Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9LFD2

- LAC8_ARATH

UniProt

Q9LFD2 - LAC8_ARATH

Protein

Laccase-8

Gene

LAC8

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Lignin degradation and detoxification of lignin-derived products By similarity. Involved in the flowering time inhibition.By similarity1 Publication

    Catalytic activityi

    4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O.

    Cofactori

    Binds 4 copper ions per monomer.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi83 – 831Copper 1; type 2By similarity
    Metal bindingi85 – 851Copper 2; type 3By similarity
    Metal bindingi128 – 1281Copper 2; type 3By similarity
    Metal bindingi130 – 1301Copper 3; type 3By similarity
    Metal bindingi467 – 4671Copper 4; type 1By similarity
    Metal bindingi470 – 4701Copper 1; type 2By similarity
    Metal bindingi472 – 4721Copper 3; type 3By similarity
    Metal bindingi529 – 5291Copper 3; type 3By similarity
    Metal bindingi530 – 5301Copper 4; type 1By similarity
    Metal bindingi531 – 5311Copper 2; type 3By similarity
    Metal bindingi535 – 5351Copper 4; type 1By similarity

    GO - Molecular functioni

    1. copper ion binding Source: InterPro
    2. hydroquinone:oxygen oxidoreductase activity Source: UniProtKB-EC

    GO - Biological processi

    1. lignin catabolic process Source: UniProtKB-KW
    2. response to copper ion Source: TAIR
    3. vegetative to reproductive phase transition of meristem Source: TAIR

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Lignin degradation

    Keywords - Ligandi

    Copper, Metal-binding

    Enzyme and pathway databases

    BioCyciARA:AT5G01040-MONOMER.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Laccase-8 (EC:1.10.3.2)
    Alternative name(s):
    Benzenediol:oxygen oxidoreductase 8
    Diphenol oxidase 8
    Urishiol oxidase 8
    Gene namesi
    Name:LAC8
    Ordered Locus Names:At5g01040
    ORF Names:F7J8.20
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 5

    Organism-specific databases

    TAIRiAT5G01040.

    Subcellular locationi

    GO - Cellular componenti

    1. apoplast Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Apoplast, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 584559Laccase-8PRO_0000283636Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi52 – 521N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi75 – 751N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi111 – 1111N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi236 – 2361N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi332 – 3321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi384 – 3841N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi402 – 4021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi449 – 4491N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Expressioni

    Tissue specificityi

    Predominantly expressed in tissues other than the inflorescence stem, especially in roots.2 Publications

    Developmental stagei

    Expressed along a developmental gradient in the inflorescence stem, with higher levels in olders organs and low levels in young tissues.1 Publication

    Gene expression databases

    GenevestigatoriQ9LFD2.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9LFD2.
    SMRiQ9LFD2. Positions 45-575.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini33 – 149117Plastocyanin-like 1Add
    BLAST
    Domaini159 – 306148Plastocyanin-like 2Add
    BLAST
    Domaini410 – 550141Plastocyanin-like 3Add
    BLAST

    Sequence similaritiesi

    Belongs to the multicopper oxidase family.Curated
    Contains 3 plastocyanin-like domains.Curated

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    eggNOGiCOG2132.
    HOGENOMiHOG000241916.
    InParanoidiQ9LFD2.
    OMAiAYFYNIS.
    PhylomeDBiQ9LFD2.

    Family and domain databases

    Gene3Di2.60.40.420. 3 hits.
    InterProiIPR001117. Cu-oxidase.
    IPR011706. Cu-oxidase_2.
    IPR011707. Cu-oxidase_3.
    IPR008972. Cupredoxin.
    IPR017761. Laccase.
    [Graphical view]
    PfamiPF00394. Cu-oxidase. 1 hit.
    PF07731. Cu-oxidase_2. 1 hit.
    PF07732. Cu-oxidase_3. 1 hit.
    [Graphical view]
    SUPFAMiSSF49503. SSF49503. 4 hits.
    TIGRFAMsiTIGR03389. laccase. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9LFD2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPRLHHYLSN QAFLVLLLFS SIASAAVVEH VLHIQDVVVK PLCKEQIIPA    50
    ANGSLPGPTI NVREGDTLVV NVINNSTYNV TIHWHGVFQL KSVWMDGANM 100
    ITQCPIQPGY NFTYQFDITG QEGTLLWHAH VVNLRATLHG ALVIRPRSGR 150
    PYPFPKPYKE VPIVFQQWWD TDVRLLQLRP APVSDAYLIN GLAGDSYPCS 200
    ENRMFNLKVV QGKTYLLRIV NAALNTHLFF KIANHNVTVV AVDAVYSTPY 250
    LTDVMILTPG QTVDALLTAD QAIGKYYMAT LPYISAIGIP TPDIKPTRGL 300
    IVYQGATSSS SPAEPLMPVP NDMSTAHRFT SNITSLVGGP HWTPVPRHVD 350
    EKMFITMGLG LDPCPAGTKC IGPLGQRYAG SLNNRTFMIP ERISMQEAYF 400
    YNISGIYTDD FPNQPPLKFD YTKFEQRTNN DMKMMFPERK TSVKKIRFNS 450
    TVEIVLQNTA IISPESHPMH LHGFNFYVLG YGFGNYDPIR DARKLNLFNP 500
    QMHNTVGVPP GGWVVLRFIA NNPGVWLFHC HMDAHLPYGI MSAFIVQNGP 550
    TPETSLPSPP SNLPQCTRDP TIYDSRTTNI DLSY 584
    Length:584
    Mass (Da):65,282
    Last modified:October 1, 2000 - v1
    Checksum:iE83C308696325898
    GO
    Isoform 2 (identifier: Q9LFD2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         203-234: RMFNLKVVQGKTYLLRIVNAALNTHLFFKIAN → SNTHSLLESKVTFYCKLFTKNRINFYFYFWLW
         235-584: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:234
    Mass (Da):26,727
    Checksum:i75498B1972496DA1
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei203 – 23432RMFNL…FKIAN → SNTHSLLESKVTFYCKLFTK NRINFYFYFWLW in isoform 2. 1 PublicationVSP_024348Add
    BLAST
    Alternative sequencei235 – 584350Missing in isoform 2. 1 PublicationVSP_024349Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL137189 Genomic DNA. Translation: CAB69832.1.
    CP002688 Genomic DNA. Translation: AED90291.1.
    AK117360 mRNA. Translation: BAC42030.1.
    AK176457 mRNA. Translation: BAD44220.1.
    PIRiT45944.
    RefSeqiNP_195724.1. NM_120181.4. [Q9LFD2-1]
    UniGeneiAt.27863.
    At.27905.

    Genome annotation databases

    EnsemblPlantsiAT5G01040.1; AT5G01040.1; AT5G01040. [Q9LFD2-1]
    GeneIDi831877.
    KEGGiath:AT5G01040.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL137189 Genomic DNA. Translation: CAB69832.1 .
    CP002688 Genomic DNA. Translation: AED90291.1 .
    AK117360 mRNA. Translation: BAC42030.1 .
    AK176457 mRNA. Translation: BAD44220.1 .
    PIRi T45944.
    RefSeqi NP_195724.1. NM_120181.4. [Q9LFD2-1 ]
    UniGenei At.27863.
    At.27905.

    3D structure databases

    ProteinModelPortali Q9LFD2.
    SMRi Q9LFD2. Positions 45-575.
    ModBasei Search...
    MobiDBi Search...

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT5G01040.1 ; AT5G01040.1 ; AT5G01040 . [Q9LFD2-1 ]
    GeneIDi 831877.
    KEGGi ath:AT5G01040.

    Organism-specific databases

    TAIRi AT5G01040.

    Phylogenomic databases

    eggNOGi COG2132.
    HOGENOMi HOG000241916.
    InParanoidi Q9LFD2.
    OMAi AYFYNIS.
    PhylomeDBi Q9LFD2.

    Enzyme and pathway databases

    BioCyci ARA:AT5G01040-MONOMER.

    Gene expression databases

    Genevestigatori Q9LFD2.

    Family and domain databases

    Gene3Di 2.60.40.420. 3 hits.
    InterProi IPR001117. Cu-oxidase.
    IPR011706. Cu-oxidase_2.
    IPR011707. Cu-oxidase_3.
    IPR008972. Cupredoxin.
    IPR017761. Laccase.
    [Graphical view ]
    Pfami PF00394. Cu-oxidase. 1 hit.
    PF07731. Cu-oxidase_2. 1 hit.
    PF07732. Cu-oxidase_3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49503. SSF49503. 4 hits.
    TIGRFAMsi TIGR03389. laccase. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana."
      Tabata S., Kaneko T., Nakamura Y., Kotani H., Kato T., Asamizu E., Miyajima N., Sasamoto S., Kimura T., Hosouchi T., Kawashima K., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Naruo K.
      , Okumura S., Shinpo S., Takeuchi C., Wada T., Watanabe A., Yamada M., Yasuda M., Sato S., de la Bastide M., Huang E., Spiegel L., Gnoj L., O'Shaughnessy A., Preston R., Habermann K., Murray J., Johnson D., Rohlfing T., Nelson J., Stoneking T., Pepin K., Spieth J., Sekhon M., Armstrong J., Becker M., Belter E., Cordum H., Cordes M., Courtney L., Courtney W., Dante M., Du H., Edwards J., Fryman J., Haakensen B., Lamar E., Latreille P., Leonard S., Meyer R., Mulvaney E., Ozersky P., Riley A., Strowmatt C., Wagner-McPherson C., Wollam A., Yoakum M., Bell M., Dedhia N., Parnell L., Shah R., Rodriguez M., Hoon See L., Vil D., Baker J., Kirchoff K., Toth K., King L., Bahret A., Miller B., Marra M.A., Martienssen R., McCombie W.R., Wilson R.K., Murphy G., Bancroft I., Volckaert G., Wambutt R., Duesterhoeft A., Stiekema W., Pohl T., Entian K.-D., Terryn N., Hartley N., Bent E., Johnson S., Langham S.-A., McCullagh B., Robben J., Grymonprez B., Zimmermann W., Ramsperger U., Wedler H., Balke K., Wedler E., Peters S., van Staveren M., Dirkse W., Mooijman P., Klein Lankhorst R., Weitzenegger T., Bothe G., Rose M., Hauf J., Berneiser S., Hempel S., Feldpausch M., Lamberth S., Villarroel R., Gielen J., Ardiles W., Bents O., Lemcke K., Kolesov G., Mayer K.F.X., Rudd S., Schoof H., Schueller C., Zaccaria P., Mewes H.-W., Bevan M., Fransz P.F.
      Nature 408:823-826(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    2. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: cv. Columbia.
    4. "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs."
      Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.
      , Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y., Shinozaki K.
      Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 204-499 (ISOFORM 1).
      Strain: cv. Columbia.
    5. "Gene structure and molecular analysis of the laccase-like multicopper oxidase (LMCO) gene family in Arabidopsis thaliana."
      McCaig B.C., Meagher R.B., Dean J.F.D.
      Planta 221:619-636(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    6. "Mutant identification and characterization of the laccase gene family in Arabidopsis."
      Cai X., Davis E.J., Ballif J., Liang M., Bushman E., Haroldsen V., Torabinejad J., Wu Y.
      J. Exp. Bot. 57:2563-2569(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiLAC8_ARATH
    AccessioniPrimary (citable) accession number: Q9LFD2
    Secondary accession number(s): Q67YL1, Q8GYV9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 88 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3