Reviewed,
UniProtKB/Swiss-Prot Q9JLI3 (MMEL1_MOUSE)
Last modified
October 13, 2009.
Version 54.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Membrane metallo-endopeptidase-like 1 EC=3.4.24.11 Alternative name(s): Neprilysin-2 Neprilysin II NL2 NEPII NEP2(m) Neprilysin-like peptidase Short name=NEPLP Neprilysin-like 1 Short name=NL-1 Soluble secreted endopeptidase Cleaved into the following chain: 1- Recommended name: Membrane metallo-endopeptidase-like 1, soluble form Alternative name(s): Neprilysin-2 secreted Short name=NEP2(s) | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 765 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Metalloprotease involved in sperm function, possibly by modulating the processes of fertilization and early embryonic development. Degrades a broad variety of small peptides with a preference for peptides shorter than 3 kDa containing neutral bulky aliphatic or aromatic amino acid residues. Shares the same substrate specificiy with MME and cleaves peptides at the same amide bond. Ref.1 Ref.3 |
| Catalytic activity | Preferential cleavage of polypeptides between hydrophobic residues, particularly with Phe or Tyr at P1'. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Inhibited by thiorphan and phosphoramidon. Ref.3 |
| Subcellular location | Membrane; Single-pass type II membrane protein. Secreted. Note: A secreted form produced by proteollytic cleavage also exists. Ref.1 |
| Tissue specificity | Highly expressed in testis. Also expressed in ovary. Weakly or not expressed in brain, lung, heart, liver, kidney, adrenal gland and intestine. Ref.1 |
| Post-translational modification | |
| Disruption phenotype | Mice are viable and develop normally. However, males produce smaller litters, indicating specific male fertility problems. Ref.5 |
| Sequence similarities | Belongs to the peptidase M13 family. |
| Biophysicochemical properties | Kinetic parameters: KM=18 µM for D-Ala(2)-Leu(5)-enkephalin |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Signal-anchor Transmembrane |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Disulfide bond Glycoprotein |
| Gene Ontology (GO) | |
| Biological process | proteolysis Inferred from electronic annotation. Source: InterPro |
| Cellular component | Golgi apparatus Ref.1 Inferred from direct assay. Source: MGI endoplasmic reticulum Ref.1Inferred from direct assay. Source: MGI extracellular space Ref.1Traceable author statement. Source: MGI integral to membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | metalloendopeptidase activity Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9JLI3-1) Also known as: Beta; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9JLI3-2) Also known as: Alpha; Delta; The sequence of this isoform differs from the canonical sequence as follows: 41-63: Missing. | ||||||
| Isoform 3 (identifier: Q9JLI3-3) Also known as: Gamma; The sequence of this isoform differs from the canonical sequence as follows: 41-63: Missing. 330-330: F → FGLKDRVSLCSPGCPGTHSVDQAGLELGNPPASDSRVL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 765 | 765 | Membrane metallo-endopeptidase-like 1 | PRO_0000248417 | |||||||
| Chain | 63 – 765 | 703 | Membrane metallo-endopeptidase-like 1, soluble form Probable | PRO_0000248418 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 19 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 20 – 40 | 21 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 41 – 765 | 725 | Lumenal Potential | ||||||||
| Coiled coil | 523 – 549 | 27 | Potential | ||||||||
Sites | |||||||||||
| Active site | 606 | 1 | By similarity | ||||||||
| Active site | 666 | 1 | Proton donor By similarity | ||||||||
| Metal binding | 599 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 603 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 662 | 1 | Zinc; catalytic By similarity | ||||||||
| Binding site | 121 | 1 | Substrate carboxyl By similarity | ||||||||
| Site | 62 – 63 | 2 | Cleavage Probable | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 163 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 279 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 303 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 336 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 694 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 75 ↔ 80 | By similarity | |||||||||
| Disulfide bond | 98 ↔ 750 | By similarity | |||||||||
| Disulfide bond | 106 ↔ 710 | By similarity | |||||||||
| Disulfide bond | 161 ↔ 425 | By similarity | |||||||||
| Disulfide bond | 636 ↔ 762 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 41 – 63 | 23 | Missing in isoform 2 and isoform 3. | VSP_020290 | |||||||
| Alternative sequence | 330 | 1 | F → FGLKDRVSLCSPGCPGTHSV DQAGLELGNPPASDSRVL in isoform 3. | VSP_020291 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 62 – 63 | 2 | KR → NG: Abolishes formation the soluble form. Ref.2 | ||||||||
| Sequence conflict | 189 | 1 | M → L in AAF13152. Ref.1 | ||||||||
| Sequence conflict | 189 | 1 | M → L in AAF13153. Ref.1 | ||||||||
| Sequence conflict | 264 | 1 | L → P in AAF13152. Ref.1 | ||||||||
| Sequence conflict | 264 | 1 | L → P in AAF13153. Ref.1 | ||||||||
| Sequence conflict | 659 | 1 | T → S in AAF13152. Ref.1 | ||||||||
| Sequence conflict | 659 | 1 | T → S in AAF13153. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular identification and characterization of novel membrane-bound metalloprotease, the soluble secreted form of which hydrolyzes a variety of vasoactive peptides." Ikeda K., Emoto N., Raharjo S.B., Nurhantari Y., Saiki K., Yokoyama M., Matsuo M. J. Biol. Chem. 274:32469-32477(1999) [PubMed: 10542292] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, GLYCOSYLATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "Molecular cloning and biochemical characterization of a new mouse testis soluble zinc-metallopeptidase of the neprilysin family." Ghaddar G., Ruchon A.F., Carpentier M., Marcinkiewicz M., Seidah N.G., Crine P., DesGroseillers L., Boileau G. Biochem. J. 347:419-429(2000) [PubMed: 10749671] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GLYCOSYLATION, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF 62-LYS-ARG-63. Tissue: Testis. |
| [3] | "Neprilysin degrades both amyloid beta peptides 1-40 and 1-42 most rapidly and efficiently among thiorphan- and phosphoramidon-sensitive endopeptidases." Shirotani K., Tsubuki S., Iwata N., Takaki Y., Harigaya W., Maruyama K., Kiryu-Seo S., Kiyama H., Iwata H., Tomita T., Iwatsubo T., Saido T.C. J. Biol. Chem. 276:21895-21901(2001) [PubMed: 11278416] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, ENZYME REGULATION. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 64-765. Strain: NOD. |
| [5] | "Reduced fertility in male mice deficient in the zinc metallopeptidase NL1." Carpentier M., Guillemette C., Bailey J.L., Boileau G., Jeannotte L., DesGroseillers L., Charron J. Mol. Cell. Biol. 24:4428-4437(2004) [PubMed: 15121861] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF157105 mRNA. Translation: AAF13152.1. AF157106 mRNA. Translation: AAF13153.1. AF176569 mRNA. Translation: AAF69247.1. AF302075 mRNA. Translation: AAG18446.1. AF302076 mRNA. Translation: AAG18447.1. AF302077 mRNA. Translation: AAG18448.1. AK154366 mRNA. Translation: BAE32538.1. Different initiation. | |
| IPI | IPI00112412. IPI00317343. IPI00648163. |
| RefSeq | NP_038811.2. |
| UniGene | Mm.116944 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1DMT based on UniProtKB P08473. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9JLI3. |
Protein family/group databases | |
| MEROPS | M13.008. |
PTM databases | |
| PhosphoSite | Q9JLI3. |
Proteomic databases | |
| PRIDE | Q9JLI3. |
Genome annotation databases | |
| Ensembl | ENSMUST00000079269; ENSMUSP00000078252; ENSMUSG00000058183; Mus musculus. [Genome view] ENSMUST00000080559; ENSMUSP00000079399; ENSMUSG00000058183; Mus musculus. [Genome view] ENSMUST00000105634; ENSMUSP00000101259; ENSMUSG00000058183; Mus musculus. [Genome view] |
| GeneID | 27390. |
| KEGG | mmu:27390. |
| UCSC | uc008wcd.1. mouse. uc008wcf.1. mouse. |
Organism-specific databases | |
| CTD | 27390. |
| MGI | MGI:1351603. Mmel1. |
Phylogenomic databases | |
| HOVERGEN | Q9JLI3. |
Enzyme and pathway databases | |
| BRENDA | 3.4.24.11. 244. |
Gene expression databases | |
| ArrayExpress | Q9JLI3. |
| Bgee | Q9JLI3. |
| CleanEx | MM_MMEL1. |
| Genevestigator | Q9JLI3. |
| GermOnline | ENSMUSG00000058183. Mus musculus. |
Family and domain databases | |
| InterPro | IPR006025. Pept_M_Zn_BS. IPR000718. Peptidase_M13. IPR018497. Peptidase_M13_C. IPR008753. Peptidase_M13_N. [Graphical view] |
| PANTHER | PTHR11733. Peptidase_M13. 1 hit. |
| Pfam | PF01431. Peptidase_M13. 1 hit. PF05649. Peptidase_M13_N. 1 hit. [Graphical view] |
| PRINTS | PR00786. NEPRILYSIN. |
| PROSITE | PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 305354. |
| SOURCE | Search... |
Entry information
| Entry name | MMEL1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9JLI3 Secondary accession number(s): Q3U495 Q9QZV7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


