Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calpain-15

Gene

Capn15

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei562 – 5621By similarity
Active sitei727 – 7271By similarity
Active sitei747 – 7471By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri3 – 3230RanBP2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri44 – 7330RanBP2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri148 – 17831RanBP2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri348 – 37932RanBP2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri422 – 45130RanBP2-type 5PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. calcium-dependent cysteine-type endopeptidase activity Source: GO_Central
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. proteolysis Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiC02.010.

Names & Taxonomyi

Protein namesi
Recommended name:
Calpain-15 (EC:3.4.22.-)
Alternative name(s):
Small optic lobes homolog
Gene namesi
Name:Capn15
Synonyms:Solh
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1355075. Capn15.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: GO_Central
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10951095Calpain-15PRO_0000278771Add
BLAST

Proteomic databases

MaxQBiQ9JLG8.
PaxDbiQ9JLG8.
PRIDEiQ9JLG8.

PTM databases

PhosphoSiteiQ9JLG8.

Expressioni

Tissue specificityi

Expressed in olfactory bulbs (at protein level).1 Publication

Gene expression databases

BgeeiQ9JLG8.
CleanExiMM_SOLH.
GenevestigatoriQ9JLG8.

Structurei

3D structure databases

ProteinModelPortaliQ9JLG8.
SMRiQ9JLG8. Positions 466-908.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini497 – 803307Calpain catalyticPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi124 – 14825Glu-richAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase C2 family.Curated
Contains 1 calpain catalytic domain.PROSITE-ProRule annotation
Contains 5 RanBP2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri3 – 3230RanBP2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri44 – 7330RanBP2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri148 – 17831RanBP2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri348 – 37932RanBP2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri422 – 45130RanBP2-type 5PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG327523.
GeneTreeiENSGT00750000117668.
HOGENOMiHOG000007650.
HOVERGENiHBG080984.
InParanoidiQ9JLG8.
KOiK08582.
OMAiHGFQEHS.
OrthoDBiEOG7NKKJJ.
PhylomeDBiQ9JLG8.
TreeFamiTF322245.

Family and domain databases

InterProiIPR022684. Calpain_cysteine_protease.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
IPR001876. Znf_RanBP2.
[Graphical view]
PfamiPF00648. Peptidase_C2. 1 hit.
PF00641. zf-RanBP. 4 hits.
[Graphical view]
PRINTSiPR00704. CALPAIN.
SMARTiSM00230. CysPc. 1 hit.
SM00547. ZnF_RBZ. 5 hits.
[Graphical view]
PROSITEiPS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
PS01358. ZF_RANBP2_1. 5 hits.
PS50199. ZF_RANBP2_2. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9JLG8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATVGEWSCA RCTFLNPAGQ RQCSICEAPR HKPDLDQILR LSVEEQKWPC
60 70 80 90 100
ARCTFRNFLG KEACEVCGFT PEPVPGAPLL PIINGVLPKP PTILVEPKGS
110 120 130 140 150
GKEEAGPVRT AGLVATEPAR GRPEGEEERE ERGEEEEKEQ EGEGERAEPG
160 170 180 190 200
SGWACQRCTL HNTPVASSCS ACGGPRKLSL PRIPPEALVV PEVVAPTGFH
210 220 230 240 250
VVPAPSQPVL PGEGAEADSP STSQGPTSTD QEPPRVPLFS PFSPTLQNNP
260 270 280 290 300
VPRSRREVPP QLQPPVPEAV QSSASTSSKG PQQGPGRAAA GASRLAELLS
310 320 330 340 350
GKELLPGKRL SVLEEEVPES SPARCESCSD VIDLAGDIVR YTPASPSSPD
360 370 380 390 400
FTTWSCARCT LRNPTTAPRC SVCGGSKLHG FQEHSEPPTH CPDCGANKPG
410 420 430 440 450
PCVGSCGRAP SAHKAVRLLP DRPGQWACPA CTLINTPRAK HCAACHTPQL
460 470 480 490 500
LVTQCRGATP LRRRESMHVE KRRQTDEGEA KALWENIVAF CRENSVNFVD
510 520 530 540 550
DSFPPGPASV GFPVGDSVQQ RVKQWLRPHE INCSVFRDHG TPWSVFHTLR
560 570 580 590 600
PSDILQGLLG NCWFLSALAV LAERPDLVER VMVTRSLCAE GAYQVRLCKD
610 620 630 640 650
GTWTTVLVDD MLPCDEAGFL LFSQAQRKQL WVALIEKALA KLHGSYFALQ
660 670 680 690 700
AGRAIEGLAT LTGAPCESLA LQVSSTNPRE EPVDTDLIWA KMLSSKEAGF
710 720 730 740 750
LMGASCGGGN MKVDDAAYES LGLRPRHAYS VLDVRDVQGS RLLRLRNPWG
760 770 780 790 800
RFSWNGSWSD EWPHWPGHLR AELMPHGSSE GVFWMEYSDF IRYFDSVDIC
810 820 830 840 850
KVHSDWQEAR VQGCFPSTAG GPVGVTALTV LERASLEFAL FQEGSRRSDS
860 870 880 890 900
VDSHLLDLCI LVFRATFGTG GRLSLGRLLA HSKRAVKKFV NCDVMLEPGE
910 920 930 940 950
YAVVCCAFNH WNPAPPGPPA QASSPSAGVP RGAPEPPGHV LAVYSSRLVM
960 970 980 990 1000
VEPVEAQPTT LADAIILLTE SRGERHEGRE GMTCYYLTHG WAGLIVVVEN
1010 1020 1030 1040 1050
RHPKSYLHVQ CDCTDSFNVV STRGSLRTQD SVPPLHRQVL VILSQLEGNA
1060 1070 1080 1090
GFSITHRLAH RKAAQAFLSD WTASRGTHSP PLTPDVAGLH GPRPL
Length:1,095
Mass (Da):118,719
Last modified:September 30, 2000 - v1
Checksum:i081E1DFED2AE5D28
GO
Isoform 2 (identifier: Q9JLG8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-921: Q → QGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPT
     978-1037: GREGMTCYYL...TQDSVPPLHR → VGGVLMGEGR...APQVLPACAM
     1038-1095: Missing.

Note: No experimental confirmation available.

Show »
Length:1,072
Mass (Da):115,346
Checksum:i77A7CC84EA7B7DD0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei921 – 9211Q → QGKGPSQMRPTPSFPTSEPQ SPPTGKLLAPLSTPPT in isoform 2. 1 PublicationVSP_023363
Alternative sequencei978 – 103760GREGM…PPLHR → VGGVLMGEGRGWATTSPGPP TLCLCPGSRGHDLLLPDSWL GGTHRGSGEPAPQVLPACAM in isoform 2. 1 PublicationVSP_023364Add
BLAST
Alternative sequencei1038 – 109558Missing in isoform 2. 1 PublicationVSP_023365Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF180445 Genomic DNA. Translation: AAF62871.1.
BC058094 mRNA. Translation: AAH58094.1.
CCDSiCCDS28540.1. [Q9JLG8-1]
RefSeqiNP_056645.1. NM_015830.1. [Q9JLG8-1]
UniGeneiMm.216072.
Mm.486289.

Genome annotation databases

EnsembliENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326. [Q9JLG8-1]
GeneIDi50817.
KEGGimmu:50817.
UCSCiuc008bcz.1. mouse. [Q9JLG8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF180445 Genomic DNA. Translation: AAF62871.1.
BC058094 mRNA. Translation: AAH58094.1.
CCDSiCCDS28540.1. [Q9JLG8-1]
RefSeqiNP_056645.1. NM_015830.1. [Q9JLG8-1]
UniGeneiMm.216072.
Mm.486289.

3D structure databases

ProteinModelPortaliQ9JLG8.
SMRiQ9JLG8. Positions 466-908.
ModBaseiSearch...
MobiDBiSearch...

Protein family/group databases

MEROPSiC02.010.

PTM databases

PhosphoSiteiQ9JLG8.

Proteomic databases

MaxQBiQ9JLG8.
PaxDbiQ9JLG8.
PRIDEiQ9JLG8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326. [Q9JLG8-1]
GeneIDi50817.
KEGGimmu:50817.
UCSCiuc008bcz.1. mouse. [Q9JLG8-1]

Organism-specific databases

CTDi6650.
MGIiMGI:1355075. Capn15.

Phylogenomic databases

eggNOGiNOG327523.
GeneTreeiENSGT00750000117668.
HOGENOMiHOG000007650.
HOVERGENiHBG080984.
InParanoidiQ9JLG8.
KOiK08582.
OMAiHGFQEHS.
OrthoDBiEOG7NKKJJ.
PhylomeDBiQ9JLG8.
TreeFamiTF322245.

Miscellaneous databases

NextBioi307819.
PROiQ9JLG8.
SOURCEiSearch...

Gene expression databases

BgeeiQ9JLG8.
CleanExiMM_SOLH.
GenevestigatoriQ9JLG8.

Family and domain databases

InterProiIPR022684. Calpain_cysteine_protease.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
IPR001876. Znf_RanBP2.
[Graphical view]
PfamiPF00648. Peptidase_C2. 1 hit.
PF00641. zf-RanBP. 4 hits.
[Graphical view]
PRINTSiPR00704. CALPAIN.
SMARTiSM00230. CysPc. 1 hit.
SM00547. ZnF_RBZ. 5 hits.
[Graphical view]
PROSITEiPS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
PS01358. ZF_RANBP2_1. 5 hits.
PS50199. ZF_RANBP2_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Solh, the mouse homologue of the Drosophila melanogaster small optic lobes gene: organization, chromosomal mapping, and localization of gene product to the olfactory bulb."
    Kamei M., Webb G.C., Heydon K., Hendry I.A., Young I.G., Campbell H.D.
    Genomics 64:82-89(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY.
    Strain: BALB/c.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Fetal brain.

Entry informationi

Entry nameiCAN15_MOUSE
AccessioniPrimary (citable) accession number: Q9JLG8
Secondary accession number(s): Q6PEE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 19, 2007
Last sequence update: September 30, 2000
Last modified: February 3, 2015
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.