Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Single Ig IL-1-related receptor

Gene

Sigirr

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity).By similarity1 Publication

GO - Biological processi

  • acute-phase response Source: HGNC
  • negative regulation of chemokine biosynthetic process Source: HGNC
  • negative regulation of cytokine-mediated signaling pathway Source: HGNC
  • negative regulation of sequence-specific DNA binding transcription factor activity Source: HGNC
  • signal transduction Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Single Ig IL-1-related receptor
Alternative name(s):
Single Ig IL-1R-related molecule
Single immunoglobulin domain-containing IL1R-related protein
Toll/interleukin-1 receptor 8
Short name:
TIR8
Gene namesi
Name:Sigirr
Synonyms:Tir8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1344402. Sigirr.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 117ExtracellularSequence analysisAdd BLAST117
Transmembranei118 – 138Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini139 – 409CytoplasmicSequence analysisAdd BLAST271

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000990661 – 409Single Ig IL-1-related receptorAdd BLAST409

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi31N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi32 ↔ 97PROSITE-ProRule annotation
Glycosylationi58N-linked (GlcNAc...)Sequence analysis1
Glycosylationi73N-linked (GlcNAc...)Sequence analysis1
Glycosylationi85N-linked (GlcNAc...)Sequence analysis1
Glycosylationi101N-linked (GlcNAc...)Sequence analysis1
Modified residuei382PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9JLZ8.
PaxDbiQ9JLZ8.
PRIDEiQ9JLZ8.

PTM databases

iPTMnetiQ9JLZ8.
PhosphoSitePlusiQ9JLZ8.

Expressioni

Tissue specificityi

Expressed at high levels in kidney, and at moderate levels in colon, small intestine, lung, spleen and liver. Not expressed in brain and muscle. Expressed at high levels in epithelial cells, at moderate levels in splenocytes, and at low or undetectable levels in fibroblasts or endothelial cells. Expressed in mucosal and dendritic cells.3 Publications

Inductioni

Down-regulated by LPS. Down-regulated during inflammation by inhibition of an SP1-mediated pathway.2 Publications

Gene expression databases

BgeeiENSMUSG00000025494.
ExpressionAtlasiQ9JLZ8. baseline and differential.
GenevisibleiQ9JLZ8. MM.

Interactioni

Subunit structurei

Interacts with IL1R1, IRAK1, TLR4, TLR5, TLR9 and TRAF6. Upon IL-1 stimulation found in a complex at least composed of IL1R1, SIGIRR, MYD88, IRAK1 and TRAF6. Upon stimulation with LPC found in a complex at least composed of TLR4, SIG1IR, MYD88, IRAK1 and TRAF6. Interacts with PALM3 (By similarity).By similarity

Protein-protein interaction databases

IntActiQ9JLZ8. 1 interactor.
MINTiMINT-4130341.
STRINGi10090.ENSMUSP00000095571.

Structurei

3D structure databases

ProteinModelPortaliQ9JLZ8.
SMRiQ9JLZ8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 108Ig-like C2-typeAdd BLAST100
Domaini162 – 309TIRPROSITE-ProRule annotationAdd BLAST148

Sequence similaritiesi

Belongs to the interleukin-1 receptor family.Curated
Contains 1 TIR domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEXB. Eukaryota.
ENOG410ZFDI. LUCA.
GeneTreeiENSGT00840000129987.
HOGENOMiHOG000237348.
HOVERGENiHBG080781.
InParanoidiQ9JLZ8.
KOiK05169.
OMAiEVEMNDG.
OrthoDBiEOG091G0GXW.
PhylomeDBiQ9JLZ8.
TreeFamiTF325519.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
3.40.50.10140. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR015621. IL-1_rcpt_fam.
IPR000157. TIR_dom.
[Graphical view]
PANTHERiPTHR11890. PTHR11890. 1 hit.
PfamiPF13895. Ig_2. 1 hit.
PF01582. TIR. 1 hit.
[Graphical view]
SMARTiSM00255. TIR. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
SSF52200. SSF52200. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS50104. TIR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9JLZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGVCDMAPN FLSPSEDQAL GLALGREVAL NCTAWVFSRP QCPQPSVQWL
60 70 80 90 100
KDGLALGNGS HFSLHEDFWV SANFSEIVSS VLVLNLTNAE DYGTFTCSVW
110 120 130 140 150
NVSSHSFTLW RAGPAGHVAA VLASLLVLVV LLLVALLYVK CRLNMLLWYQ
160 170 180 190 200
DTYGEVEMND GKLYDAYVSY SDCPEDRKFV NFILKPQLER RRGYKLFLED
210 220 230 240 250
RDLLPRAEPS ADLLVNLSRC RRLIVVLSDA FLSRPWCSQS FREGLCRLLE
260 270 280 290 300
LTRRPIFITF EGQRREPIHP ALRLLRQHRH LVTLVLWKPG SVTPSSDFWK
310 320 330 340 350
ELQLALPRKV QYRPVEGDPQ TRLQDDKDPM LIVRGRAAQG RGMESELDPD
360 370 380 390 400
PEGDLGVRGP VFGEPPTPLQ ETRICIGESH GSEMDVSDLG SRNYSARTDF

YCLVSEDDV
Length:409
Mass (Da):46,159
Last modified:September 27, 2005 - v2
Checksum:i9D175DC27AAFBE18
GO
Isoform 2 (identifier: Q9JLZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     357-409: VRGPVFGEPP...FYCLVSEDDV → MLTADQGVKHSSSVLERTQAWRTLASRDPVS

Note: No experimental confirmation available.
Show »
Length:387
Mass (Da):43,753
Checksum:i2D00E899D2707076
GO

Sequence cautioni

The sequence AAF26200 differs from that shown. Reason: Frameshift at positions 244 and 275.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti154G → R in AAF26200 (PubMed:14993616).Curated1
Sequence conflicti208 – 209EP → DA in AAF26200 (PubMed:14993616).Curated2
Sequence conflicti277 – 278QH → HD in AAF26200 (PubMed:14993616).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015718357 – 409VRGPV…SEDDV → MLTADQGVKHSSSVLERTQA WRTLASRDPVS in isoform 2. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF113795 mRNA. Translation: AAF26200.1. Frameshift.
BC010806 mRNA. Translation: AAH10806.1.
BC094069 mRNA. Translation: AAH94069.1.
CCDSiCCDS40179.1. [Q9JLZ8-1]
RefSeqiNP_075546.2. NM_023059.3. [Q9JLZ8-1]
XP_006536239.1. XM_006536176.2. [Q9JLZ8-1]
XP_006536240.1. XM_006536177.3. [Q9JLZ8-1]
XP_006536241.1. XM_006536178.3. [Q9JLZ8-1]
XP_006536242.1. XM_006536179.3. [Q9JLZ8-1]
XP_006536243.1. XM_006536180.2. [Q9JLZ8-1]
UniGeneiMm.38017.

Genome annotation databases

EnsembliENSMUST00000097958; ENSMUSP00000095571; ENSMUSG00000025494. [Q9JLZ8-1]
ENSMUST00000209294; ENSMUSP00000147541; ENSMUSG00000025494. [Q9JLZ8-1]
ENSMUST00000210167; ENSMUSP00000147280; ENSMUSG00000025494. [Q9JLZ8-2]
GeneIDi24058.
KEGGimmu:24058.
UCSCiuc009kjk.1. mouse. [Q9JLZ8-1]
uc009kjm.1. mouse. [Q9JLZ8-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF113795 mRNA. Translation: AAF26200.1. Frameshift.
BC010806 mRNA. Translation: AAH10806.1.
BC094069 mRNA. Translation: AAH94069.1.
CCDSiCCDS40179.1. [Q9JLZ8-1]
RefSeqiNP_075546.2. NM_023059.3. [Q9JLZ8-1]
XP_006536239.1. XM_006536176.2. [Q9JLZ8-1]
XP_006536240.1. XM_006536177.3. [Q9JLZ8-1]
XP_006536241.1. XM_006536178.3. [Q9JLZ8-1]
XP_006536242.1. XM_006536179.3. [Q9JLZ8-1]
XP_006536243.1. XM_006536180.2. [Q9JLZ8-1]
UniGeneiMm.38017.

3D structure databases

ProteinModelPortaliQ9JLZ8.
SMRiQ9JLZ8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9JLZ8. 1 interactor.
MINTiMINT-4130341.
STRINGi10090.ENSMUSP00000095571.

PTM databases

iPTMnetiQ9JLZ8.
PhosphoSitePlusiQ9JLZ8.

Proteomic databases

EPDiQ9JLZ8.
PaxDbiQ9JLZ8.
PRIDEiQ9JLZ8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000097958; ENSMUSP00000095571; ENSMUSG00000025494. [Q9JLZ8-1]
ENSMUST00000209294; ENSMUSP00000147541; ENSMUSG00000025494. [Q9JLZ8-1]
ENSMUST00000210167; ENSMUSP00000147280; ENSMUSG00000025494. [Q9JLZ8-2]
GeneIDi24058.
KEGGimmu:24058.
UCSCiuc009kjk.1. mouse. [Q9JLZ8-1]
uc009kjm.1. mouse. [Q9JLZ8-2]

Organism-specific databases

CTDi59307.
MGIiMGI:1344402. Sigirr.

Phylogenomic databases

eggNOGiENOG410IEXB. Eukaryota.
ENOG410ZFDI. LUCA.
GeneTreeiENSGT00840000129987.
HOGENOMiHOG000237348.
HOVERGENiHBG080781.
InParanoidiQ9JLZ8.
KOiK05169.
OMAiEVEMNDG.
OrthoDBiEOG091G0GXW.
PhylomeDBiQ9JLZ8.
TreeFamiTF325519.

Miscellaneous databases

PROiQ9JLZ8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000025494.
ExpressionAtlasiQ9JLZ8. baseline and differential.
GenevisibleiQ9JLZ8. MM.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
3.40.50.10140. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR015621. IL-1_rcpt_fam.
IPR000157. TIR_dom.
[Graphical view]
PANTHERiPTHR11890. PTHR11890. 1 hit.
PfamiPF13895. Ig_2. 1 hit.
PF01582. TIR. 1 hit.
[Graphical view]
SMARTiSM00255. TIR. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
SSF52200. SSF52200. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS50104. TIR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSIGIR_MOUSE
AccessioniPrimary (citable) accession number: Q9JLZ8
Secondary accession number(s): Q52L48
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: September 27, 2005
Last modified: November 2, 2016
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.