Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9JLG8 (CAN15_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 88. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Calpain-15

EC=3.4.22.-
Alternative name(s):
Small optic lobes homolog
Gene names
Name:Capn15
Synonyms:Solh
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1095 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Tissue specificity

Expressed in olfactory bulbs (at protein level). Ref.1

Sequence similarities

Belongs to the peptidase C2 family.

Contains 1 calpain catalytic domain.

Contains 5 RanBP2-type zinc fingers.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainRepeat
Zinc-finger
   LigandMetal-binding
Zinc
   Molecular functionHydrolase
Protease
Thiol protease
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processproteolysis

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintracellular

Inferred from electronic annotation. Source: InterPro

   Molecular_functioncalcium-dependent cysteine-type endopeptidase activity

Inferred from electronic annotation. Source: InterPro

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9JLG8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9JLG8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     921-921: Q → QGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPT
     978-1037: GREGMTCYYL...TQDSVPPLHR → VGGVLMGEGR...APQVLPACAM
     1038-1095: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10951095Calpain-15
PRO_0000278771

Regions

Domain497 – 803307Calpain catalytic
Zinc finger3 – 3230RanBP2-type 1
Zinc finger44 – 7330RanBP2-type 2
Zinc finger148 – 17831RanBP2-type 3
Zinc finger348 – 37932RanBP2-type 4
Zinc finger422 – 45130RanBP2-type 5
Compositional bias124 – 14825Glu-rich

Sites

Active site5621 By similarity
Active site7271 By similarity
Active site7471 By similarity

Natural variations

Alternative sequence9211Q → QGKGPSQMRPTPSFPTSEPQ SPPTGKLLAPLSTPPT in isoform 2.
VSP_023363
Alternative sequence978 – 103760GREGM…PPLHR → VGGVLMGEGRGWATTSPGPP TLCLCPGSRGHDLLLPDSWL GGTHRGSGEPAPQVLPACAM in isoform 2.
VSP_023364
Alternative sequence1038 – 109558Missing in isoform 2.
VSP_023365

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 081E1DFED2AE5D28

FASTA1,095118,719
        10         20         30         40         50         60 
MATVGEWSCA RCTFLNPAGQ RQCSICEAPR HKPDLDQILR LSVEEQKWPC ARCTFRNFLG 

        70         80         90        100        110        120 
KEACEVCGFT PEPVPGAPLL PIINGVLPKP PTILVEPKGS GKEEAGPVRT AGLVATEPAR 

       130        140        150        160        170        180 
GRPEGEEERE ERGEEEEKEQ EGEGERAEPG SGWACQRCTL HNTPVASSCS ACGGPRKLSL 

       190        200        210        220        230        240 
PRIPPEALVV PEVVAPTGFH VVPAPSQPVL PGEGAEADSP STSQGPTSTD QEPPRVPLFS 

       250        260        270        280        290        300 
PFSPTLQNNP VPRSRREVPP QLQPPVPEAV QSSASTSSKG PQQGPGRAAA GASRLAELLS 

       310        320        330        340        350        360 
GKELLPGKRL SVLEEEVPES SPARCESCSD VIDLAGDIVR YTPASPSSPD FTTWSCARCT 

       370        380        390        400        410        420 
LRNPTTAPRC SVCGGSKLHG FQEHSEPPTH CPDCGANKPG PCVGSCGRAP SAHKAVRLLP 

       430        440        450        460        470        480 
DRPGQWACPA CTLINTPRAK HCAACHTPQL LVTQCRGATP LRRRESMHVE KRRQTDEGEA 

       490        500        510        520        530        540 
KALWENIVAF CRENSVNFVD DSFPPGPASV GFPVGDSVQQ RVKQWLRPHE INCSVFRDHG 

       550        560        570        580        590        600 
TPWSVFHTLR PSDILQGLLG NCWFLSALAV LAERPDLVER VMVTRSLCAE GAYQVRLCKD 

       610        620        630        640        650        660 
GTWTTVLVDD MLPCDEAGFL LFSQAQRKQL WVALIEKALA KLHGSYFALQ AGRAIEGLAT 

       670        680        690        700        710        720 
LTGAPCESLA LQVSSTNPRE EPVDTDLIWA KMLSSKEAGF LMGASCGGGN MKVDDAAYES 

       730        740        750        760        770        780 
LGLRPRHAYS VLDVRDVQGS RLLRLRNPWG RFSWNGSWSD EWPHWPGHLR AELMPHGSSE 

       790        800        810        820        830        840 
GVFWMEYSDF IRYFDSVDIC KVHSDWQEAR VQGCFPSTAG GPVGVTALTV LERASLEFAL 

       850        860        870        880        890        900 
FQEGSRRSDS VDSHLLDLCI LVFRATFGTG GRLSLGRLLA HSKRAVKKFV NCDVMLEPGE 

       910        920        930        940        950        960 
YAVVCCAFNH WNPAPPGPPA QASSPSAGVP RGAPEPPGHV LAVYSSRLVM VEPVEAQPTT 

       970        980        990       1000       1010       1020 
LADAIILLTE SRGERHEGRE GMTCYYLTHG WAGLIVVVEN RHPKSYLHVQ CDCTDSFNVV 

      1030       1040       1050       1060       1070       1080 
STRGSLRTQD SVPPLHRQVL VILSQLEGNA GFSITHRLAH RKAAQAFLSD WTASRGTHSP 

      1090 
PLTPDVAGLH GPRPL 

« Hide

Isoform 2 [UniParc].

Checksum: 77A7CC84EA7B7DD0
Show »

FASTA1,072115,346

References

« Hide 'large scale' references
[1]"Solh, the mouse homologue of the Drosophila melanogaster small optic lobes gene: organization, chromosomal mapping, and localization of gene product to the olfactory bulb."
Kamei M., Webb G.C., Heydon K., Hendry I.A., Young I.G., Campbell H.D.
Genomics 64:82-89(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY.
Strain: BALB/c.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6.
Tissue: Fetal brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF180445 Genomic DNA. Translation: AAF62871.1.
BC058094 mRNA. Translation: AAH58094.1.
RefSeqNP_056645.1. NM_015830.1.
UniGeneMm.216072.
Mm.486289.

3D structure databases

ProteinModelPortalQ9JLG8.
SMRQ9JLG8. Positions 5-30, 352-378, 424-449, 466-951.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

MEROPSC02.010.

PTM databases

PhosphoSiteQ9JLG8.

Proteomic databases

PaxDbQ9JLG8.
PRIDEQ9JLG8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326. [Q9JLG8-1]
GeneID50817.
KEGGmmu:50817.
UCSCuc008bcz.1. mouse. [Q9JLG8-1]

Organism-specific databases

CTD6650.
MGIMGI:1355075. Capn15.

Phylogenomic databases

eggNOGNOG327523.
GeneTreeENSGT00750000117668.
HOGENOMHOG000007650.
HOVERGENHBG080984.
InParanoidQ9JLG8.
KOK08582.
OMAQRCTLHN.
OrthoDBEOG7NKKJJ.
PhylomeDBQ9JLG8.
TreeFamTF322245.

Gene expression databases

BgeeQ9JLG8.
CleanExMM_SOLH.
GenevestigatorQ9JLG8.

Family and domain databases

InterProIPR022684. Calpain_cysteine_protease.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
IPR001876. Znf_RanBP2.
[Graphical view]
PfamPF00648. Peptidase_C2. 1 hit.
PF00641. zf-RanBP. 4 hits.
[Graphical view]
PRINTSPR00704. CALPAIN.
SMARTSM00230. CysPc. 1 hit.
SM00547. ZnF_RBZ. 5 hits.
[Graphical view]
PROSITEPS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
PS01358. ZF_RANBP2_1. 5 hits.
PS50199. ZF_RANBP2_2. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio307819.
PROQ9JLG8.
SOURCESearch...

Entry information

Entry nameCAN15_MOUSE
AccessionPrimary (citable) accession number: Q9JLG8
Secondary accession number(s): Q6PEE9
Entry history
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: October 1, 2000
Last modified: April 16, 2014
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot