Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Laccase-8

Gene

LAC8

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Lignin degradation and detoxification of lignin-derived products (By similarity). Involved in the flowering time inhibition.By similarity1 Publication

Catalytic activityi

4 benzenediol + O2 = 4 benzosemiquinone + 2 H2O.

Cofactori

Cu cationBy similarityNote: Binds 4 Cu cations per monomer.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi83 – 831Copper 1; type 2By similarity
Metal bindingi85 – 851Copper 2; type 3By similarity
Metal bindingi128 – 1281Copper 2; type 3By similarity
Metal bindingi130 – 1301Copper 3; type 3By similarity
Metal bindingi467 – 4671Copper 4; type 1By similarity
Metal bindingi470 – 4701Copper 1; type 2By similarity
Metal bindingi472 – 4721Copper 3; type 3By similarity
Metal bindingi529 – 5291Copper 3; type 3By similarity
Metal bindingi530 – 5301Copper 4; type 1By similarity
Metal bindingi531 – 5311Copper 2; type 3By similarity
Metal bindingi535 – 5351Copper 4; type 1By similarity

GO - Molecular functioni

GO - Biological processi

  • lignin catabolic process Source: UniProtKB-KW
  • response to copper ion Source: TAIR
  • vegetative to reproductive phase transition of meristem Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Lignin degradation

Keywords - Ligandi

Copper, Metal-binding

Enzyme and pathway databases

BioCyciARA:AT5G01040-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Laccase-8 (EC:1.10.3.2)
Alternative name(s):
Benzenediol:oxygen oxidoreductase 8
Diphenol oxidase 8
Urishiol oxidase 8
Gene namesi
Name:LAC8
Ordered Locus Names:At5g01040
ORF Names:F7J8.20
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548 Componenti: Chromosome 5

Organism-specific databases

TAIRiAT5G01040.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Apoplast, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 584559Laccase-8PRO_0000283636Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi52 – 521N-linked (GlcNAc...)Sequence Analysis
Glycosylationi75 – 751N-linked (GlcNAc...)Sequence Analysis
Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
Glycosylationi111 – 1111N-linked (GlcNAc...)Sequence Analysis
Glycosylationi236 – 2361N-linked (GlcNAc...)Sequence Analysis
Glycosylationi332 – 3321N-linked (GlcNAc...)Sequence Analysis
Glycosylationi384 – 3841N-linked (GlcNAc...)Sequence Analysis
Glycosylationi402 – 4021N-linked (GlcNAc...)Sequence Analysis
Glycosylationi449 – 4491N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Expressioni

Tissue specificityi

Predominantly expressed in tissues other than the inflorescence stem, especially in roots.2 Publications

Developmental stagei

Expressed along a developmental gradient in the inflorescence stem, with higher levels in olders organs and low levels in young tissues.1 Publication

Interactioni

Protein-protein interaction databases

STRINGi3702.AT5G01040.1.

Structurei

3D structure databases

ProteinModelPortaliQ9LFD2.
SMRiQ9LFD2. Positions 45-575.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 149117Plastocyanin-like 1Add
BLAST
Domaini159 – 306148Plastocyanin-like 2Add
BLAST
Domaini410 – 550141Plastocyanin-like 3Add
BLAST

Sequence similaritiesi

Belongs to the multicopper oxidase family.Curated
Contains 3 plastocyanin-like domains.Curated

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiCOG2132.
HOGENOMiHOG000241916.
InParanoidiQ9LFD2.
KOiK05909.
OMAiSPESHPM.
PhylomeDBiQ9LFD2.

Family and domain databases

Gene3Di2.60.40.420. 3 hits.
InterProiIPR001117. Cu-oxidase.
IPR011706. Cu-oxidase_2.
IPR011707. Cu-oxidase_3.
IPR008972. Cupredoxin.
IPR017761. Laccase.
[Graphical view]
PfamiPF00394. Cu-oxidase. 1 hit.
PF07731. Cu-oxidase_2. 1 hit.
PF07732. Cu-oxidase_3. 1 hit.
[Graphical view]
SUPFAMiSSF49503. SSF49503. 4 hits.
TIGRFAMsiTIGR03389. laccase. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9LFD2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPRLHHYLSN QAFLVLLLFS SIASAAVVEH VLHIQDVVVK PLCKEQIIPA
60 70 80 90 100
ANGSLPGPTI NVREGDTLVV NVINNSTYNV TIHWHGVFQL KSVWMDGANM
110 120 130 140 150
ITQCPIQPGY NFTYQFDITG QEGTLLWHAH VVNLRATLHG ALVIRPRSGR
160 170 180 190 200
PYPFPKPYKE VPIVFQQWWD TDVRLLQLRP APVSDAYLIN GLAGDSYPCS
210 220 230 240 250
ENRMFNLKVV QGKTYLLRIV NAALNTHLFF KIANHNVTVV AVDAVYSTPY
260 270 280 290 300
LTDVMILTPG QTVDALLTAD QAIGKYYMAT LPYISAIGIP TPDIKPTRGL
310 320 330 340 350
IVYQGATSSS SPAEPLMPVP NDMSTAHRFT SNITSLVGGP HWTPVPRHVD
360 370 380 390 400
EKMFITMGLG LDPCPAGTKC IGPLGQRYAG SLNNRTFMIP ERISMQEAYF
410 420 430 440 450
YNISGIYTDD FPNQPPLKFD YTKFEQRTNN DMKMMFPERK TSVKKIRFNS
460 470 480 490 500
TVEIVLQNTA IISPESHPMH LHGFNFYVLG YGFGNYDPIR DARKLNLFNP
510 520 530 540 550
QMHNTVGVPP GGWVVLRFIA NNPGVWLFHC HMDAHLPYGI MSAFIVQNGP
560 570 580
TPETSLPSPP SNLPQCTRDP TIYDSRTTNI DLSY
Length:584
Mass (Da):65,282
Last modified:October 1, 2000 - v1
Checksum:iE83C308696325898
GO
Isoform 2 (identifier: Q9LFD2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     203-234: RMFNLKVVQGKTYLLRIVNAALNTHLFFKIAN → SNTHSLLESKVTFYCKLFTKNRINFYFYFWLW
     235-584: Missing.

Note: No experimental confirmation available.
Show »
Length:234
Mass (Da):26,727
Checksum:i75498B1972496DA1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei203 – 23432RMFNL…FKIAN → SNTHSLLESKVTFYCKLFTK NRINFYFYFWLW in isoform 2. 1 PublicationVSP_024348Add
BLAST
Alternative sequencei235 – 584350Missing in isoform 2. 1 PublicationVSP_024349Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL137189 Genomic DNA. Translation: CAB69832.1.
CP002688 Genomic DNA. Translation: AED90291.1.
AK117360 mRNA. Translation: BAC42030.1.
AK176457 mRNA. Translation: BAD44220.1.
PIRiT45944.
RefSeqiNP_195724.1. NM_120181.4. [Q9LFD2-1]
UniGeneiAt.27863.
At.27905.

Genome annotation databases

EnsemblPlantsiAT5G01040.1; AT5G01040.1; AT5G01040. [Q9LFD2-1]
GeneIDi831877.
KEGGiath:AT5G01040.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL137189 Genomic DNA. Translation: CAB69832.1.
CP002688 Genomic DNA. Translation: AED90291.1.
AK117360 mRNA. Translation: BAC42030.1.
AK176457 mRNA. Translation: BAD44220.1.
PIRiT45944.
RefSeqiNP_195724.1. NM_120181.4. [Q9LFD2-1]
UniGeneiAt.27863.
At.27905.

3D structure databases

ProteinModelPortaliQ9LFD2.
SMRiQ9LFD2. Positions 45-575.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT5G01040.1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT5G01040.1; AT5G01040.1; AT5G01040. [Q9LFD2-1]
GeneIDi831877.
KEGGiath:AT5G01040.

Organism-specific databases

TAIRiAT5G01040.

Phylogenomic databases

eggNOGiCOG2132.
HOGENOMiHOG000241916.
InParanoidiQ9LFD2.
KOiK05909.
OMAiSPESHPM.
PhylomeDBiQ9LFD2.

Enzyme and pathway databases

BioCyciARA:AT5G01040-MONOMER.

Miscellaneous databases

PROiQ9LFD2.

Family and domain databases

Gene3Di2.60.40.420. 3 hits.
InterProiIPR001117. Cu-oxidase.
IPR011706. Cu-oxidase_2.
IPR011707. Cu-oxidase_3.
IPR008972. Cupredoxin.
IPR017761. Laccase.
[Graphical view]
PfamiPF00394. Cu-oxidase. 1 hit.
PF07731. Cu-oxidase_2. 1 hit.
PF07732. Cu-oxidase_3. 1 hit.
[Graphical view]
SUPFAMiSSF49503. SSF49503. 4 hits.
TIGRFAMsiTIGR03389. laccase. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana."
    Tabata S., Kaneko T., Nakamura Y., Kotani H., Kato T., Asamizu E., Miyajima N., Sasamoto S., Kimura T., Hosouchi T., Kawashima K., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Naruo K.
    , Okumura S., Shinpo S., Takeuchi C., Wada T., Watanabe A., Yamada M., Yasuda M., Sato S., de la Bastide M., Huang E., Spiegel L., Gnoj L., O'Shaughnessy A., Preston R., Habermann K., Murray J., Johnson D., Rohlfing T., Nelson J., Stoneking T., Pepin K., Spieth J., Sekhon M., Armstrong J., Becker M., Belter E., Cordum H., Cordes M., Courtney L., Courtney W., Dante M., Du H., Edwards J., Fryman J., Haakensen B., Lamar E., Latreille P., Leonard S., Meyer R., Mulvaney E., Ozersky P., Riley A., Strowmatt C., Wagner-McPherson C., Wollam A., Yoakum M., Bell M., Dedhia N., Parnell L., Shah R., Rodriguez M., Hoon See L., Vil D., Baker J., Kirchoff K., Toth K., King L., Bahret A., Miller B., Marra M.A., Martienssen R., McCombie W.R., Wilson R.K., Murphy G., Bancroft I., Volckaert G., Wambutt R., Duesterhoeft A., Stiekema W., Pohl T., Entian K.-D., Terryn N., Hartley N., Bent E., Johnson S., Langham S.-A., McCullagh B., Robben J., Grymonprez B., Zimmermann W., Ramsperger U., Wedler H., Balke K., Wedler E., Peters S., van Staveren M., Dirkse W., Mooijman P., Klein Lankhorst R., Weitzenegger T., Bothe G., Rose M., Hauf J., Berneiser S., Hempel S., Feldpausch M., Lamberth S., Villarroel R., Gielen J., Ardiles W., Bents O., Lemcke K., Kolesov G., Mayer K.F.X., Rudd S., Schoof H., Schueller C., Zaccaria P., Mewes H.-W., Bevan M., Fransz P.F.
    Nature 408:823-826(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: cv. Columbia.
  4. "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs."
    Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.
    , Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y., Shinozaki K.
    Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 204-499 (ISOFORM 1).
    Strain: cv. Columbia.
  5. "Gene structure and molecular analysis of the laccase-like multicopper oxidase (LMCO) gene family in Arabidopsis thaliana."
    McCaig B.C., Meagher R.B., Dean J.F.D.
    Planta 221:619-636(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  6. "Mutant identification and characterization of the laccase gene family in Arabidopsis."
    Cai X., Davis E.J., Ballif J., Liang M., Bushman E., Haroldsen V., Torabinejad J., Wu Y.
    J. Exp. Bot. 57:2563-2569(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiLAC8_ARATH
AccessioniPrimary (citable) accession number: Q9LFD2
Secondary accession number(s): Q67YL1, Q8GYV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2000
Last modified: June 24, 2015
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.