Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9JM52 (MINK1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 125. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Misshapen-like kinase 1

EC=2.7.11.1
Alternative name(s):
GCK family kinase MiNK
MAPK/ERK kinase kinase kinase 6
Short name=MEK kinase kinase 6
Short name=MEKKK 6
Misshapen/NIK-related kinase
Mitogen-activated protein kinase kinase kinase kinase 6
Gene names
Name:Mink1
Synonyms:Map4k6, Mink
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1308 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Serine/threonine kinase which acts as a negative regulator of Ras-related Rap2-mediated signal transduction to control neuronal structure and AMPA receptor trafficking. Required for normal synaptic density, dendrite complexity, as well as surface AMPA receptor expression in hippocampal neurons. Can activate the JNK and MAPK14/p38 pathways and mediates stimulation of the stress-activated protein kinase MAPK14/p38 MAPK downstream of the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation by RAP2A, MBP and SMAD1. Has an essential function in negative selection of thymocytes, perhaps by coupling NCK1 to activation of JNK1. Ref.1 Ref.6

Catalytic activity

ATP + a protein = ADP + a phosphoprotein. Ref.1

Cofactor

Magnesium. Ref.1

Subunit structure

Interacts with RAP2A and TANC1 By similarity. Interacts with NCK1. Ref.6

Subcellular location

Cytoplasm By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell projectionaxon By similarity. Cell projectiondendrite By similarity.

Tissue specificity

Appears to be ubiquitous, expressed in all tissue types examined. Highly expressed in the brain, moderately expressed in kidney and spleen, low levels present in heart and skeletal muscle. Isoform 2 is more abundant in the brain than isoform 1. Ref.1

Developmental stage

Up-regulated during postnatal brain development. Ref.1

Post-translational modification

Autophosphorylated By similarity.

Sequence similarities

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.

Contains 1 CNH domain.

Contains 1 protein kinase domain.

Ontologies

Keywords
   Cellular componentCell junction
Cell membrane
Cell projection
Cytoplasm
Membrane
Postsynaptic cell membrane
Synapse
   Coding sequence diversityAlternative splicing
   LigandATP-binding
Nucleotide-binding
   Molecular functionKinase
Serine/threonine-protein kinase
Transferase
   PTMPhosphoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processJNK cascade

Inferred from electronic annotation. Source: InterPro

actin cytoskeleton reorganization

Inferred from electronic annotation. Source: InterPro

dendrite morphogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

intracellular signal transduction

Inferred from direct assay Ref.1. Source: UniProtKB

multicellular organismal development

Inferred from expression pattern Ref.1. Source: UniProtKB

negative thymic T cell selection

Inferred from mutant phenotype Ref.6. Source: MGI

protein autophosphorylation

Inferred from sequence or structural similarity. Source: UniProtKB

protein phosphorylation

Inferred from direct assay Ref.1. Source: UniProtKB

regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity

Inferred from sequence or structural similarity. Source: UniProtKB

response to stress

Inferred from direct assay Ref.1. Source: UniProtKB

synaptic transmission

Inferred from sequence or structural similarity. Source: UniProtKB

   Cellular_componentaxon

Inferred from electronic annotation. Source: UniProtKB-SubCell

cell junction

Inferred from electronic annotation. Source: UniProtKB-KW

cytoplasm

Inferred from sequence or structural similarity. Source: UniProtKB

dendrite

Inferred from electronic annotation. Source: UniProtKB-SubCell

postsynaptic density

Inferred from electronic annotation. Source: UniProtKB-SubCell

postsynaptic membrane

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionATP binding

Inferred from direct assay Ref.1. Source: UniProtKB

protein serine/threonine kinase activity

Inferred from direct assay Ref.1. Source: UniProtKB

receptor signaling protein serine/threonine kinase activity

Inferred from Biological aspect of Ancestor. Source: RefGenome

small GTPase regulator activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 2 Ref.1 (identifier: Q9JM52-1)

Also known as: MiNK-2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 Ref.1 (identifier: Q9JM52-2)

Also known as: MiNK-1;

The sequence of this isoform differs from the canonical sequence as follows:
     769-776: Missing.
Isoform 3 Ref.1 (identifier: Q9JM52-3)

The sequence of this isoform differs from the canonical sequence as follows:
     698-698: A → ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNAS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 13081308Misshapen-like kinase 1
PRO_0000086330

Regions

Domain25 – 289265Protein kinase
Domain995 – 1282288CNH
Nucleotide binding31 – 399ATP By similarity UniProtKB O00506
Region842 – 1308467Mediates interaction with RAP2A By similarity
Compositional bias359 – 497139Gln-rich
Compositional bias544 – 672129Pro-rich
Compositional bias800 – 8034Poly-Ser
Compositional bias810 – 8156Poly-Glu

Sites

Active site1531Proton acceptor By similarity UniProtKB O00506
Binding site541ATP By similarity UniProtKB O00506

Amino acid modifications

Modified residue6441Phosphoserine By similarity
Modified residue7291Phosphoserine Ref.9
Modified residue7451Phosphoserine By similarity
Modified residue7461Phosphoserine By similarity
Modified residue7501Phosphoserine By similarity

Natural variations

Alternative sequence6981A → ARPRSNSAWQIYLQRRAERG TPKPPGPPAQPPGPPNAS in isoform 3.
VSP_007061
Alternative sequence769 – 7768Missing in isoform 1. Ref.1
VSP_007062

Experimental info

Sequence conflict2211I → V in AAH11346. Ref.4
Sequence conflict2431F → L in AAH11346. Ref.4
Sequence conflict3171E → R in AAH11346. Ref.4
Sequence conflict542 – 5465AKPSS → RSQAG in BAA90752. Ref.1
Sequence conflict542 – 5465AKPSS → RSQAG in BAA94837. Ref.1
Sequence conflict8321Missing in AAH11346. Ref.4
Sequence conflict8401S → T in BAA94837. Ref.1
Sequence conflict8401S → T in BAA90752. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 2 (MiNK-2) [UniParc].

Last modified July 27, 2011. Version 3.
Checksum: 455E546EC5459B47

FASTA1,308147,295
        10         20         30         40         50         60 
MGDPAPARSL DDIDLSALRD PAGIFELVEV VGNGTYGQVY KGRHVKTGQL AAIKVMDVTE 

        70         80         90        100        110        120 
DEEEEIKQEI NMLKKYSHHR NIATYYGAFI KKSPPGNDDQ LWLVMEFCGA GSVTDLVKNT 

       130        140        150        160        170        180 
KGNALKEDCI AYICREILRG LAHLHAHKVI HRDIKGQNVL LTENAEVKLV DFGVSAQLDR 

       190        200        210        220        230        240 
TVGRRNTFIG TPYWMAPEVI ACDENPDATY DYRSDIWSLG ITAIEMAEGA PPLCDMHPMR 

       250        260        270        280        290        300 
ALFLIPRNPP PRLKSKKWSK KFTDFIDTCL IKTYLSRPPT EQLLKFPFIR DQPTERQVRI 

       310        320        330        340        350        360 
QLKDHIDRSR KKRGEKEETE YEYSGSEEED DSHGEEGEPS SIMNVPGEST LRREFLRLQQ 

       370        380        390        400        410        420 
ENKSNSEALK QQQQLQQQQQ RDPEAHIKHL LHQRQRRIEE QKEERRRVEE QQRREREQRK 

       430        440        450        460        470        480 
LQEKEQQRRL EDMQALRREE ERRQAEREQE YKRKQLEEQR QSERLQRQLQ QEHAYLKSLQ 

       490        500        510        520        530        540 
QQQQQQQLQK QQQQQQQILP GDRKPLYHYG RGINPADKPA WAREVEERAR MNKQQNSPLA 

       550        560        570        580        590        600 
KAKPSSAGPE PPISQASPSP PGPLSQTPPM QRPVEPQEGP HKSLVAHRVP LKPYAAPVPR 

       610        620        630        640        650        660 
SQSLQDQPTR NLAAFPASHD PDPAAVPTPT ATPSARGAVI RQNSDPTSEG PGPSPNPPSW 

       670        680        690        700        710        720 
VRPDNEAPPK VPQRTSSIAT ALNTSGAGGS RPAQAVRASN PDLRRSDPGW ERSDSVLPAS 

       730        740        750        760        770        780 
HGHLPQAGSL ERNRNRVGAS TKLDSSPVLS PGNKAKPEDH RSRPGRPASY KRAIGEDFVL 

       790        800        810        820        830        840 
LKERTLDEAP KPPKKAMDYS SSSEEVESSE EEEEEGDGEP SEGSRDTPGG RSDGDTDSVS 

       850        860        870        880        890        900 
TMVVHDVEEI SGTQPSYGGG TMVVQRTPEE ERSLLLADSN GYTNLPDVVQ PSHSPTENSK 

       910        920        930        940        950        960 
GQSPPTKDGG SDYQSRGLVK APGKSSFTMF VDLGIYQPGG SGDTIPITAL VGGEGGRLDQ 

       970        980        990       1000       1010       1020 
LQFDVRKGSV VNVNPTNTRA HSETPEIRKY KKRFNSEILC AALWGVNLLV GTENGLMLLD 

      1030       1040       1050       1060       1070       1080 
RSGQGKVYGL IGRRRFQQMD VLEGLNLLIT ISGKRNKLRV YYLSWLRNKI LHNDPEVEKK 

      1090       1100       1110       1120       1130       1140 
QGWTTVGDME GCGHYRVVKY ERIKFLVIAL KNSVEVYAWA PKPYHKFMAF KSFADLPHRP 

      1150       1160       1170       1180       1190       1200 
LLVDLTVEEG QRLKVIYGSS AGFHAVDVDS GNSYDIYIPV HIQSQITPHA IIFLPNTDGM 

      1210       1220       1230       1240       1250       1260 
EMLLCYEDEG VYVNTYGRII KDVVLQWGEM PTSVAYICSN QIMGWGEKAI EIRSVETGHL 

      1270       1280       1290       1300 
DGVFMHKRAQ RLKFLCERND KVFFASVRSG GSSQVYFMTL NRNCIMNW 

« Hide

Isoform 1 (MiNK-1) [UniParc].

Checksum: 9DB699C6D1F39C54
Show »

FASTA1,300146,390
Isoform 3 [UniParc].

Checksum: 0A23B48F645B9258
Show »

FASTA1,345151,310

References

« Hide 'large scale' references
[1]"Molecular cloning of MINK, a novel member of mammalian GCK family kinases, which is up-regulated during postnatal mouse cerebral development."
Dan I., Watanabe N.M., Kobayashi T., Yamashita-Suzuki K., Fukagaya Y., Kajikawa E., Kimura W.K., Nakashima T.M., Matsumoto K., Ninomiya-Tsuji J., Kusumi A.
FEBS Lett. 469:19-23(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Strain: ICR.
Tissue: Brain.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 148-1308 (ISOFORM 3).
Tissue: Mammary gland.
[5]Lubec G., Kang S.U.
Submitted (APR-2007) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 735-742 AND 908-920, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: C57BL/6.
Tissue: Brain.
[6]"Signaling by the kinase MINK is essential in the negative selection of autoreactive thymocytes."
McCarty N., Paust S., Ikizawa K., Dan I., Li X., Cantor H.
Nat. Immunol. 6:65-72(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH NCK1.
[7]Erratum
McCarty N., Paust S., Ikizawa K., Dan I., Li X., Cantor H.
Nat. Immunol. 6:219-219(2005)
[8]"Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[9]"The phagosomal proteome in interferon-gamma-activated macrophages."
Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-729, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB041925 mRNA. Translation: BAA94837.1.
AB035697 mRNA. Translation: BAA90752.1.
AL592547 Genomic DNA. Translation: CAI24010.1.
CR933736 Genomic DNA. Translation: CAM28122.1.
CH466596 Genomic DNA. Translation: EDL12579.1.
BC011346 mRNA. Translation: AAH11346.1.
CCDSCCDS24954.1. [Q9JM52-2]
CCDS24955.1. [Q9JM52-1]
RefSeqNP_057922.2. NM_016713.2. [Q9JM52-2]
NP_795712.2. NM_176893.2. [Q9JM52-1]
XP_006533744.1. XM_006533681.1. [Q9JM52-3]
XP_006537239.1. XM_006537176.1. [Q9JM52-3]
UniGeneMm.42967.

3D structure databases

ProteinModelPortalQ9JM52.
SMRQ9JM52. Positions 13-313.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ9JM52. 4 interactions.
MINTMINT-1616244.

PTM databases

PhosphoSiteQ9JM52.

Proteomic databases

MaxQBQ9JM52.
PaxDbQ9JM52.
PRIDEQ9JM52.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000102558; ENSMUSP00000099618; ENSMUSG00000020827. [Q9JM52-2]
ENSMUST00000102559; ENSMUSP00000099619; ENSMUSG00000020827. [Q9JM52-1]
GeneID50932.
KEGGmmu:50932.
UCSCuc007jvj.1. mouse. [Q9JM52-1]

Organism-specific databases

CTD50488.
MGIMGI:1355329. Mink1.

Phylogenomic databases

eggNOGCOG0515.
GeneTreeENSGT00740000115097.
HOGENOMHOG000290708.
HOVERGENHBG036506.
KOK04413.

Gene expression databases

ArrayExpressQ9JM52.
BgeeQ9JM52.
CleanExMM_MINK1.
GenevestigatorQ9JM52.

Family and domain databases

InterProIPR001180. Citron.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF00780. CNH. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTSM00036. CNH. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS50219. CNH. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio307959.
PROQ9JM52.
SOURCESearch...

Entry information

Entry nameMINK1_MOUSE
AccessionPrimary (citable) accession number: Q9JM52
Secondary accession number(s): Q5SXG2, Q921M6, Q9JM92
Entry history
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot