Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9JM52

- MINK1_MOUSE

UniProt

Q9JM52 - MINK1_MOUSE

Protein

Misshapen-like kinase 1

Gene

Mink1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 127 (01 Oct 2014)
      Sequence version 3 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Serine/threonine kinase which acts as a negative regulator of Ras-related Rap2-mediated signal transduction to control neuronal structure and AMPA receptor trafficking. Required for normal synaptic density, dendrite complexity, as well as surface AMPA receptor expression in hippocampal neurons. Can activate the JNK and MAPK14/p38 pathways and mediates stimulation of the stress-activated protein kinase MAPK14/p38 MAPK downstream of the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation by RAP2A, MBP and SMAD1. Has an essential function in negative selection of thymocytes, perhaps by coupling NCK1 to activation of JNK1.2 Publications

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.1 Publication

    Cofactori

    Magnesium.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei54 – 541ATPPROSITE-ProRule annotation
    Active sitei153 – 1531Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi31 – 399ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB
    2. protein serine/threonine kinase activity Source: UniProtKB
    3. small GTPase regulator activity Source: InterPro

    GO - Biological processi

    1. dendrite morphogenesis Source: UniProtKB
    2. intracellular signal transduction Source: UniProtKB
    3. multicellular organismal development Source: UniProtKB
    4. negative thymic T cell selection Source: MGI
    5. protein autophosphorylation Source: UniProtKB
    6. protein phosphorylation Source: UniProtKB
    7. regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: UniProtKB
    8. response to stress Source: UniProtKB
    9. synaptic transmission Source: UniProtKB

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_188970. Oxidative Stress Induced Senescence.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Misshapen-like kinase 1 (EC:2.7.11.1)
    Alternative name(s):
    GCK family kinase MiNK
    MAPK/ERK kinase kinase kinase 6
    Short name:
    MEK kinase kinase 6
    Short name:
    MEKKK 6
    Misshapen/NIK-related kinase
    Mitogen-activated protein kinase kinase kinase kinase 6
    Gene namesi
    Name:Mink1By similarity
    Synonyms:Map4k6Imported, MinkImported
    OrganismiMus musculus (Mouse)Imported
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1355329. Mink1.

    Subcellular locationi

    Cytoplasm By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell projectionaxon By similarity. Cell projectiondendrite By similarity

    GO - Cellular componenti

    1. axon Source: UniProtKB-SubCell
    2. cell junction Source: UniProtKB-KW
    3. cytoplasm Source: UniProtKB
    4. dendrite Source: UniProtKB-SubCell
    5. postsynaptic density Source: UniProtKB-SubCell
    6. postsynaptic membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13081308Misshapen-like kinase 1PRO_0000086330Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei644 – 6441PhosphoserineBy similarity
    Modified residuei729 – 7291Phosphoserine1 Publication
    Modified residuei745 – 7451PhosphoserineBy similarity
    Modified residuei746 – 7461PhosphoserineBy similarity
    Modified residuei750 – 7501PhosphoserineBy similarity

    Post-translational modificationi

    Autophosphorylated.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9JM52.
    PaxDbiQ9JM52.
    PRIDEiQ9JM52.

    PTM databases

    PhosphoSiteiQ9JM52.

    Expressioni

    Tissue specificityi

    Appears to be ubiquitous, expressed in all tissue types examined. Highly expressed in the brain, moderately expressed in kidney and spleen, low levels present in heart and skeletal muscle. Isoform 2 is more abundant in the brain than isoform 1.1 Publication

    Developmental stagei

    Up-regulated during postnatal brain development.1 Publication

    Gene expression databases

    ArrayExpressiQ9JM52.
    BgeeiQ9JM52.
    CleanExiMM_MINK1.
    GenevestigatoriQ9JM52.

    Interactioni

    Subunit structurei

    Interacts with RAP2A and TANC1 By similarity. Interacts with NCK1.By similarity1 Publication

    Protein-protein interaction databases

    IntActiQ9JM52. 4 interactions.
    MINTiMINT-1616244.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9JM52.
    SMRiQ9JM52. Positions 13-313.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini25 – 289265Protein kinasePROSITE-ProRule annotationAdd
    BLAST
    Domaini995 – 1282288CNHPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni842 – 1308467Mediates interaction with RAP2ABy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi359 – 497139Gln-richAdd
    BLAST
    Compositional biasi544 – 672129Pro-richAdd
    BLAST
    Compositional biasi800 – 8034Poly-Ser
    Compositional biasi810 – 8156Poly-Glu

    Sequence similaritiesi

    Contains 1 CNH domain.CuratedPROSITE-ProRule annotation
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    GeneTreeiENSGT00740000115097.
    HOGENOMiHOG000290708.
    HOVERGENiHBG036506.
    KOiK04413.

    Family and domain databases

    InterProiIPR001180. Citron.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00780. CNH. 1 hit.
    PF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00036. CNH. 1 hit.
    SM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS50219. CNH. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 21 Publication (identifier: Q9JM52-1) [UniParc]FASTAAdd to Basket

    Also known as: MiNK-2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGDPAPARSL DDIDLSALRD PAGIFELVEV VGNGTYGQVY KGRHVKTGQL     50
    AAIKVMDVTE DEEEEIKQEI NMLKKYSHHR NIATYYGAFI KKSPPGNDDQ 100
    LWLVMEFCGA GSVTDLVKNT KGNALKEDCI AYICREILRG LAHLHAHKVI 150
    HRDIKGQNVL LTENAEVKLV DFGVSAQLDR TVGRRNTFIG TPYWMAPEVI 200
    ACDENPDATY DYRSDIWSLG ITAIEMAEGA PPLCDMHPMR ALFLIPRNPP 250
    PRLKSKKWSK KFTDFIDTCL IKTYLSRPPT EQLLKFPFIR DQPTERQVRI 300
    QLKDHIDRSR KKRGEKEETE YEYSGSEEED DSHGEEGEPS SIMNVPGEST 350
    LRREFLRLQQ ENKSNSEALK QQQQLQQQQQ RDPEAHIKHL LHQRQRRIEE 400
    QKEERRRVEE QQRREREQRK LQEKEQQRRL EDMQALRREE ERRQAEREQE 450
    YKRKQLEEQR QSERLQRQLQ QEHAYLKSLQ QQQQQQQLQK QQQQQQQILP 500
    GDRKPLYHYG RGINPADKPA WAREVEERAR MNKQQNSPLA KAKPSSAGPE 550
    PPISQASPSP PGPLSQTPPM QRPVEPQEGP HKSLVAHRVP LKPYAAPVPR 600
    SQSLQDQPTR NLAAFPASHD PDPAAVPTPT ATPSARGAVI RQNSDPTSEG 650
    PGPSPNPPSW VRPDNEAPPK VPQRTSSIAT ALNTSGAGGS RPAQAVRASN 700
    PDLRRSDPGW ERSDSVLPAS HGHLPQAGSL ERNRNRVGAS TKLDSSPVLS 750
    PGNKAKPEDH RSRPGRPASY KRAIGEDFVL LKERTLDEAP KPPKKAMDYS 800
    SSSEEVESSE EEEEEGDGEP SEGSRDTPGG RSDGDTDSVS TMVVHDVEEI 850
    SGTQPSYGGG TMVVQRTPEE ERSLLLADSN GYTNLPDVVQ PSHSPTENSK 900
    GQSPPTKDGG SDYQSRGLVK APGKSSFTMF VDLGIYQPGG SGDTIPITAL 950
    VGGEGGRLDQ LQFDVRKGSV VNVNPTNTRA HSETPEIRKY KKRFNSEILC 1000
    AALWGVNLLV GTENGLMLLD RSGQGKVYGL IGRRRFQQMD VLEGLNLLIT 1050
    ISGKRNKLRV YYLSWLRNKI LHNDPEVEKK QGWTTVGDME GCGHYRVVKY 1100
    ERIKFLVIAL KNSVEVYAWA PKPYHKFMAF KSFADLPHRP LLVDLTVEEG 1150
    QRLKVIYGSS AGFHAVDVDS GNSYDIYIPV HIQSQITPHA IIFLPNTDGM 1200
    EMLLCYEDEG VYVNTYGRII KDVVLQWGEM PTSVAYICSN QIMGWGEKAI 1250
    EIRSVETGHL DGVFMHKRAQ RLKFLCERND KVFFASVRSG GSSQVYFMTL 1300
    NRNCIMNW 1308
    Length:1,308
    Mass (Da):147,295
    Last modified:July 27, 2011 - v3
    Checksum:i455E546EC5459B47
    GO
    Isoform 11 Publication (identifier: Q9JM52-2) [UniParc]FASTAAdd to Basket

    Also known as: MiNK-1

    The sequence of this isoform differs from the canonical sequence as follows:
         769-776: Missing.

    Show »
    Length:1,300
    Mass (Da):146,390
    Checksum:i9DB699C6D1F39C54
    GO
    Isoform 31 Publication (identifier: Q9JM52-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         698-698: A → ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNAS

    Note: No experimental confirmation available.

    Show »
    Length:1,345
    Mass (Da):151,310
    Checksum:i0A23B48F645B9258
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti221 – 2211I → V in AAH11346. (PubMed:15489334)Curated
    Sequence conflicti243 – 2431F → L in AAH11346. (PubMed:15489334)Curated
    Sequence conflicti317 – 3171E → R in AAH11346. (PubMed:15489334)Curated
    Sequence conflicti542 – 5465AKPSS → RSQAG in BAA90752. (PubMed:10708748)Curated
    Sequence conflicti542 – 5465AKPSS → RSQAG in BAA94837. (PubMed:10708748)Curated
    Sequence conflicti832 – 8321Missing in AAH11346. (PubMed:15489334)Curated
    Sequence conflicti840 – 8401S → T in BAA94837. (PubMed:10708748)Curated
    Sequence conflicti840 – 8401S → T in BAA90752. (PubMed:10708748)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei698 – 6981A → ARPRSNSAWQIYLQRRAERG TPKPPGPPAQPPGPPNAS in isoform 3. 1 PublicationVSP_007061
    Alternative sequencei769 – 7768Missing in isoform 1. 1 PublicationVSP_007062

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB041925 mRNA. Translation: BAA94837.1.
    AB035697 mRNA. Translation: BAA90752.1.
    AL592547 Genomic DNA. Translation: CAI24010.1.
    CR933736 Genomic DNA. Translation: CAM28122.1.
    CH466596 Genomic DNA. Translation: EDL12579.1.
    BC011346 mRNA. Translation: AAH11346.1.
    CCDSiCCDS24954.1. [Q9JM52-2]
    CCDS24955.1. [Q9JM52-1]
    RefSeqiNP_057922.2. NM_016713.2. [Q9JM52-2]
    NP_795712.2. NM_176893.2. [Q9JM52-1]
    XP_006533744.1. XM_006533681.1. [Q9JM52-3]
    XP_006537239.1. XM_006537176.1. [Q9JM52-3]
    UniGeneiMm.42967.

    Genome annotation databases

    EnsembliENSMUST00000102558; ENSMUSP00000099618; ENSMUSG00000020827. [Q9JM52-2]
    ENSMUST00000102559; ENSMUSP00000099619; ENSMUSG00000020827. [Q9JM52-1]
    GeneIDi50932.
    KEGGimmu:50932.
    UCSCiuc007jvj.1. mouse. [Q9JM52-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB041925 mRNA. Translation: BAA94837.1 .
    AB035697 mRNA. Translation: BAA90752.1 .
    AL592547 Genomic DNA. Translation: CAI24010.1 .
    CR933736 Genomic DNA. Translation: CAM28122.1 .
    CH466596 Genomic DNA. Translation: EDL12579.1 .
    BC011346 mRNA. Translation: AAH11346.1 .
    CCDSi CCDS24954.1. [Q9JM52-2 ]
    CCDS24955.1. [Q9JM52-1 ]
    RefSeqi NP_057922.2. NM_016713.2. [Q9JM52-2 ]
    NP_795712.2. NM_176893.2. [Q9JM52-1 ]
    XP_006533744.1. XM_006533681.1. [Q9JM52-3 ]
    XP_006537239.1. XM_006537176.1. [Q9JM52-3 ]
    UniGenei Mm.42967.

    3D structure databases

    ProteinModelPortali Q9JM52.
    SMRi Q9JM52. Positions 13-313.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9JM52. 4 interactions.
    MINTi MINT-1616244.

    PTM databases

    PhosphoSitei Q9JM52.

    Proteomic databases

    MaxQBi Q9JM52.
    PaxDbi Q9JM52.
    PRIDEi Q9JM52.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000102558 ; ENSMUSP00000099618 ; ENSMUSG00000020827 . [Q9JM52-2 ]
    ENSMUST00000102559 ; ENSMUSP00000099619 ; ENSMUSG00000020827 . [Q9JM52-1 ]
    GeneIDi 50932.
    KEGGi mmu:50932.
    UCSCi uc007jvj.1. mouse. [Q9JM52-1 ]

    Organism-specific databases

    CTDi 50488.
    MGIi MGI:1355329. Mink1.

    Phylogenomic databases

    eggNOGi COG0515.
    GeneTreei ENSGT00740000115097.
    HOGENOMi HOG000290708.
    HOVERGENi HBG036506.
    KOi K04413.

    Enzyme and pathway databases

    Reactomei REACT_188970. Oxidative Stress Induced Senescence.

    Miscellaneous databases

    NextBioi 307959.
    PROi Q9JM52.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9JM52.
    Bgeei Q9JM52.
    CleanExi MM_MINK1.
    Genevestigatori Q9JM52.

    Family and domain databases

    InterProi IPR001180. Citron.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00780. CNH. 1 hit.
    PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00036. CNH. 1 hit.
    SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS50219. CNH. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of MINK, a novel member of mammalian GCK family kinases, which is up-regulated during postnatal mouse cerebral development."
      Dan I., Watanabe N.M., Kobayashi T., Yamashita-Suzuki K., Fukagaya Y., Kajikawa E., Kimura W.K., Nakashima T.M., Matsumoto K., Ninomiya-Tsuji J., Kusumi A.
      FEBS Lett. 469:19-23(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: ICR.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 148-1308 (ISOFORM 3).
      Tissue: Mammary gland.
    5. Lubec G., Kang S.U.
      Submitted (APR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 735-742 AND 908-920, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: C57BL/6.
      Tissue: Brain.
    6. "Signaling by the kinase MINK is essential in the negative selection of autoreactive thymocytes."
      McCarty N., Paust S., Ikizawa K., Dan I., Li X., Cantor H.
      Nat. Immunol. 6:65-72(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH NCK1.
    7. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    8. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-729, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiMINK1_MOUSE
    AccessioniPrimary (citable) accession number: Q9JM52
    Secondary accession number(s): Q5SXG2, Q921M6, Q9JM92
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 28, 2003
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 127 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3