Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9LXI7

- PPA20_ARATH

UniProt

Q9LXI7 - PPA20_ARATH

Protein

Probable purple acid phosphatase 20

Gene

PAP20

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    A phosphate monoester + H2O = an alcohol + phosphate.

    Cofactori

    Binds 1 iron ion per subunit.By similarity
    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi147 – 1471IronBy similarity
    Metal bindingi174 – 1741IronBy similarity
    Metal bindingi174 – 1741ZincBy similarity
    Metal bindingi177 – 1771IronBy similarity
    Metal bindingi207 – 2071ZincBy similarity
    Binding sitei207 – 2071SubstrateBy similarity
    Metal bindingi291 – 2911ZincBy similarity
    Active sitei301 – 3011Proton donorBy similarity
    Metal bindingi330 – 3301ZincBy similarity
    Metal bindingi332 – 3321IronBy similarity

    GO - Molecular functioni

    1. acid phosphatase activity Source: TAIR
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. dephosphorylation Source: GOC

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    Iron, Metal-binding, Zinc

    Enzyme and pathway databases

    BioCyciARA:AT3G52780-MONOMER.
    ARA:GQT-2193-MONOMER.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable purple acid phosphatase 20 (EC:3.1.3.2)
    Gene namesi
    Name:PAP20
    Synonyms:AT4
    Ordered Locus Names:At3g52780
    ORF Names:F3C22.180
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 3

    Organism-specific databases

    TAIRiAT3G52780.

    Subcellular locationi

    Secreted By similarity

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Sequence AnalysisAdd
    BLAST
    Chaini22 – 427406Probable purple acid phosphatase 20PRO_0000372823Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi85 – 851N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi392 – 3921N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9LXI7.
    PRIDEiQ9LXI7.

    Expressioni

    Tissue specificityi

    Expressed flowers and siliques.1 Publication

    Gene expression databases

    GenevestigatoriQ9LXI7.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ9LXI7.
    SMRiQ9LXI7. Positions 44-416.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni330 – 3323Substrate bindingBy similarity

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG1409.
    HOGENOMiHOG000238330.
    InParanoidiQ9LXI7.
    OMAiKDPKAPM.
    PhylomeDBiQ9LXI7.

    Family and domain databases

    Gene3Di2.60.40.380. 1 hit.
    3.60.21.10. 1 hit.
    InterProiIPR004843. Calcineurin-like_PHP_apaH.
    IPR029052. Metallo-depent_PP-like.
    IPR008963. Purple_acid_Pase-like_N.
    IPR015914. Purple_acid_Pase_N.
    IPR025733. Purple_acid_PPase_C_dom.
    [Graphical view]
    PfamiPF00149. Metallophos. 1 hit.
    PF14008. Metallophos_C. 1 hit.
    [Graphical view]
    SUPFAMiSSF49363. SSF49363. 1 hit.
    SSF56300. SSF56300. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9LXI7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVKVLGLVAI LLIVLAGNVL SYDRQGTRKN LVIHPTNEDD PTFPDQVHIS    50
    LVGPDKMRIS WITQSSISPS VVYGTVSGKY EGSANGTSSS YHYLLIYRSG 100
    QINDVVIGPL KPNTVYYYKC GGPSSTQEFS FRTPPSKFPI KFAVSGDLGT 150
    SEWSKSTLEH VSKWDYDVFI LPGDLSYANM YQPLWDTFGR LVQPLASQRP 200
    WMVTHGNHEL EKIPILHSNP FTAYNKRWRM PFEESGSSSN LYYSFNVYGV 250
    HIIMLGSYTD FEPGSEQYQW LENNLKKIDR KTTPWVVAVV HAPWYNSNEA 300
    HQGEKESVEM KESMETLLYK ARVDLVFAGH VHAYERFSRV YQDKFDKCGP 350
    VYINIGDGGN LEGLATKYRD PNPEISLFRE ASFGHGQLVV ENATHARWEW 400
    HRNDDDVSVE KDSVWLTSLL ADSSCKI 427
    Length:427
    Mass (Da):48,462
    Last modified:October 1, 2000 - v1
    Checksum:iE9CF7BE0E26BFCCD
    GO
    Isoform 2 (identifier: Q9LXI7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         338-385: SRVYQDKFDKCGPVYINIGDGGNLEGLATKYRDPNPEISLFREASFGH → VIECTKISSTNVVRFILTSEMVGI
         386-427: Missing.

    Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.

    Show »
    Length:361
    Mass (Da):40,933
    Checksum:i219B940A509482D4
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei338 – 38548SRVYQ…ASFGH → VIECTKISSTNVVRFILTSE MVGI in isoform 2. CuratedVSP_037200Add
    BLAST
    Alternative sequencei386 – 42742Missing in isoform 2. CuratedVSP_038048Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF492666 mRNA. Translation: AAM15915.1.
    AL353912 Genomic DNA. Translation: CAB89239.1.
    CP002686 Genomic DNA. Translation: AEE78992.1.
    CP002686 Genomic DNA. Translation: AEE78993.1.
    BT029748 mRNA. Translation: ABM06018.1.
    PIRiT49031.
    RefSeqiNP_190846.1. NM_115138.2. [Q9LXI7-1]
    NP_850686.1. NM_180355.1. [Q9LXI7-2]
    UniGeneiAt.35263.

    Genome annotation databases

    EnsemblPlantsiAT3G52780.1; AT3G52780.1; AT3G52780. [Q9LXI7-1]
    GeneIDi824444.
    KEGGiath:AT3G52780.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF492666 mRNA. Translation: AAM15915.1 .
    AL353912 Genomic DNA. Translation: CAB89239.1 .
    CP002686 Genomic DNA. Translation: AEE78992.1 .
    CP002686 Genomic DNA. Translation: AEE78993.1 .
    BT029748 mRNA. Translation: ABM06018.1 .
    PIRi T49031.
    RefSeqi NP_190846.1. NM_115138.2. [Q9LXI7-1 ]
    NP_850686.1. NM_180355.1. [Q9LXI7-2 ]
    UniGenei At.35263.

    3D structure databases

    ProteinModelPortali Q9LXI7.
    SMRi Q9LXI7. Positions 44-416.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q9LXI7.
    PRIDEi Q9LXI7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT3G52780.1 ; AT3G52780.1 ; AT3G52780 . [Q9LXI7-1 ]
    GeneIDi 824444.
    KEGGi ath:AT3G52780.

    Organism-specific databases

    TAIRi AT3G52780.

    Phylogenomic databases

    eggNOGi COG1409.
    HOGENOMi HOG000238330.
    InParanoidi Q9LXI7.
    OMAi KDPKAPM.
    PhylomeDBi Q9LXI7.

    Enzyme and pathway databases

    BioCyci ARA:AT3G52780-MONOMER.
    ARA:GQT-2193-MONOMER.

    Gene expression databases

    Genevestigatori Q9LXI7.

    Family and domain databases

    Gene3Di 2.60.40.380. 1 hit.
    3.60.21.10. 1 hit.
    InterProi IPR004843. Calcineurin-like_PHP_apaH.
    IPR029052. Metallo-depent_PP-like.
    IPR008963. Purple_acid_Pase-like_N.
    IPR015914. Purple_acid_Pase_N.
    IPR025733. Purple_acid_PPase_C_dom.
    [Graphical view ]
    Pfami PF00149. Metallophos. 1 hit.
    PF14008. Metallophos_C. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49363. SSF49363. 1 hit.
    SSF56300. SSF56300. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation."
      Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D.
      J. Biol. Chem. 277:27772-27781(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GENE FAMILY, NOMENCLATURE.
      Strain: cv. Col-1.
    2. "Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana."
      Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M., Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B., Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P., De Simone V., Choisne N., Artiguenave F.
      , Robert C., Brottier P., Wincker P., Cattolico L., Weissenbach J., Saurin W., Quetier F., Schaefer M., Mueller-Auer S., Gabel C., Fuchs M., Benes V., Wurmbach E., Drzonek H., Erfle H., Jordan N., Bangert S., Wiedelmann R., Kranz H., Voss H., Holland R., Brandt P., Nyakatura G., Vezzi A., D'Angelo M., Pallavicini A., Toppo S., Simionati B., Conrad A., Hornischer K., Kauer G., Loehnert T.-H., Nordsiek G., Reichelt J., Scharfe M., Schoen O., Bargues M., Terol J., Climent J., Navarro P., Collado C., Perez-Perez A., Ottenwaelder B., Duchemin D., Cooke R., Laudie M., Berger-Llauro C., Purnelle B., Masuy D., de Haan M., Maarse A.C., Alcaraz J.-P., Cottet A., Casacuberta E., Monfort A., Argiriou A., Flores M., Liguori R., Vitale D., Mannhaupt G., Haase D., Schoof H., Rudd S., Zaccaria P., Mewes H.-W., Mayer K.F.X., Kaul S., Town C.D., Koo H.L., Tallon L.J., Jenkins J., Rooney T., Rizzo M., Walts A., Utterback T., Fujii C.Y., Shea T.P., Creasy T.H., Haas B., Maiti R., Wu D., Peterson J., Van Aken S., Pai G., Militscher J., Sellers P., Gill J.E., Feldblyum T.V., Preuss D., Lin X., Nierman W.C., Salzberg S.L., White O., Venter J.C., Fraser C.M., Kaneko T., Nakamura Y., Sato S., Kato T., Asamizu E., Sasamoto S., Kimura T., Idesawa K., Kawashima K., Kishida Y., Kiyokawa C., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Shinpo S., Takeuchi C., Wada T., Watanabe A., Yamada M., Yasuda M., Tabata S.
      Nature 408:820-822(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    3. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    4. "Arabidopsis ORF clones."
      Bautista V.R., Kim C.J., Chen H., Wu S.Y., De Los Reyes C., Ecker J.R.
      Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: cv. Columbia.
    5. "Expression patterns of purple acid phosphatase genes in Arabidopsis organs and functional analysis of AtPAP23 predominantly transcribed in flower."
      Zhu H., Qian W., Lu X., Li D., Liu X., Liu K., Wang D.
      Plant Mol. Biol. 59:581-594(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiPPA20_ARATH
    AccessioniPrimary (citable) accession number: Q9LXI7
    Secondary accession number(s): Q3EAK8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 5, 2009
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 91 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3