SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9JM52

- MINK1_MOUSE

UniProt

Q9JM52 - MINK1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Misshapen-like kinase 1
Gene
Mink1, Map4k6, Mink
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Serine/threonine kinase which acts as a negative regulator of Ras-related Rap2-mediated signal transduction to control neuronal structure and AMPA receptor trafficking. Required for normal synaptic density, dendrite complexity, as well as surface AMPA receptor expression in hippocampal neurons. Can activate the JNK and MAPK14/p38 pathways and mediates stimulation of the stress-activated protein kinase MAPK14/p38 MAPK downstream of the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation by RAP2A, MBP and SMAD1. Has an essential function in negative selection of thymocytes, perhaps by coupling NCK1 to activation of JNK1.2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Cofactori

Magnesium.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei54 – 541ATP By similarityBy similarity
Active sitei153 – 1531Proton acceptor By similarityBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi31 – 399ATP By similarityBy similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB
  2. protein serine/threonine kinase activity Source: UniProtKB
  3. receptor signaling protein serine/threonine kinase activity Source: RefGenome
  4. small GTPase regulator activity Source: InterPro

GO - Biological processi

  1. dendrite morphogenesis Source: UniProtKB
  2. intracellular signal transduction Source: UniProtKB
  3. multicellular organismal development Source: UniProtKB
  4. negative thymic T cell selection Source: MGI
  5. protein autophosphorylation Source: UniProtKB
  6. protein phosphorylation Source: UniProtKB
  7. regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: UniProtKB
  8. response to stress Source: UniProtKB
  9. signal transduction by phosphorylation Source: GOC
  10. synaptic transmission Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_188970. Oxidative Stress Induced Senescence.

Names & Taxonomyi

Protein namesi
Recommended name:
Misshapen-like kinase 1 (EC:2.7.11.1)
Alternative name(s):
GCK family kinase MiNK
MAPK/ERK kinase kinase kinase 6
Short name:
MEK kinase kinase 6
Short name:
MEKKK 6
Misshapen/NIK-related kinase
Mitogen-activated protein kinase kinase kinase kinase 6
Gene namesi
Name:Mink1
Synonyms:Map4k6, Mink
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:1355329. Mink1.

Subcellular locationi

Cytoplasm By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell projectionaxon By similarity. Cell projectiondendrite By similarity

GO - Cellular componenti

  1. axon Source: UniProtKB-SubCell
  2. cell junction Source: UniProtKB-KW
  3. cytoplasm Source: UniProtKB
  4. dendrite Source: UniProtKB-SubCell
  5. postsynaptic density Source: UniProtKB-SubCell
  6. postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13081308Misshapen-like kinase 1
PRO_0000086330Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei644 – 6441Phosphoserine By similarity
Modified residuei729 – 7291Phosphoserine1 Publication
Modified residuei745 – 7451Phosphoserine By similarity
Modified residuei746 – 7461Phosphoserine By similarity
Modified residuei750 – 7501Phosphoserine By similarity

Post-translational modificationi

Autophosphorylated By similarity.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9JM52.
PaxDbiQ9JM52.
PRIDEiQ9JM52.

PTM databases

PhosphoSiteiQ9JM52.

Expressioni

Tissue specificityi

Appears to be ubiquitous, expressed in all tissue types examined. Highly expressed in the brain, moderately expressed in kidney and spleen, low levels present in heart and skeletal muscle. Isoform 2 is more abundant in the brain than isoform 1.1 Publication

Developmental stagei

Up-regulated during postnatal brain development.1 Publication

Gene expression databases

ArrayExpressiQ9JM52.
BgeeiQ9JM52.
CleanExiMM_MINK1.
GenevestigatoriQ9JM52.

Interactioni

Subunit structurei

Interacts with RAP2A and TANC1 By similarity. Interacts with NCK1.1 Publication

Protein-protein interaction databases

IntActiQ9JM52. 4 interactions.
MINTiMINT-1616244.

Structurei

3D structure databases

ProteinModelPortaliQ9JM52.
SMRiQ9JM52. Positions 13-313.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini25 – 289265Protein kinase
Add
BLAST
Domaini995 – 1282288CNH
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni842 – 1308467Mediates interaction with RAP2A By similarity
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi359 – 497139Gln-rich
Add
BLAST
Compositional biasi544 – 672129Pro-rich
Add
BLAST
Compositional biasi800 – 8034Poly-Ser
Compositional biasi810 – 8156Poly-Glu

Sequence similaritiesi

Contains 1 CNH domain.

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00740000115097.
HOGENOMiHOG000290708.
HOVERGENiHBG036506.
KOiK04413.

Family and domain databases

InterProiIPR001180. Citron.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00780. CNH. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00036. CNH. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50219. CNH. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 21 Publication (identifier: Q9JM52-1) [UniParc]FASTAAdd to Basket

Also known as: MiNK-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGDPAPARSL DDIDLSALRD PAGIFELVEV VGNGTYGQVY KGRHVKTGQL     50
AAIKVMDVTE DEEEEIKQEI NMLKKYSHHR NIATYYGAFI KKSPPGNDDQ 100
LWLVMEFCGA GSVTDLVKNT KGNALKEDCI AYICREILRG LAHLHAHKVI 150
HRDIKGQNVL LTENAEVKLV DFGVSAQLDR TVGRRNTFIG TPYWMAPEVI 200
ACDENPDATY DYRSDIWSLG ITAIEMAEGA PPLCDMHPMR ALFLIPRNPP 250
PRLKSKKWSK KFTDFIDTCL IKTYLSRPPT EQLLKFPFIR DQPTERQVRI 300
QLKDHIDRSR KKRGEKEETE YEYSGSEEED DSHGEEGEPS SIMNVPGEST 350
LRREFLRLQQ ENKSNSEALK QQQQLQQQQQ RDPEAHIKHL LHQRQRRIEE 400
QKEERRRVEE QQRREREQRK LQEKEQQRRL EDMQALRREE ERRQAEREQE 450
YKRKQLEEQR QSERLQRQLQ QEHAYLKSLQ QQQQQQQLQK QQQQQQQILP 500
GDRKPLYHYG RGINPADKPA WAREVEERAR MNKQQNSPLA KAKPSSAGPE 550
PPISQASPSP PGPLSQTPPM QRPVEPQEGP HKSLVAHRVP LKPYAAPVPR 600
SQSLQDQPTR NLAAFPASHD PDPAAVPTPT ATPSARGAVI RQNSDPTSEG 650
PGPSPNPPSW VRPDNEAPPK VPQRTSSIAT ALNTSGAGGS RPAQAVRASN 700
PDLRRSDPGW ERSDSVLPAS HGHLPQAGSL ERNRNRVGAS TKLDSSPVLS 750
PGNKAKPEDH RSRPGRPASY KRAIGEDFVL LKERTLDEAP KPPKKAMDYS 800
SSSEEVESSE EEEEEGDGEP SEGSRDTPGG RSDGDTDSVS TMVVHDVEEI 850
SGTQPSYGGG TMVVQRTPEE ERSLLLADSN GYTNLPDVVQ PSHSPTENSK 900
GQSPPTKDGG SDYQSRGLVK APGKSSFTMF VDLGIYQPGG SGDTIPITAL 950
VGGEGGRLDQ LQFDVRKGSV VNVNPTNTRA HSETPEIRKY KKRFNSEILC 1000
AALWGVNLLV GTENGLMLLD RSGQGKVYGL IGRRRFQQMD VLEGLNLLIT 1050
ISGKRNKLRV YYLSWLRNKI LHNDPEVEKK QGWTTVGDME GCGHYRVVKY 1100
ERIKFLVIAL KNSVEVYAWA PKPYHKFMAF KSFADLPHRP LLVDLTVEEG 1150
QRLKVIYGSS AGFHAVDVDS GNSYDIYIPV HIQSQITPHA IIFLPNTDGM 1200
EMLLCYEDEG VYVNTYGRII KDVVLQWGEM PTSVAYICSN QIMGWGEKAI 1250
EIRSVETGHL DGVFMHKRAQ RLKFLCERND KVFFASVRSG GSSQVYFMTL 1300
NRNCIMNW 1308
Length:1,308
Mass (Da):147,295
Last modified:July 27, 2011 - v3
Checksum:i455E546EC5459B47
GO
Isoform 11 Publication (identifier: Q9JM52-2) [UniParc]FASTAAdd to Basket

Also known as: MiNK-1

The sequence of this isoform differs from the canonical sequence as follows:
     769-776: Missing.

Show »
Length:1,300
Mass (Da):146,390
Checksum:i9DB699C6D1F39C54
GO
Isoform 31 Publication (identifier: Q9JM52-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     698-698: A → ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNAS

Note: No experimental confirmation available.

Show »
Length:1,345
Mass (Da):151,310
Checksum:i0A23B48F645B9258
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei698 – 6981A → ARPRSNSAWQIYLQRRAERG TPKPPGPPAQPPGPPNAS in isoform 3.
VSP_007061
Alternative sequencei769 – 7768Missing in isoform 1. 1 Publication
VSP_007062

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti221 – 2211I → V in AAH11346. 1 Publication
Sequence conflicti243 – 2431F → L in AAH11346. 1 Publication
Sequence conflicti317 – 3171E → R in AAH11346. 1 Publication
Sequence conflicti542 – 5465AKPSS → RSQAG in BAA90752. 1 Publication
Sequence conflicti542 – 5465AKPSS → RSQAG in BAA94837. 1 Publication
Sequence conflicti832 – 8321Missing in AAH11346. 1 Publication
Sequence conflicti840 – 8401S → T in BAA94837. 1 Publication
Sequence conflicti840 – 8401S → T in BAA90752. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB041925 mRNA. Translation: BAA94837.1.
AB035697 mRNA. Translation: BAA90752.1.
AL592547 Genomic DNA. Translation: CAI24010.1.
CR933736 Genomic DNA. Translation: CAM28122.1.
CH466596 Genomic DNA. Translation: EDL12579.1.
BC011346 mRNA. Translation: AAH11346.1.
CCDSiCCDS24954.1. [Q9JM52-2]
CCDS24955.1. [Q9JM52-1]
RefSeqiNP_057922.2. NM_016713.2. [Q9JM52-2]
NP_795712.2. NM_176893.2. [Q9JM52-1]
XP_006533744.1. XM_006533681.1. [Q9JM52-3]
XP_006537239.1. XM_006537176.1. [Q9JM52-3]
UniGeneiMm.42967.

Genome annotation databases

EnsembliENSMUST00000102558; ENSMUSP00000099618; ENSMUSG00000020827. [Q9JM52-2]
ENSMUST00000102559; ENSMUSP00000099619; ENSMUSG00000020827. [Q9JM52-1]
GeneIDi50932.
KEGGimmu:50932.
UCSCiuc007jvj.1. mouse. [Q9JM52-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB041925 mRNA. Translation: BAA94837.1 .
AB035697 mRNA. Translation: BAA90752.1 .
AL592547 Genomic DNA. Translation: CAI24010.1 .
CR933736 Genomic DNA. Translation: CAM28122.1 .
CH466596 Genomic DNA. Translation: EDL12579.1 .
BC011346 mRNA. Translation: AAH11346.1 .
CCDSi CCDS24954.1. [Q9JM52-2 ]
CCDS24955.1. [Q9JM52-1 ]
RefSeqi NP_057922.2. NM_016713.2. [Q9JM52-2 ]
NP_795712.2. NM_176893.2. [Q9JM52-1 ]
XP_006533744.1. XM_006533681.1. [Q9JM52-3 ]
XP_006537239.1. XM_006537176.1. [Q9JM52-3 ]
UniGenei Mm.42967.

3D structure databases

ProteinModelPortali Q9JM52.
SMRi Q9JM52. Positions 13-313.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q9JM52. 4 interactions.
MINTi MINT-1616244.

PTM databases

PhosphoSitei Q9JM52.

Proteomic databases

MaxQBi Q9JM52.
PaxDbi Q9JM52.
PRIDEi Q9JM52.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000102558 ; ENSMUSP00000099618 ; ENSMUSG00000020827 . [Q9JM52-2 ]
ENSMUST00000102559 ; ENSMUSP00000099619 ; ENSMUSG00000020827 . [Q9JM52-1 ]
GeneIDi 50932.
KEGGi mmu:50932.
UCSCi uc007jvj.1. mouse. [Q9JM52-1 ]

Organism-specific databases

CTDi 50488.
MGIi MGI:1355329. Mink1.

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00740000115097.
HOGENOMi HOG000290708.
HOVERGENi HBG036506.
KOi K04413.

Enzyme and pathway databases

Reactomei REACT_188970. Oxidative Stress Induced Senescence.

Miscellaneous databases

NextBioi 307959.
PROi Q9JM52.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9JM52.
Bgeei Q9JM52.
CleanExi MM_MINK1.
Genevestigatori Q9JM52.

Family and domain databases

InterProi IPR001180. Citron.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00780. CNH. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00036. CNH. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50219. CNH. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of MINK, a novel member of mammalian GCK family kinases, which is up-regulated during postnatal mouse cerebral development."
    Dan I., Watanabe N.M., Kobayashi T., Yamashita-Suzuki K., Fukagaya Y., Kajikawa E., Kimura W.K., Nakashima T.M., Matsumoto K., Ninomiya-Tsuji J., Kusumi A.
    FEBS Lett. 469:19-23(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: ICR.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 148-1308 (ISOFORM 3).
    Tissue: Mammary gland.
  5. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 735-742 AND 908-920, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  6. "Signaling by the kinase MINK is essential in the negative selection of autoreactive thymocytes."
    McCarty N., Paust S., Ikizawa K., Dan I., Li X., Cantor H.
    Nat. Immunol. 6:65-72(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH NCK1.
  7. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  8. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-729, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMINK1_MOUSE
AccessioniPrimary (citable) accession number: Q9JM52
Secondary accession number(s): Q5SXG2, Q921M6, Q9JM92
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: July 27, 2011
Last modified: September 3, 2014
This is version 126 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi