Reviewed,
UniProtKB/Swiss-Prot Q9LFD2 (LAC8_ARATH)
Last modified
November 3, 2009.
Version 50.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Laccase-8 EC=1.10.3.2 Alternative name(s): Benzenediol:oxygen oxidoreductase 8 Urishiol oxidase 8 Diphenol oxidase 8 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Complete proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › eurosids II › Brassicales › Brassicaceae › Arabidopsis |
Protein attributes
| Sequence length | 584 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Lignin degradation and detoxification of lignin-derived products By similarity. Involved in the flowering time inhibition. |
| Catalytic activity | 4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O. |
| Cofactor | Binds 4 copper ions per monomer By similarity. |
| Subcellular location | Secreted › extracellular space › apoplast Potential. |
| Tissue specificity | Predominantly expressed in tissues other than the inflorescence stem, especially in roots. Ref.4 Ref.5 |
| Developmental stage | Expressed along a developmental gradient in the inflorescence stem, with higher levels in olders organs and low levels in young tissues. Ref.4 |
| Sequence similarities | Belongs to the multicopper oxidase family. Contains 3 plastocyanin-like domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lignin degradation |
| Cellular component | Apoplast Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal |
| Ligand | Copper Metal-binding |
| Molecular function | Oxidoreductase |
| PTM | Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | lignin catabolic process Inferred from electronic annotation. Source: UniProtKB-KW oxidation reductionInferred from electronic annotation. Source: UniProtKB-KW vegetative to reproductive phase transition Ref.5Inferred from mutant phenotype. Source: TAIR |
| Cellular component | apoplast Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | copper ion binding Inferred from electronic annotation. Source: UniProtKB-KW laccase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9LFD2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9LFD2-2) The sequence of this isoform differs from the canonical sequence as follows: 203-234: RMFNLKVVQGKTYLLRIVNAALNTHLFFKIAN → SNTHSLLESKVTFYCKLFTKNRINFYFYFWLW 235-584: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||
| Chain | 26 – 584 | 559 | Laccase-8 | PRO_0000283636 | |||||
Regions | |||||||||
| Domain | 33 – 149 | 117 | Plastocyanin-like 1 | ||||||
| Domain | 159 – 306 | 148 | Plastocyanin-like 2 | ||||||
| Domain | 410 – 550 | 141 | Plastocyanin-like 3 | ||||||
Sites | |||||||||
| Metal binding | 83 | 1 | Copper 1; type 2 By similarity | ||||||
| Metal binding | 85 | 1 | Copper 2; type 3 By similarity | ||||||
| Metal binding | 128 | 1 | Copper 2; type 3 By similarity | ||||||
| Metal binding | 130 | 1 | Copper 3; type 3 By similarity | ||||||
| Metal binding | 467 | 1 | Copper 4; type 1 By similarity | ||||||
| Metal binding | 470 | 1 | Copper 1; type 2 By similarity | ||||||
| Metal binding | 472 | 1 | Copper 3; type 3 By similarity | ||||||
| Metal binding | 529 | 1 | Copper 3; type 3 By similarity | ||||||
| Metal binding | 530 | 1 | Copper 4; type 1 By similarity | ||||||
| Metal binding | 531 | 1 | Copper 2; type 3 By similarity | ||||||
| Metal binding | 535 | 1 | Copper 4; type 1 By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 52 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 75 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 79 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 111 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 236 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 332 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 384 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 402 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 449 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 203 – 234 | 32 | RMFNL…FKIAN → SNTHSLLESKVTFYCKLFTK NRINFYFYFWLW in isoform 2. | VSP_024348 | |||||
| Alternative sequence | 235 – 584 | 350 | Missing in isoform 2. | VSP_024349 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AL137189 Genomic DNA. Translation: CAB69832.1. AK117360 mRNA. Translation: BAC42030.1. AK176457 mRNA. Translation: BAD44220.1. | |
| IPI | IPI00526470. IPI00845130. |
| PIR | T45944. |
| RefSeq | NP_195724.1. |
| UniGene | At.27905 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1AOZ based on UniProtKB P37064. |
| ModBase | Search... |
Genome annotation databases | |
| GeneID | 831877. |
| GenomeReviews | Gene locus AT5G01040 in contig BA000015_GR. |
| KEGG | ath:AT5G01040. |
| NMPDR | fig|3702.1.peg.22165. |
Organism-specific databases | |
| TAIR | At5g01040. |
Phylogenomic databases | |
| OMA | NSEDTEA. |
Enzyme and pathway databases | |
| BRENDA | 1.10.3.2. 302. |
Gene expression databases | |
| Genevestigator | Q9LFD2. |
Family and domain databases | |
| InterPro | IPR001117. Cu-oxidase. IPR011706. Cu-oxidase_2. IPR011707. Cu-oxidase_3. IPR002355. Cu_oxidase_Cu_BS. IPR008972. Cupredoxin. IPR017761. Laccase. [Graphical view] |
| Gene3D | G3DSA:2.60.40.420. Cupredoxin. 3 hits. |
| Pfam | PF00394. Cu-oxidase. 1 hit. PF07731. Cu-oxidase_2. 1 hit. PF07732. Cu-oxidase_3. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR03389. laccase. 1 hit. |
| PROSITE | PS00079. MULTICOPPER_OXIDASE1. False negative. PS00080. MULTICOPPER_OXIDASE2. False negative. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | LAC8_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9LFD2 Secondary accession number(s): Q67YL1, Q8GYV9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | PPAP (Plant Proteome Annotation Project) | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with


