Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9LXI7 (PPA20_ARATH) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 90. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable purple acid phosphatase 20

EC=3.1.3.2
Gene names
Name:PAP20
Synonyms:AT4
Ordered Locus Names:At3g52780
ORF Names:F3C22.180
OrganismArabidopsis thaliana (Mouse-ear cress) [Reference proteome]
Taxonomic identifier3702 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis

Protein attributes

Sequence length427 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

A phosphate monoester + H2O = an alcohol + phosphate.

Cofactor

Binds 1 iron ion per subunit By similarity.

Binds 1 zinc ion per subunit By similarity.

Subunit structure

Homodimer By similarity.

Subcellular location

Secreted By similarity.

Tissue specificity

Expressed flowers and siliques. Ref.5

Sequence similarities

Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   LigandIron
Metal-binding
Zinc
   Molecular functionHydrolase
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processdephosphorylation

Inferred from sequence or structural similarity Ref.5. Source: GOC

   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionacid phosphatase activity

Inferred from sequence or structural similarity Ref.5. Source: TAIR

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9LXI7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9LXI7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     338-385: SRVYQDKFDKCGPVYINIGDGGNLEGLATKYRDPNPEISLFREASFGH → VIECTKISSTNVVRFILTSEMVGI
     386-427: Missing.
Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2121 Potential
Chain22 – 427406Probable purple acid phosphatase 20
PRO_0000372823

Regions

Region330 – 3323Substrate binding By similarity

Sites

Active site3011Proton donor By similarity
Metal binding1471Iron By similarity
Metal binding1741Iron By similarity
Metal binding1741Zinc By similarity
Metal binding1771Iron By similarity
Metal binding2071Zinc By similarity
Metal binding2911Zinc By similarity
Metal binding3301Zinc By similarity
Metal binding3321Iron By similarity
Binding site2071Substrate By similarity

Amino acid modifications

Glycosylation851N-linked (GlcNAc...) Potential
Glycosylation3921N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence338 – 38548SRVYQ…ASFGH → VIECTKISSTNVVRFILTSE MVGI in isoform 2.
VSP_037200
Alternative sequence386 – 42742Missing in isoform 2.
VSP_038048

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: E9CF7BE0E26BFCCD

FASTA42748,462
        10         20         30         40         50         60 
MVKVLGLVAI LLIVLAGNVL SYDRQGTRKN LVIHPTNEDD PTFPDQVHIS LVGPDKMRIS 

        70         80         90        100        110        120 
WITQSSISPS VVYGTVSGKY EGSANGTSSS YHYLLIYRSG QINDVVIGPL KPNTVYYYKC 

       130        140        150        160        170        180 
GGPSSTQEFS FRTPPSKFPI KFAVSGDLGT SEWSKSTLEH VSKWDYDVFI LPGDLSYANM 

       190        200        210        220        230        240 
YQPLWDTFGR LVQPLASQRP WMVTHGNHEL EKIPILHSNP FTAYNKRWRM PFEESGSSSN 

       250        260        270        280        290        300 
LYYSFNVYGV HIIMLGSYTD FEPGSEQYQW LENNLKKIDR KTTPWVVAVV HAPWYNSNEA 

       310        320        330        340        350        360 
HQGEKESVEM KESMETLLYK ARVDLVFAGH VHAYERFSRV YQDKFDKCGP VYINIGDGGN 

       370        380        390        400        410        420 
LEGLATKYRD PNPEISLFRE ASFGHGQLVV ENATHARWEW HRNDDDVSVE KDSVWLTSLL 


ADSSCKI 

« Hide

Isoform 2 [UniParc].

Checksum: 219B940A509482D4
Show »

FASTA36140,933

References

« Hide 'large scale' references
[1]"Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation."
Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D.
J. Biol. Chem. 277:27772-27781(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GENE FAMILY, NOMENCLATURE.
Strain: cv. Col-1.
[2]"Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana."
Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M., Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B., Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P., De Simone V., Choisne N., Artiguenave F. expand/collapse author list , Robert C., Brottier P., Wincker P., Cattolico L., Weissenbach J., Saurin W., Quetier F., Schaefer M., Mueller-Auer S., Gabel C., Fuchs M., Benes V., Wurmbach E., Drzonek H., Erfle H., Jordan N., Bangert S., Wiedelmann R., Kranz H., Voss H., Holland R., Brandt P., Nyakatura G., Vezzi A., D'Angelo M., Pallavicini A., Toppo S., Simionati B., Conrad A., Hornischer K., Kauer G., Loehnert T.-H., Nordsiek G., Reichelt J., Scharfe M., Schoen O., Bargues M., Terol J., Climent J., Navarro P., Collado C., Perez-Perez A., Ottenwaelder B., Duchemin D., Cooke R., Laudie M., Berger-Llauro C., Purnelle B., Masuy D., de Haan M., Maarse A.C., Alcaraz J.-P., Cottet A., Casacuberta E., Monfort A., Argiriou A., Flores M., Liguori R., Vitale D., Mannhaupt G., Haase D., Schoof H., Rudd S., Zaccaria P., Mewes H.-W., Mayer K.F.X., Kaul S., Town C.D., Koo H.L., Tallon L.J., Jenkins J., Rooney T., Rizzo M., Walts A., Utterback T., Fujii C.Y., Shea T.P., Creasy T.H., Haas B., Maiti R., Wu D., Peterson J., Van Aken S., Pai G., Militscher J., Sellers P., Gill J.E., Feldblyum T.V., Preuss D., Lin X., Nierman W.C., Salzberg S.L., White O., Venter J.C., Fraser C.M., Kaneko T., Nakamura Y., Sato S., Kato T., Asamizu E., Sasamoto S., Kimura T., Idesawa K., Kawashima K., Kishida Y., Kiyokawa C., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Shinpo S., Takeuchi C., Wada T., Watanabe A., Yamada M., Yasuda M., Tabata S.
Nature 408:820-822(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Columbia.
[3]The Arabidopsis Information Resource (TAIR)
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
Cited for: GENOME REANNOTATION.
Strain: cv. Columbia.
[4]"Arabidopsis ORF clones."
Bautista V.R., Kim C.J., Chen H., Wu S.Y., De Los Reyes C., Ecker J.R.
Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: cv. Columbia.
[5]"Expression patterns of purple acid phosphatase genes in Arabidopsis organs and functional analysis of AtPAP23 predominantly transcribed in flower."
Zhu H., Qian W., Lu X., Li D., Liu X., Liu K., Wang D.
Plant Mol. Biol. 59:581-594(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF492666 mRNA. Translation: AAM15915.1.
AL353912 Genomic DNA. Translation: CAB89239.1.
CP002686 Genomic DNA. Translation: AEE78992.1.
CP002686 Genomic DNA. Translation: AEE78993.1.
BT029748 mRNA. Translation: ABM06018.1.
PIRT49031.
RefSeqNP_190846.1. NM_115138.2. [Q9LXI7-1]
NP_850686.1. NM_180355.1. [Q9LXI7-2]
UniGeneAt.35263.

3D structure databases

ProteinModelPortalQ9LXI7.
SMRQ9LXI7. Positions 44-416.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PaxDbQ9LXI7.
PRIDEQ9LXI7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsAT3G52780.1; AT3G52780.1; AT3G52780. [Q9LXI7-1]
GeneID824444.
KEGGath:AT3G52780.

Organism-specific databases

TAIRAT3G52780.

Phylogenomic databases

eggNOGCOG1409.
HOGENOMHOG000238330.
InParanoidQ9LXI7.
OMAKDPKAPM.
PhylomeDBQ9LXI7.

Enzyme and pathway databases

BioCycARA:AT3G52780-MONOMER.
ARA:GQT-2193-MONOMER.

Gene expression databases

GenevestigatorQ9LXI7.

Family and domain databases

Gene3D2.60.40.380. 1 hit.
3.60.21.10. 1 hit.
InterProIPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
IPR008963. Purple_acid_Pase-like_N.
IPR015914. Purple_acid_Pase_N.
IPR025733. Purple_acid_PPase_C_dom.
[Graphical view]
PfamPF00149. Metallophos. 1 hit.
PF14008. Metallophos_C. 1 hit.
[Graphical view]
SUPFAMSSF49363. SSF49363. 1 hit.
SSF56300. SSF56300. 1 hit.
ProtoNetSearch...

Entry information

Entry namePPA20_ARATH
AccessionPrimary (citable) accession number: Q9LXI7
Secondary accession number(s): Q3EAK8
Entry history
Integrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: October 1, 2000
Last modified: June 11, 2014
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Arabidopsis thaliana

Arabidopsis thaliana: entries and gene names