Q9LXI7 (PPA20_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable purple acid phosphatase 20 EC=3.1.3.2 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 427 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | A phosphate monoester + H2O = an alcohol + phosphate. |
| Cofactor | Binds 1 iron ion per subunit By similarity. Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Homodimer By similarity. |
| Subcellular location | Secreted By similarity. |
| Tissue specificity | Expressed flowers and siliques. Ref.5 |
| Sequence similarities | Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Ligand | Iron Metal-binding Zinc |
| Molecular function | Hydrolase |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | acid phosphatase activity Inferred from sequence or structural similarity Ref.5. Source: TAIR metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9LXI7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9LXI7-2) The sequence of this isoform differs from the canonical sequence as follows: 338-385: SRVYQDKFDKCGPVYINIGDGGNLEGLATKYRDPNPEISLFREASFGH → VIECTKISSTNVVRFILTSEMVGI 386-427: Missing. | ||||||
| Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||
| Chain | 22 – 427 | 406 | Probable purple acid phosphatase 20 | PRO_0000372823 | |||||
Regions | |||||||||
| Region | 330 – 332 | 3 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 301 | 1 | Proton donor By similarity | ||||||
| Metal binding | 147 | 1 | Iron By similarity | ||||||
| Metal binding | 174 | 1 | Iron By similarity | ||||||
| Metal binding | 174 | 1 | Zinc By similarity | ||||||
| Metal binding | 177 | 1 | Iron By similarity | ||||||
| Metal binding | 207 | 1 | Zinc By similarity | ||||||
| Metal binding | 291 | 1 | Zinc By similarity | ||||||
| Metal binding | 330 | 1 | Zinc By similarity | ||||||
| Metal binding | 332 | 1 | Iron By similarity | ||||||
| Binding site | 207 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 85 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 392 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 338 – 385 | 48 | SRVYQ…ASFGH → VIECTKISSTNVVRFILTSE MVGI in isoform 2. | VSP_037200 | |||||
| Alternative sequence | 386 – 427 | 42 | Missing in isoform 2. | VSP_038048 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation." Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D. J. Biol. Chem. 277:27772-27781(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GENE FAMILY, NOMENCLATURE. Strain: cv. Col-1. |
| [2] | "Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana." Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M., Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B., Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P., De Simone V., Choisne N., Artiguenave F. Tabata S.Nature 408:820-822(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [3] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [4] | "Arabidopsis ORF clones." Bautista V.R., Kim C.J., Chen H., Wu S.Y., De Los Reyes C., Ecker J.R. Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: cv. Columbia. |
| [5] | "Expression patterns of purple acid phosphatase genes in Arabidopsis organs and functional analysis of AtPAP23 predominantly transcribed in flower." Zhu H., Qian W., Lu X., Li D., Liu X., Liu K., Wang D. Plant Mol. Biol. 59:581-594(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF492666 mRNA. Translation: AAM15915.1. AL353912 Genomic DNA. Translation: CAB89239.1. CP002686 Genomic DNA. Translation: AEE78992.1. CP002686 Genomic DNA. Translation: AEE78993.1. BT029748 mRNA. Translation: ABM06018.1. |
| IPI | IPI00517643. IPI00545298. |
| PIR | T49031. |
| RefSeq | NP_190846.1. NM_115138.2. NP_850686.1. NM_180355.1. |
| UniGene | At.35263. |
3D structure databases | |
| HSSP | HSSP built from PDB template 4KBP based on UniProtKB P80366. |
| ProteinModelPortal | Q9LXI7. |
| SMR | Q9LXI7. Positions 44-416. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q9LXI7. |
| PRIDE | Q9LXI7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT3G52780.1; AT3G52780.1; AT3G52780. |
| GeneID | 824444. |
| KEGG | ath:AT3G52780. |
Organism-specific databases | |
| TAIR | At3g52780. |
Phylogenomic databases | |
| eggNOG | COG1409. |
| HOGENOM | HOG000238330. |
| InParanoid | Q9LXI7. |
| OMA | GNHESAY. |
| PhylomeDB | Q9LXI7. |
| ProtClustDB | PLN02533. |
Gene expression databases | |
| Genevestigator | Q9LXI7. |
Family and domain databases | |
| Gene3D | 2.60.40.380. 1 hit. |
| InterPro | IPR004843. Metallo_PEstase_dom. IPR008963. Purple_acid_Pase-like_N. IPR015914. Purple_acid_Pase_N. IPR025733. Purple_acid_PPase_C_dom. [Graphical view] |
| Pfam | PF00149. Metallophos. 1 hit. PF14008. Metallophos_C. 1 hit. [Graphical view] |
| SUPFAM | SSF49363. Purple_Pase_N. 1 hit. |
| ProtoNet | Search... |
Entry information
| Entry name | PPA20_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9LXI7 Secondary accession number(s): Q3EAK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
