SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9JLG8

- CAN15_MOUSE

UniProt

Q9JLG8 - CAN15_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Calpain-15

Gene
Capn15, Solh
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei562 – 5621 By similarity
Active sitei727 – 7271 By similarity
Active sitei747 – 7471 By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri3 – 3230RanBP2-type 1Add
BLAST
Zinc fingeri44 – 7330RanBP2-type 2Add
BLAST
Zinc fingeri148 – 17831RanBP2-type 3Add
BLAST
Zinc fingeri348 – 37932RanBP2-type 4Add
BLAST
Zinc fingeri422 – 45130RanBP2-type 5Add
BLAST

GO - Molecular functioni

  1. calcium-dependent cysteine-type endopeptidase activity Source: RefGenome
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. proteolysis Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiC02.010.

Names & Taxonomyi

Protein namesi
Recommended name:
Calpain-15 (EC:3.4.22.-)
Alternative name(s):
Small optic lobes homolog
Gene namesi
Name:Capn15
Synonyms:Solh
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 17

Organism-specific databases

MGIiMGI:1355075. Capn15.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: RefGenome
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10951095Calpain-15PRO_0000278771Add
BLAST

Proteomic databases

PaxDbiQ9JLG8.
PRIDEiQ9JLG8.

PTM databases

PhosphoSiteiQ9JLG8.

Expressioni

Tissue specificityi

Expressed in olfactory bulbs (at protein level).1 Publication

Gene expression databases

BgeeiQ9JLG8.
CleanExiMM_SOLH.
GenevestigatoriQ9JLG8.

Structurei

3D structure databases

ProteinModelPortaliQ9JLG8.
SMRiQ9JLG8. Positions 5-31, 352-378, 424-449, 466-908.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini497 – 803307Calpain catalyticAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi124 – 14825Glu-richAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase C2 family.

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri3 – 3230RanBP2-type 1Add
BLAST
Zinc fingeri44 – 7330RanBP2-type 2Add
BLAST
Zinc fingeri148 – 17831RanBP2-type 3Add
BLAST
Zinc fingeri348 – 37932RanBP2-type 4Add
BLAST
Zinc fingeri422 – 45130RanBP2-type 5Add
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG327523.
GeneTreeiENSGT00750000117668.
HOGENOMiHOG000007650.
HOVERGENiHBG080984.
InParanoidiQ9JLG8.
KOiK08582.
OMAiQRCTLHN.
OrthoDBiEOG7NKKJJ.
PhylomeDBiQ9JLG8.
TreeFamiTF322245.

Family and domain databases

InterProiIPR022684. Calpain_cysteine_protease.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
IPR001876. Znf_RanBP2.
[Graphical view]
PfamiPF00648. Peptidase_C2. 1 hit.
PF00641. zf-RanBP. 4 hits.
[Graphical view]
PRINTSiPR00704. CALPAIN.
SMARTiSM00230. CysPc. 1 hit.
SM00547. ZnF_RBZ. 5 hits.
[Graphical view]
PROSITEiPS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
PS01358. ZF_RANBP2_1. 5 hits.
PS50199. ZF_RANBP2_2. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9JLG8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATVGEWSCA RCTFLNPAGQ RQCSICEAPR HKPDLDQILR LSVEEQKWPC     50
ARCTFRNFLG KEACEVCGFT PEPVPGAPLL PIINGVLPKP PTILVEPKGS 100
GKEEAGPVRT AGLVATEPAR GRPEGEEERE ERGEEEEKEQ EGEGERAEPG 150
SGWACQRCTL HNTPVASSCS ACGGPRKLSL PRIPPEALVV PEVVAPTGFH 200
VVPAPSQPVL PGEGAEADSP STSQGPTSTD QEPPRVPLFS PFSPTLQNNP 250
VPRSRREVPP QLQPPVPEAV QSSASTSSKG PQQGPGRAAA GASRLAELLS 300
GKELLPGKRL SVLEEEVPES SPARCESCSD VIDLAGDIVR YTPASPSSPD 350
FTTWSCARCT LRNPTTAPRC SVCGGSKLHG FQEHSEPPTH CPDCGANKPG 400
PCVGSCGRAP SAHKAVRLLP DRPGQWACPA CTLINTPRAK HCAACHTPQL 450
LVTQCRGATP LRRRESMHVE KRRQTDEGEA KALWENIVAF CRENSVNFVD 500
DSFPPGPASV GFPVGDSVQQ RVKQWLRPHE INCSVFRDHG TPWSVFHTLR 550
PSDILQGLLG NCWFLSALAV LAERPDLVER VMVTRSLCAE GAYQVRLCKD 600
GTWTTVLVDD MLPCDEAGFL LFSQAQRKQL WVALIEKALA KLHGSYFALQ 650
AGRAIEGLAT LTGAPCESLA LQVSSTNPRE EPVDTDLIWA KMLSSKEAGF 700
LMGASCGGGN MKVDDAAYES LGLRPRHAYS VLDVRDVQGS RLLRLRNPWG 750
RFSWNGSWSD EWPHWPGHLR AELMPHGSSE GVFWMEYSDF IRYFDSVDIC 800
KVHSDWQEAR VQGCFPSTAG GPVGVTALTV LERASLEFAL FQEGSRRSDS 850
VDSHLLDLCI LVFRATFGTG GRLSLGRLLA HSKRAVKKFV NCDVMLEPGE 900
YAVVCCAFNH WNPAPPGPPA QASSPSAGVP RGAPEPPGHV LAVYSSRLVM 950
VEPVEAQPTT LADAIILLTE SRGERHEGRE GMTCYYLTHG WAGLIVVVEN 1000
RHPKSYLHVQ CDCTDSFNVV STRGSLRTQD SVPPLHRQVL VILSQLEGNA 1050
GFSITHRLAH RKAAQAFLSD WTASRGTHSP PLTPDVAGLH GPRPL 1095
Length:1,095
Mass (Da):118,719
Last modified:October 1, 2000 - v1
Checksum:i081E1DFED2AE5D28
GO
Isoform 2 (identifier: Q9JLG8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-921: Q → QGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPT
     978-1037: GREGMTCYYL...TQDSVPPLHR → VGGVLMGEGR...APQVLPACAM
     1038-1095: Missing.

Note: No experimental confirmation available.

Show »
Length:1,072
Mass (Da):115,346
Checksum:i77A7CC84EA7B7DD0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei921 – 9211Q → QGKGPSQMRPTPSFPTSEPQ SPPTGKLLAPLSTPPT in isoform 2. VSP_023363
Alternative sequencei978 – 103760GREGM…PPLHR → VGGVLMGEGRGWATTSPGPP TLCLCPGSRGHDLLLPDSWL GGTHRGSGEPAPQVLPACAM in isoform 2. VSP_023364Add
BLAST
Alternative sequencei1038 – 109558Missing in isoform 2. VSP_023365Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF180445 Genomic DNA. Translation: AAF62871.1.
BC058094 mRNA. Translation: AAH58094.1.
CCDSiCCDS28540.1. [Q9JLG8-1]
RefSeqiNP_056645.1. NM_015830.1. [Q9JLG8-1]
UniGeneiMm.216072.
Mm.486289.

Genome annotation databases

EnsembliENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326. [Q9JLG8-1]
GeneIDi50817.
KEGGimmu:50817.
UCSCiuc008bcz.1. mouse. [Q9JLG8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF180445 Genomic DNA. Translation: AAF62871.1 .
BC058094 mRNA. Translation: AAH58094.1 .
CCDSi CCDS28540.1. [Q9JLG8-1 ]
RefSeqi NP_056645.1. NM_015830.1. [Q9JLG8-1 ]
UniGenei Mm.216072.
Mm.486289.

3D structure databases

ProteinModelPortali Q9JLG8.
SMRi Q9JLG8. Positions 5-31, 352-378, 424-449, 466-908.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi C02.010.

PTM databases

PhosphoSitei Q9JLG8.

Proteomic databases

PaxDbi Q9JLG8.
PRIDEi Q9JLG8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000041641 ; ENSMUSP00000039528 ; ENSMUSG00000037326 . [Q9JLG8-1 ]
GeneIDi 50817.
KEGGi mmu:50817.
UCSCi uc008bcz.1. mouse. [Q9JLG8-1 ]

Organism-specific databases

CTDi 6650.
MGIi MGI:1355075. Capn15.

Phylogenomic databases

eggNOGi NOG327523.
GeneTreei ENSGT00750000117668.
HOGENOMi HOG000007650.
HOVERGENi HBG080984.
InParanoidi Q9JLG8.
KOi K08582.
OMAi QRCTLHN.
OrthoDBi EOG7NKKJJ.
PhylomeDBi Q9JLG8.
TreeFami TF322245.

Miscellaneous databases

NextBioi 307819.
PROi Q9JLG8.
SOURCEi Search...

Gene expression databases

Bgeei Q9JLG8.
CleanExi MM_SOLH.
Genevestigatori Q9JLG8.

Family and domain databases

InterProi IPR022684. Calpain_cysteine_protease.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
IPR001876. Znf_RanBP2.
[Graphical view ]
Pfami PF00648. Peptidase_C2. 1 hit.
PF00641. zf-RanBP. 4 hits.
[Graphical view ]
PRINTSi PR00704. CALPAIN.
SMARTi SM00230. CysPc. 1 hit.
SM00547. ZnF_RBZ. 5 hits.
[Graphical view ]
PROSITEi PS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
PS01358. ZF_RANBP2_1. 5 hits.
PS50199. ZF_RANBP2_2. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Solh, the mouse homologue of the Drosophila melanogaster small optic lobes gene: organization, chromosomal mapping, and localization of gene product to the olfactory bulb."
    Kamei M., Webb G.C., Heydon K., Hendry I.A., Young I.G., Campbell H.D.
    Genomics 64:82-89(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY.
    Strain: BALB/c.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Fetal brain.

Entry informationi

Entry nameiCAN15_MOUSE
AccessioniPrimary (citable) accession number: Q9JLG8
Secondary accession number(s): Q6PEE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi