Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable purple acid phosphatase 20

Gene

PAP20

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

A phosphate monoester + H2O = an alcohol + phosphate.

Cofactori

Protein has several cofactor binding sites:
  • Fe cationBy similarityNote: Binds 1 Fe cation per subunit.By similarity
  • Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi147IronBy similarity1
Metal bindingi174IronBy similarity1
Metal bindingi174ZincBy similarity1
Metal bindingi177IronBy similarity1
Metal bindingi207ZincBy similarity1
Binding sitei207SubstrateBy similarity1
Metal bindingi291ZincBy similarity1
Active sitei301Proton donorBy similarity1
Metal bindingi330ZincBy similarity1
Metal bindingi332IronBy similarity1

GO - Molecular functioni

  • acid phosphatase activity Source: TAIR
  • metal ion binding Source: UniProtKB-KW

Keywordsi

Molecular functionHydrolase
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciARA:AT3G52780-MONOMER

Names & Taxonomyi

Protein namesi
Recommended name:
Probable purple acid phosphatase 20 (EC:3.1.3.2)
Gene namesi
Name:PAP20
Synonyms:AT4
Ordered Locus Names:At3g52780
ORF Names:F3C22.180
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 3

Organism-specific databases

AraportiAT3G52780
TAIRilocus:2083288 AT3G52780

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000037282322 – 427Probable purple acid phosphatase 20Add BLAST406

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi85N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi392N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9LXI7
PRIDEiQ9LXI7

Expressioni

Tissue specificityi

Expressed flowers and siliques.1 Publication

Gene expression databases

ExpressionAtlasiQ9LXI7 baseline and differential
GenevisibleiQ9LXI7 AT

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

STRINGi3702.AT3G52780.1

Structurei

3D structure databases

ProteinModelPortaliQ9LXI7
SMRiQ9LXI7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni330 – 332Substrate bindingBy similarity3

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1378 Eukaryota
COG1409 LUCA
HOGENOMiHOG000238330
InParanoidiQ9LXI7
KOiK22390
OMAiNATHAQW
OrthoDBiEOG09360B5T
PhylomeDBiQ9LXI7

Family and domain databases

Gene3Di2.60.40.380, 1 hit
3.60.21.10, 1 hit
InterProiView protein in InterPro
IPR004843 Calcineurin-like_PHP_ApaH
IPR029052 Metallo-depent_PP-like
IPR008963 Purple_acid_Pase-like_N
IPR015914 Purple_acid_Pase_N
IPR025733 Purple_acid_PPase_C_dom
PfamiView protein in Pfam
PF00149 Metallophos, 1 hit
PF14008 Metallophos_C, 1 hit
PF16656 Pur_ac_phosph_N, 1 hit
SUPFAMiSSF49363 SSF49363, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9LXI7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKVLGLVAI LLIVLAGNVL SYDRQGTRKN LVIHPTNEDD PTFPDQVHIS
60 70 80 90 100
LVGPDKMRIS WITQSSISPS VVYGTVSGKY EGSANGTSSS YHYLLIYRSG
110 120 130 140 150
QINDVVIGPL KPNTVYYYKC GGPSSTQEFS FRTPPSKFPI KFAVSGDLGT
160 170 180 190 200
SEWSKSTLEH VSKWDYDVFI LPGDLSYANM YQPLWDTFGR LVQPLASQRP
210 220 230 240 250
WMVTHGNHEL EKIPILHSNP FTAYNKRWRM PFEESGSSSN LYYSFNVYGV
260 270 280 290 300
HIIMLGSYTD FEPGSEQYQW LENNLKKIDR KTTPWVVAVV HAPWYNSNEA
310 320 330 340 350
HQGEKESVEM KESMETLLYK ARVDLVFAGH VHAYERFSRV YQDKFDKCGP
360 370 380 390 400
VYINIGDGGN LEGLATKYRD PNPEISLFRE ASFGHGQLVV ENATHARWEW
410 420
HRNDDDVSVE KDSVWLTSLL ADSSCKI
Length:427
Mass (Da):48,462
Last modified:October 1, 2000 - v1
Checksum:iE9CF7BE0E26BFCCD
GO
Isoform 2 (identifier: Q9LXI7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     338-385: SRVYQDKFDKCGPVYINIGDGGNLEGLATKYRDPNPEISLFREASFGH → VIECTKISSTNVVRFILTSEMVGI
     386-427: Missing.

Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.
Show »
Length:361
Mass (Da):40,933
Checksum:i219B940A509482D4
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_037200338 – 385SRVYQ…ASFGH → VIECTKISSTNVVRFILTSE MVGI in isoform 2. CuratedAdd BLAST48
Alternative sequenceiVSP_038048386 – 427Missing in isoform 2. CuratedAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492666 mRNA Translation: AAM15915.1
AL353912 Genomic DNA Translation: CAB89239.1
CP002686 Genomic DNA Translation: AEE78992.1
CP002686 Genomic DNA Translation: AEE78993.1
BT029748 mRNA Translation: ABM06018.1
PIRiT49031
RefSeqiNP_190846.1, NM_115138.3 [Q9LXI7-1]
NP_850686.1, NM_180355.1 [Q9LXI7-2]
UniGeneiAt.35263

Genome annotation databases

EnsemblPlantsiAT3G52780.1; AT3G52780.1; AT3G52780 [Q9LXI7-1]
AT3G52780.2; AT3G52780.2; AT3G52780 [Q9LXI7-2]
GeneIDi824444
GrameneiAT3G52780.1; AT3G52780.1; AT3G52780 [Q9LXI7-1]
AT3G52780.2; AT3G52780.2; AT3G52780 [Q9LXI7-2]
KEGGiath:AT3G52780

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPPA20_ARATH
AccessioniPrimary (citable) accession number: Q9LXI7
Secondary accession number(s): Q3EAK8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: October 1, 2000
Last modified: April 25, 2018
This is version 114 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health