Q9JLG8 (CAN15_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calpain-15 EC=3.4.22.- Alternative name(s): Small optic lobes homolog | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 1095 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Tissue specificity | Expressed in olfactory bulbs (at protein level). Ref.1 |
| Sequence similarities | Belongs to the peptidase C2 family. Contains 1 calpain catalytic domain. Contains 5 RanBP2-type zinc fingers. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Protease Thiol protease |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | proteolysis Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular_function | calcium-dependent cysteine-type endopeptidase activity Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9JLG8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9JLG8-2) The sequence of this isoform differs from the canonical sequence as follows: 921-921: Q → QGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPT 978-1037: GREGMTCYYL...TQDSVPPLHR → VGGVLMGEGR...APQVLPACAM 1038-1095: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1095 | 1095 | Calpain-15 | PRO_0000278771 | |||||
Regions | |||||||||
| Domain | 497 – 803 | 307 | Calpain catalytic | ||||||
| Zinc finger | 3 – 32 | 30 | RanBP2-type 1 | ||||||
| Zinc finger | 44 – 73 | 30 | RanBP2-type 2 | ||||||
| Zinc finger | 148 – 178 | 31 | RanBP2-type 3 | ||||||
| Zinc finger | 348 – 379 | 32 | RanBP2-type 4 | ||||||
| Zinc finger | 422 – 451 | 30 | RanBP2-type 5 | ||||||
| Compositional bias | 124 – 148 | 25 | Glu-rich | ||||||
Sites | |||||||||
| Active site | 562 | 1 | By similarity | ||||||
| Active site | 727 | 1 | By similarity | ||||||
| Active site | 747 | 1 | By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 921 | 1 | Q → QGKGPSQMRPTPSFPTSEPQ SPPTGKLLAPLSTPPT in isoform 2. | VSP_023363 | |||||
| Alternative sequence | 978 – 1037 | 60 | GREGM…PPLHR → VGGVLMGEGRGWATTSPGPP TLCLCPGSRGHDLLLPDSWL GGTHRGSGEPAPQVLPACAM in isoform 2. | VSP_023364 | |||||
| Alternative sequence | 1038 – 1095 | 58 | Missing in isoform 2. | VSP_023365 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Solh, the mouse homologue of the Drosophila melanogaster small optic lobes gene: organization, chromosomal mapping, and localization of gene product to the olfactory bulb." Kamei M., Webb G.C., Heydon K., Hendry I.A., Young I.G., Campbell H.D. Genomics 64:82-89(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY. Strain: BALB/c. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Fetal brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF180445 Genomic DNA. Translation: AAF62871.1. BC058094 mRNA. Translation: AAH58094.1. |
| IPI | IPI00124299. IPI00828269. |
| RefSeq | NP_056645.1. NM_015830.1. |
| UniGene | Mm.216072. Mm.486289. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QXP based on UniProtKB P97571. |
| ProteinModelPortal | Q9JLG8. |
| SMR | Q9JLG8. Positions 466-908. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | C02.010. |
PTM databases | |
| PhosphoSite | Q9JLG8. |
Proteomic databases | |
| PaxDb | Q9JLG8. |
| PRIDE | Q9JLG8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326. |
| GeneID | 50817. |
| KEGG | mmu:50817. |
| UCSC | uc008bcz.1. mouse. |
Organism-specific databases | |
| CTD | 6650. |
| MGI | MGI:1355075. Solh. |
Phylogenomic databases | |
| eggNOG | NOG327523. |
| GeneTree | ENSGT00700000104120. |
| HOGENOM | HOG000007650. |
| HOVERGEN | HBG080984. |
| InParanoid | Q9JLG8. |
| KO | K08582. |
| OMA | QRCTLHN. |
| OrthoDB | EOG46T30S. |
Gene expression databases | |
| Bgee | Q9JLG8. |
| CleanEx | MM_SOLH. |
| Genevestigator | Q9JLG8. |
Family and domain databases | |
| InterPro | IPR022684. Calpain_cysteine_protease. IPR000169. Pept_cys_AS. IPR001300. Peptidase_C2_calpain_cat. IPR001876. Znf_RanBP2. [Graphical view] |
| Pfam | PF00648. Peptidase_C2. 1 hit. PF00641. zf-RanBP. 4 hits. [Graphical view] |
| PRINTS | PR00704. CALPAIN. |
| SMART | SM00230. CysPc. 1 hit. SM00547. ZnF_RBZ. 5 hits. [Graphical view] |
| PROSITE | PS50203. CALPAIN_CAT. 1 hit. PS00640. THIOL_PROTEASE_ASN. False negative. PS00139. THIOL_PROTEASE_CYS. 1 hit. PS00639. THIOL_PROTEASE_HIS. False negative. PS01358. ZF_RANBP2_1. 5 hits. PS50199. ZF_RANBP2_2. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 307819. |
| SOURCE | Search... |
Entry information
| Entry name | CAN15_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9JLG8 Secondary accession number(s): Q6PEE9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |