Q9JM52 (MINK1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Misshapen-like kinase 1 EC=2.7.11.1 Alternative name(s): GCK family kinase MiNK MAPK/ERK kinase kinase kinase 6 Short name=MEK kinase kinase 6 Short name=MEKKK 6 Misshapen/NIK-related kinase Mitogen-activated protein kinase kinase kinase kinase 6 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1308 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine kinase which acts as a negative regulator of Ras-related Rap2-mediated signal transduction to control neuronal structure and AMPA receptor trafficking. Required for normal synaptic density, dendrite complexity, as well as surface AMPA receptor expression in hippocampal neurons. Can activate the JNK and MAPK14/p38 pathways and mediates stimulation of the stress-activated protein kinase MAPK14/p38 MAPK downstream of the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation by RAP2A, MBP and SMAD1. Has an essential function in negative selection of thymocytes, perhaps by coupling NCK1 to activation of JNK1. Ref.1 Ref.6 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. Ref.1 |
| Cofactor | Magnesium. Ref.1 |
| Subunit structure | Interacts with RAP2A and TANC1 By similarity. Interacts with NCK1. Ref.6 |
| Subcellular location | Cytoplasm By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Cell projection › axon By similarity. Cell projection › dendrite By similarity. |
| Tissue specificity | Appears to be ubiquitous, expressed in all tissue types examined. Highly expressed in the brain, moderately expressed in kidney and spleen, low levels present in heart and skeletal muscle. Isoform 2 is more abundant in the brain than isoform 1. Ref.1 |
| Developmental stage | Up-regulated during postnatal brain development. Ref.1 |
| Post-translational modification | Autophosphorylated By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. Contains 1 CNH domain. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 Ref.1 (identifier: Q9JM52-1) Also known as: MiNK-2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 Ref.1 (identifier: Q9JM52-2) Also known as: MiNK-1; The sequence of this isoform differs from the canonical sequence as follows: 769-776: Missing. | ||||||
| Isoform 3 Ref.1 (identifier: Q9JM52-3) The sequence of this isoform differs from the canonical sequence as follows: 698-698: A → ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNAS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1308 | 1308 | Misshapen-like kinase 1 | PRO_0000086330 | |||||
Regions | |||||||||
| Domain | 25 – 289 | 265 | Protein kinase | ||||||
| Domain | 995 – 1282 | 288 | CNH | ||||||
| Nucleotide binding | 31 – 39 | 9 | ATP By similarity UniProtKB O00506 | ||||||
| Region | 842 – 1308 | 467 | Mediates interaction with RAP2A By similarity | ||||||
| Compositional bias | 359 – 497 | 139 | Gln-rich | ||||||
| Compositional bias | 544 – 672 | 129 | Pro-rich | ||||||
| Compositional bias | 800 – 803 | 4 | Poly-Ser | ||||||
| Compositional bias | 810 – 815 | 6 | Poly-Glu | ||||||
Sites | |||||||||
| Active site | 153 | 1 | Proton acceptor By similarity UniProtKB O00506 | ||||||
| Binding site | 54 | 1 | ATP By similarity UniProtKB O00506 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 644 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 729 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 745 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 746 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 750 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 892 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 969 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 698 | 1 | A → ARPRSNSAWQIYLQRRAERG TPKPPGPPAQPPGPPNAS in isoform 3. | VSP_007061 | |||||
| Alternative sequence | 769 – 776 | 8 | Missing in isoform 1. Ref.1 | VSP_007062 | |||||
Experimental info | |||||||||
| Sequence conflict | 221 | 1 | I → V in AAH11346. Ref.4 | ||||||
| Sequence conflict | 243 | 1 | F → L in AAH11346. Ref.4 | ||||||
| Sequence conflict | 317 | 1 | E → R in AAH11346. Ref.4 | ||||||
| Sequence conflict | 542 – 546 | 5 | AKPSS → RSQAG in BAA90752. Ref.1 | ||||||
| Sequence conflict | 542 – 546 | 5 | AKPSS → RSQAG in BAA94837. Ref.1 | ||||||
| Sequence conflict | 832 | 1 | Missing in AAH11346. Ref.4 | ||||||
| Sequence conflict | 840 | 1 | S → T in BAA94837. Ref.1 | ||||||
| Sequence conflict | 840 | 1 | S → T in BAA90752. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of MINK, a novel member of mammalian GCK family kinases, which is up-regulated during postnatal mouse cerebral development." Dan I., Watanabe N.M., Kobayashi T., Yamashita-Suzuki K., Fukagaya Y., Kajikawa E., Kimura W.K., Nakashima T.M., Matsumoto K., Ninomiya-Tsuji J., Kusumi A. FEBS Lett. 469:19-23(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Strain: ICR. Tissue: Brain. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 148-1308 (ISOFORM 3). Tissue: Mammary gland. |
| [5] | Lubec G., Kang S.U. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 735-742 AND 908-920, MASS SPECTROMETRY. Strain: C57BL/6. Tissue: Brain. |
| [6] | "Signaling by the kinase MINK is essential in the negative selection of autoreactive thymocytes." McCarty N., Paust S., Ikizawa K., Dan I., Li X., Cantor H. Nat. Immunol. 6:65-72(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH NCK1. |
| [7] | Erratum McCarty N., Paust S., Ikizawa K., Dan I., Li X., Cantor H. Nat. Immunol. 6:219-219(2005) |
| [8] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746; SER-750 AND SER-892, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [9] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-729 AND SER-969, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB041925 mRNA. Translation: BAA94837.1. AB035697 mRNA. Translation: BAA90752.1. AL592547 Genomic DNA. Translation: CAI24010.1. CR933736 Genomic DNA. Translation: CAM28122.1. CH466596 Genomic DNA. Translation: EDL12579.1. BC011346 mRNA. Translation: AAH11346.1. |
| IPI | IPI00124753. IPI00230171. IPI00468997. |
| RefSeq | NP_057922.2. NM_016713.2. NP_795712.2. NM_176893.2. |
| UniGene | Mm.42967. |
3D structure databases | |
| ProteinModelPortal | Q9JM52. |
| SMR | Q9JM52. Positions 13-313. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9JM52. 3 interactions. |
PTM databases | |
| PhosphoSite | Q9JM52. |
Proteomic databases | |
| PaxDb | Q9JM52. |
| PRIDE | Q9JM52. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000102558; ENSMUSP00000099618; ENSMUSG00000020827. ENSMUST00000102559; ENSMUSP00000099619; ENSMUSG00000020827. |
| GeneID | 50932. |
| KEGG | mmu:50932. |
Organism-specific databases | |
| CTD | 50488. |
| MGI | MGI:1355329. Mink1. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00680000099778. |
| HOGENOM | HOG000290708. |
| HOVERGEN | HBG036506. |
| KO | K04413. |
Gene expression databases | |
| ArrayExpress | Q9JM52. |
| Bgee | Q9JM52. |
| CleanEx | MM_MINK1. |
| Genevestigator | Q9JM52. |
| GermOnline | ENSMUSG00000020827. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001180. Citron. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00780. CNH. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00036. CNH. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50219. CNH. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 307959. |
| SOURCE | Search... |
Entry information
| Entry name | MINK1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9JM52 Secondary accession number(s): Q5SXG2, Q921M6, Q9JM92 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
