Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9JLG8

- CAN15_MOUSE

UniProt

Q9JLG8 - CAN15_MOUSE

Protein

Calpain-15

Gene

Capn15

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei562 – 5621By similarity
    Active sitei727 – 7271By similarity
    Active sitei747 – 7471By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri3 – 3230RanBP2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri44 – 7330RanBP2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri148 – 17831RanBP2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri348 – 37932RanBP2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri422 – 45130RanBP2-type 5PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium-dependent cysteine-type endopeptidase activity Source: RefGenome
    2. zinc ion binding Source: InterPro

    GO - Biological processi

    1. proteolysis Source: RefGenome

    Keywords - Molecular functioni

    Hydrolase, Protease, Thiol protease

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiC02.010.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calpain-15 (EC:3.4.22.-)
    Alternative name(s):
    Small optic lobes homolog
    Gene namesi
    Name:Capn15
    Synonyms:Solh
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 17

    Organism-specific databases

    MGIiMGI:1355075. Capn15.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: RefGenome

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10951095Calpain-15PRO_0000278771Add
    BLAST

    Proteomic databases

    PaxDbiQ9JLG8.
    PRIDEiQ9JLG8.

    PTM databases

    PhosphoSiteiQ9JLG8.

    Expressioni

    Tissue specificityi

    Expressed in olfactory bulbs (at protein level).1 Publication

    Gene expression databases

    BgeeiQ9JLG8.
    CleanExiMM_SOLH.
    GenevestigatoriQ9JLG8.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9JLG8.
    SMRiQ9JLG8. Positions 5-31, 352-378, 424-449, 466-908.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini497 – 803307Calpain catalyticPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi124 – 14825Glu-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase C2 family.Curated
    Contains 1 calpain catalytic domain.PROSITE-ProRule annotation
    Contains 5 RanBP2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri3 – 3230RanBP2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri44 – 7330RanBP2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri148 – 17831RanBP2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri348 – 37932RanBP2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri422 – 45130RanBP2-type 5PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG327523.
    GeneTreeiENSGT00750000117668.
    HOGENOMiHOG000007650.
    HOVERGENiHBG080984.
    InParanoidiQ9JLG8.
    KOiK08582.
    OMAiQRCTLHN.
    OrthoDBiEOG7NKKJJ.
    PhylomeDBiQ9JLG8.
    TreeFamiTF322245.

    Family and domain databases

    InterProiIPR022684. Calpain_cysteine_protease.
    IPR000169. Pept_cys_AS.
    IPR001300. Peptidase_C2_calpain_cat.
    IPR001876. Znf_RanBP2.
    [Graphical view]
    PfamiPF00648. Peptidase_C2. 1 hit.
    PF00641. zf-RanBP. 4 hits.
    [Graphical view]
    PRINTSiPR00704. CALPAIN.
    SMARTiSM00230. CysPc. 1 hit.
    SM00547. ZnF_RBZ. 5 hits.
    [Graphical view]
    PROSITEiPS50203. CALPAIN_CAT. 1 hit.
    PS00139. THIOL_PROTEASE_CYS. 1 hit.
    PS01358. ZF_RANBP2_1. 5 hits.
    PS50199. ZF_RANBP2_2. 4 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9JLG8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATVGEWSCA RCTFLNPAGQ RQCSICEAPR HKPDLDQILR LSVEEQKWPC     50
    ARCTFRNFLG KEACEVCGFT PEPVPGAPLL PIINGVLPKP PTILVEPKGS 100
    GKEEAGPVRT AGLVATEPAR GRPEGEEERE ERGEEEEKEQ EGEGERAEPG 150
    SGWACQRCTL HNTPVASSCS ACGGPRKLSL PRIPPEALVV PEVVAPTGFH 200
    VVPAPSQPVL PGEGAEADSP STSQGPTSTD QEPPRVPLFS PFSPTLQNNP 250
    VPRSRREVPP QLQPPVPEAV QSSASTSSKG PQQGPGRAAA GASRLAELLS 300
    GKELLPGKRL SVLEEEVPES SPARCESCSD VIDLAGDIVR YTPASPSSPD 350
    FTTWSCARCT LRNPTTAPRC SVCGGSKLHG FQEHSEPPTH CPDCGANKPG 400
    PCVGSCGRAP SAHKAVRLLP DRPGQWACPA CTLINTPRAK HCAACHTPQL 450
    LVTQCRGATP LRRRESMHVE KRRQTDEGEA KALWENIVAF CRENSVNFVD 500
    DSFPPGPASV GFPVGDSVQQ RVKQWLRPHE INCSVFRDHG TPWSVFHTLR 550
    PSDILQGLLG NCWFLSALAV LAERPDLVER VMVTRSLCAE GAYQVRLCKD 600
    GTWTTVLVDD MLPCDEAGFL LFSQAQRKQL WVALIEKALA KLHGSYFALQ 650
    AGRAIEGLAT LTGAPCESLA LQVSSTNPRE EPVDTDLIWA KMLSSKEAGF 700
    LMGASCGGGN MKVDDAAYES LGLRPRHAYS VLDVRDVQGS RLLRLRNPWG 750
    RFSWNGSWSD EWPHWPGHLR AELMPHGSSE GVFWMEYSDF IRYFDSVDIC 800
    KVHSDWQEAR VQGCFPSTAG GPVGVTALTV LERASLEFAL FQEGSRRSDS 850
    VDSHLLDLCI LVFRATFGTG GRLSLGRLLA HSKRAVKKFV NCDVMLEPGE 900
    YAVVCCAFNH WNPAPPGPPA QASSPSAGVP RGAPEPPGHV LAVYSSRLVM 950
    VEPVEAQPTT LADAIILLTE SRGERHEGRE GMTCYYLTHG WAGLIVVVEN 1000
    RHPKSYLHVQ CDCTDSFNVV STRGSLRTQD SVPPLHRQVL VILSQLEGNA 1050
    GFSITHRLAH RKAAQAFLSD WTASRGTHSP PLTPDVAGLH GPRPL 1095
    Length:1,095
    Mass (Da):118,719
    Last modified:October 1, 2000 - v1
    Checksum:i081E1DFED2AE5D28
    GO
    Isoform 2 (identifier: Q9JLG8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         921-921: Q → QGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPT
         978-1037: GREGMTCYYL...TQDSVPPLHR → VGGVLMGEGR...APQVLPACAM
         1038-1095: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,072
    Mass (Da):115,346
    Checksum:i77A7CC84EA7B7DD0
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei921 – 9211Q → QGKGPSQMRPTPSFPTSEPQ SPPTGKLLAPLSTPPT in isoform 2. 1 PublicationVSP_023363
    Alternative sequencei978 – 103760GREGM…PPLHR → VGGVLMGEGRGWATTSPGPP TLCLCPGSRGHDLLLPDSWL GGTHRGSGEPAPQVLPACAM in isoform 2. 1 PublicationVSP_023364Add
    BLAST
    Alternative sequencei1038 – 109558Missing in isoform 2. 1 PublicationVSP_023365Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF180445 Genomic DNA. Translation: AAF62871.1.
    BC058094 mRNA. Translation: AAH58094.1.
    CCDSiCCDS28540.1. [Q9JLG8-1]
    RefSeqiNP_056645.1. NM_015830.1. [Q9JLG8-1]
    UniGeneiMm.216072.
    Mm.486289.

    Genome annotation databases

    EnsembliENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326. [Q9JLG8-1]
    GeneIDi50817.
    KEGGimmu:50817.
    UCSCiuc008bcz.1. mouse. [Q9JLG8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF180445 Genomic DNA. Translation: AAF62871.1 .
    BC058094 mRNA. Translation: AAH58094.1 .
    CCDSi CCDS28540.1. [Q9JLG8-1 ]
    RefSeqi NP_056645.1. NM_015830.1. [Q9JLG8-1 ]
    UniGenei Mm.216072.
    Mm.486289.

    3D structure databases

    ProteinModelPortali Q9JLG8.
    SMRi Q9JLG8. Positions 5-31, 352-378, 424-449, 466-908.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    MEROPSi C02.010.

    PTM databases

    PhosphoSitei Q9JLG8.

    Proteomic databases

    PaxDbi Q9JLG8.
    PRIDEi Q9JLG8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000041641 ; ENSMUSP00000039528 ; ENSMUSG00000037326 . [Q9JLG8-1 ]
    GeneIDi 50817.
    KEGGi mmu:50817.
    UCSCi uc008bcz.1. mouse. [Q9JLG8-1 ]

    Organism-specific databases

    CTDi 6650.
    MGIi MGI:1355075. Capn15.

    Phylogenomic databases

    eggNOGi NOG327523.
    GeneTreei ENSGT00750000117668.
    HOGENOMi HOG000007650.
    HOVERGENi HBG080984.
    InParanoidi Q9JLG8.
    KOi K08582.
    OMAi QRCTLHN.
    OrthoDBi EOG7NKKJJ.
    PhylomeDBi Q9JLG8.
    TreeFami TF322245.

    Miscellaneous databases

    NextBioi 307819.
    PROi Q9JLG8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9JLG8.
    CleanExi MM_SOLH.
    Genevestigatori Q9JLG8.

    Family and domain databases

    InterProi IPR022684. Calpain_cysteine_protease.
    IPR000169. Pept_cys_AS.
    IPR001300. Peptidase_C2_calpain_cat.
    IPR001876. Znf_RanBP2.
    [Graphical view ]
    Pfami PF00648. Peptidase_C2. 1 hit.
    PF00641. zf-RanBP. 4 hits.
    [Graphical view ]
    PRINTSi PR00704. CALPAIN.
    SMARTi SM00230. CysPc. 1 hit.
    SM00547. ZnF_RBZ. 5 hits.
    [Graphical view ]
    PROSITEi PS50203. CALPAIN_CAT. 1 hit.
    PS00139. THIOL_PROTEASE_CYS. 1 hit.
    PS01358. ZF_RANBP2_1. 5 hits.
    PS50199. ZF_RANBP2_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Solh, the mouse homologue of the Drosophila melanogaster small optic lobes gene: organization, chromosomal mapping, and localization of gene product to the olfactory bulb."
      Kamei M., Webb G.C., Heydon K., Hendry I.A., Young I.G., Campbell H.D.
      Genomics 64:82-89(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY.
      Strain: BALB/c.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6.
      Tissue: Fetal brain.

    Entry informationi

    Entry nameiCAN15_MOUSE
    AccessioniPrimary (citable) accession number: Q9JLG8
    Secondary accession number(s): Q6PEE9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 20, 2007
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 92 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3