Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable purple acid phosphatase 20

Gene

PAP20

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

A phosphate monoester + H2O = an alcohol + phosphate.

Cofactori

Protein has several cofactor binding sites:
  • Fe cationBy similarityNote: Binds 1 Fe cation per subunit.By similarity
  • Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi147 – 1471IronBy similarity
Metal bindingi174 – 1741IronBy similarity
Metal bindingi174 – 1741ZincBy similarity
Metal bindingi177 – 1771IronBy similarity
Metal bindingi207 – 2071ZincBy similarity
Binding sitei207 – 2071SubstrateBy similarity
Metal bindingi291 – 2911ZincBy similarity
Active sitei301 – 3011Proton donorBy similarity
Metal bindingi330 – 3301ZincBy similarity
Metal bindingi332 – 3321IronBy similarity

GO - Molecular functioni

  • acid phosphatase activity Source: TAIR
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • dephosphorylation Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Iron, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciARA:AT3G52780-MONOMER.
ARA:GQT-2193-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable purple acid phosphatase 20 (EC:3.1.3.2)
Gene namesi
Name:PAP20
Synonyms:AT4
Ordered Locus Names:At3g52780
ORF Names:F3C22.180
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548 Componenti: Chromosome 3

Organism-specific databases

TAIRiAT3G52780.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence AnalysisAdd
BLAST
Chaini22 – 427406Probable purple acid phosphatase 20PRO_0000372823Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi85 – 851N-linked (GlcNAc...)Sequence Analysis
Glycosylationi392 – 3921N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9LXI7.
PRIDEiQ9LXI7.

Expressioni

Tissue specificityi

Expressed flowers and siliques.1 Publication

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

STRINGi3702.AT3G52780.1.

Structurei

3D structure databases

ProteinModelPortaliQ9LXI7.
SMRiQ9LXI7. Positions 44-416.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni330 – 3323Substrate bindingBy similarity

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1409.
HOGENOMiHOG000238330.
InParanoidiQ9LXI7.
OMAiHVAADDY.
PhylomeDBiQ9LXI7.

Family and domain databases

Gene3Di2.60.40.380. 1 hit.
3.60.21.10. 1 hit.
InterProiIPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
IPR008963. Purple_acid_Pase-like_N.
IPR015914. Purple_acid_Pase_N.
IPR025733. Purple_acid_PPase_C_dom.
[Graphical view]
PfamiPF00149. Metallophos. 1 hit.
PF14008. Metallophos_C. 1 hit.
[Graphical view]
SUPFAMiSSF49363. SSF49363. 1 hit.
SSF56300. SSF56300. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9LXI7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKVLGLVAI LLIVLAGNVL SYDRQGTRKN LVIHPTNEDD PTFPDQVHIS
60 70 80 90 100
LVGPDKMRIS WITQSSISPS VVYGTVSGKY EGSANGTSSS YHYLLIYRSG
110 120 130 140 150
QINDVVIGPL KPNTVYYYKC GGPSSTQEFS FRTPPSKFPI KFAVSGDLGT
160 170 180 190 200
SEWSKSTLEH VSKWDYDVFI LPGDLSYANM YQPLWDTFGR LVQPLASQRP
210 220 230 240 250
WMVTHGNHEL EKIPILHSNP FTAYNKRWRM PFEESGSSSN LYYSFNVYGV
260 270 280 290 300
HIIMLGSYTD FEPGSEQYQW LENNLKKIDR KTTPWVVAVV HAPWYNSNEA
310 320 330 340 350
HQGEKESVEM KESMETLLYK ARVDLVFAGH VHAYERFSRV YQDKFDKCGP
360 370 380 390 400
VYINIGDGGN LEGLATKYRD PNPEISLFRE ASFGHGQLVV ENATHARWEW
410 420
HRNDDDVSVE KDSVWLTSLL ADSSCKI
Length:427
Mass (Da):48,462
Last modified:October 1, 2000 - v1
Checksum:iE9CF7BE0E26BFCCD
GO
Isoform 2 (identifier: Q9LXI7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     338-385: SRVYQDKFDKCGPVYINIGDGGNLEGLATKYRDPNPEISLFREASFGH → VIECTKISSTNVVRFILTSEMVGI
     386-427: Missing.

Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.
Show »
Length:361
Mass (Da):40,933
Checksum:i219B940A509482D4
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei338 – 38548SRVYQ…ASFGH → VIECTKISSTNVVRFILTSE MVGI in isoform 2. CuratedVSP_037200Add
BLAST
Alternative sequencei386 – 42742Missing in isoform 2. CuratedVSP_038048Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492666 mRNA. Translation: AAM15915.1.
AL353912 Genomic DNA. Translation: CAB89239.1.
CP002686 Genomic DNA. Translation: AEE78992.1.
CP002686 Genomic DNA. Translation: AEE78993.1.
BT029748 mRNA. Translation: ABM06018.1.
PIRiT49031.
RefSeqiNP_190846.1. NM_115138.2. [Q9LXI7-1]
NP_850686.1. NM_180355.1. [Q9LXI7-2]
UniGeneiAt.35263.

Genome annotation databases

EnsemblPlantsiAT3G52780.1; AT3G52780.1; AT3G52780. [Q9LXI7-1]
GeneIDi824444.
KEGGiath:AT3G52780.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492666 mRNA. Translation: AAM15915.1.
AL353912 Genomic DNA. Translation: CAB89239.1.
CP002686 Genomic DNA. Translation: AEE78992.1.
CP002686 Genomic DNA. Translation: AEE78993.1.
BT029748 mRNA. Translation: ABM06018.1.
PIRiT49031.
RefSeqiNP_190846.1. NM_115138.2. [Q9LXI7-1]
NP_850686.1. NM_180355.1. [Q9LXI7-2]
UniGeneiAt.35263.

3D structure databases

ProteinModelPortaliQ9LXI7.
SMRiQ9LXI7. Positions 44-416.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT3G52780.1.

Proteomic databases

PaxDbiQ9LXI7.
PRIDEiQ9LXI7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT3G52780.1; AT3G52780.1; AT3G52780. [Q9LXI7-1]
GeneIDi824444.
KEGGiath:AT3G52780.

Organism-specific databases

TAIRiAT3G52780.

Phylogenomic databases

eggNOGiCOG1409.
HOGENOMiHOG000238330.
InParanoidiQ9LXI7.
OMAiHVAADDY.
PhylomeDBiQ9LXI7.

Enzyme and pathway databases

BioCyciARA:AT3G52780-MONOMER.
ARA:GQT-2193-MONOMER.

Miscellaneous databases

PROiQ9LXI7.

Family and domain databases

Gene3Di2.60.40.380. 1 hit.
3.60.21.10. 1 hit.
InterProiIPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
IPR008963. Purple_acid_Pase-like_N.
IPR015914. Purple_acid_Pase_N.
IPR025733. Purple_acid_PPase_C_dom.
[Graphical view]
PfamiPF00149. Metallophos. 1 hit.
PF14008. Metallophos_C. 1 hit.
[Graphical view]
SUPFAMiSSF49363. SSF49363. 1 hit.
SSF56300. SSF56300. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation."
    Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D.
    J. Biol. Chem. 277:27772-27781(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GENE FAMILY, NOMENCLATURE.
    Strain: cv. Col-1.
  2. "Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana."
    Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M., Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B., Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P., De Simone V., Choisne N., Artiguenave F.
    , Robert C., Brottier P., Wincker P., Cattolico L., Weissenbach J., Saurin W., Quetier F., Schaefer M., Mueller-Auer S., Gabel C., Fuchs M., Benes V., Wurmbach E., Drzonek H., Erfle H., Jordan N., Bangert S., Wiedelmann R., Kranz H., Voss H., Holland R., Brandt P., Nyakatura G., Vezzi A., D'Angelo M., Pallavicini A., Toppo S., Simionati B., Conrad A., Hornischer K., Kauer G., Loehnert T.-H., Nordsiek G., Reichelt J., Scharfe M., Schoen O., Bargues M., Terol J., Climent J., Navarro P., Collado C., Perez-Perez A., Ottenwaelder B., Duchemin D., Cooke R., Laudie M., Berger-Llauro C., Purnelle B., Masuy D., de Haan M., Maarse A.C., Alcaraz J.-P., Cottet A., Casacuberta E., Monfort A., Argiriou A., Flores M., Liguori R., Vitale D., Mannhaupt G., Haase D., Schoof H., Rudd S., Zaccaria P., Mewes H.-W., Mayer K.F.X., Kaul S., Town C.D., Koo H.L., Tallon L.J., Jenkins J., Rooney T., Rizzo M., Walts A., Utterback T., Fujii C.Y., Shea T.P., Creasy T.H., Haas B., Maiti R., Wu D., Peterson J., Van Aken S., Pai G., Militscher J., Sellers P., Gill J.E., Feldblyum T.V., Preuss D., Lin X., Nierman W.C., Salzberg S.L., White O., Venter J.C., Fraser C.M., Kaneko T., Nakamura Y., Sato S., Kato T., Asamizu E., Sasamoto S., Kimura T., Idesawa K., Kawashima K., Kishida Y., Kiyokawa C., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Shinpo S., Takeuchi C., Wada T., Watanabe A., Yamada M., Yasuda M., Tabata S.
    Nature 408:820-822(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  3. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  4. "Arabidopsis ORF clones."
    Bautista V.R., Kim C.J., Chen H., Wu S.Y., De Los Reyes C., Ecker J.R.
    Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  5. "Expression patterns of purple acid phosphatase genes in Arabidopsis organs and functional analysis of AtPAP23 predominantly transcribed in flower."
    Zhu H., Qian W., Lu X., Li D., Liu X., Liu K., Wang D.
    Plant Mol. Biol. 59:581-594(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiPPA20_ARATH
AccessioniPrimary (citable) accession number: Q9LXI7
Secondary accession number(s): Q3EAK8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: October 1, 2000
Last modified: July 22, 2015
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.