Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calpain-15

Gene

Capn15

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei562By similarity1
Active sitei727By similarity1
Active sitei747By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri3 – 32RanBP2-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri44 – 73RanBP2-type 2PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri148 – 178RanBP2-type 3PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri348 – 379RanBP2-type 4PROSITE-ProRule annotationAdd BLAST32
Zinc fingeri422 – 451RanBP2-type 5PROSITE-ProRule annotationAdd BLAST30

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-1474228 Degradation of the extracellular matrix

Names & Taxonomyi

Protein namesi
Recommended name:
Calpain-15 (EC:3.4.22.-)
Alternative name(s):
Small optic lobes homolog
Gene namesi
Name:Capn15
Synonyms:Solh
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1355075 Capn15

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002787711 – 1095Calpain-15Add BLAST1095

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei311PhosphoserineBy similarity1
Modified residuei345PhosphoserineBy similarity1
Modified residuei348PhosphoserineBy similarity1
Modified residuei1079PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9JLG8
PRIDEiQ9JLG8

PTM databases

iPTMnetiQ9JLG8
PhosphoSitePlusiQ9JLG8

Expressioni

Tissue specificityi

Expressed in olfactory bulbs (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000037326
CleanExiMM_SOLH
ExpressionAtlasiQ9JLG8 baseline and differential
GenevisibleiQ9JLG8 MM

Interactioni

Protein-protein interaction databases

BioGridi206132, 2 interactors
STRINGi10090.ENSMUSP00000039528

Structurei

3D structure databases

ProteinModelPortaliQ9JLG8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini497 – 803Calpain catalyticPROSITE-ProRule annotationAdd BLAST307

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi124 – 148Glu-richAdd BLAST25

Sequence similaritiesi

Belongs to the peptidase C2 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri3 – 32RanBP2-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri44 – 73RanBP2-type 2PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri148 – 178RanBP2-type 3PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri348 – 379RanBP2-type 4PROSITE-ProRule annotationAdd BLAST32
Zinc fingeri422 – 451RanBP2-type 5PROSITE-ProRule annotationAdd BLAST30

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0045 Eukaryota
ENOG410XP0B LUCA
GeneTreeiENSGT00750000117668
HOGENOMiHOG000007650
HOVERGENiHBG080984
InParanoidiQ9JLG8
KOiK08582
OrthoDBiEOG091G02OL
PhylomeDBiQ9JLG8
TreeFamiTF322245

Family and domain databases

CDDicd00044 CysPc, 1 hit
InterProiView protein in InterPro
IPR022684 Calpain_cysteine_protease
IPR000169 Pept_cys_AS
IPR001300 Peptidase_C2_calpain_cat
IPR001876 Znf_RanBP2
IPR036443 Znf_RanBP2_sf
PfamiView protein in Pfam
PF00648 Peptidase_C2, 1 hit
PF00641 zf-RanBP, 4 hits
PRINTSiPR00704 CALPAIN
SMARTiView protein in SMART
SM00230 CysPc, 1 hit
SM00547 ZnF_RBZ, 5 hits
SUPFAMiSSF90209 SSF90209, 4 hits
PROSITEiView protein in PROSITE
PS50203 CALPAIN_CAT, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit
PS01358 ZF_RANBP2_1, 5 hits
PS50199 ZF_RANBP2_2, 4 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9JLG8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATVGEWSCA RCTFLNPAGQ RQCSICEAPR HKPDLDQILR LSVEEQKWPC
60 70 80 90 100
ARCTFRNFLG KEACEVCGFT PEPVPGAPLL PIINGVLPKP PTILVEPKGS
110 120 130 140 150
GKEEAGPVRT AGLVATEPAR GRPEGEEERE ERGEEEEKEQ EGEGERAEPG
160 170 180 190 200
SGWACQRCTL HNTPVASSCS ACGGPRKLSL PRIPPEALVV PEVVAPTGFH
210 220 230 240 250
VVPAPSQPVL PGEGAEADSP STSQGPTSTD QEPPRVPLFS PFSPTLQNNP
260 270 280 290 300
VPRSRREVPP QLQPPVPEAV QSSASTSSKG PQQGPGRAAA GASRLAELLS
310 320 330 340 350
GKELLPGKRL SVLEEEVPES SPARCESCSD VIDLAGDIVR YTPASPSSPD
360 370 380 390 400
FTTWSCARCT LRNPTTAPRC SVCGGSKLHG FQEHSEPPTH CPDCGANKPG
410 420 430 440 450
PCVGSCGRAP SAHKAVRLLP DRPGQWACPA CTLINTPRAK HCAACHTPQL
460 470 480 490 500
LVTQCRGATP LRRRESMHVE KRRQTDEGEA KALWENIVAF CRENSVNFVD
510 520 530 540 550
DSFPPGPASV GFPVGDSVQQ RVKQWLRPHE INCSVFRDHG TPWSVFHTLR
560 570 580 590 600
PSDILQGLLG NCWFLSALAV LAERPDLVER VMVTRSLCAE GAYQVRLCKD
610 620 630 640 650
GTWTTVLVDD MLPCDEAGFL LFSQAQRKQL WVALIEKALA KLHGSYFALQ
660 670 680 690 700
AGRAIEGLAT LTGAPCESLA LQVSSTNPRE EPVDTDLIWA KMLSSKEAGF
710 720 730 740 750
LMGASCGGGN MKVDDAAYES LGLRPRHAYS VLDVRDVQGS RLLRLRNPWG
760 770 780 790 800
RFSWNGSWSD EWPHWPGHLR AELMPHGSSE GVFWMEYSDF IRYFDSVDIC
810 820 830 840 850
KVHSDWQEAR VQGCFPSTAG GPVGVTALTV LERASLEFAL FQEGSRRSDS
860 870 880 890 900
VDSHLLDLCI LVFRATFGTG GRLSLGRLLA HSKRAVKKFV NCDVMLEPGE
910 920 930 940 950
YAVVCCAFNH WNPAPPGPPA QASSPSAGVP RGAPEPPGHV LAVYSSRLVM
960 970 980 990 1000
VEPVEAQPTT LADAIILLTE SRGERHEGRE GMTCYYLTHG WAGLIVVVEN
1010 1020 1030 1040 1050
RHPKSYLHVQ CDCTDSFNVV STRGSLRTQD SVPPLHRQVL VILSQLEGNA
1060 1070 1080 1090
GFSITHRLAH RKAAQAFLSD WTASRGTHSP PLTPDVAGLH GPRPL
Length:1,095
Mass (Da):118,719
Last modified:October 1, 2000 - v1
Checksum:i081E1DFED2AE5D28
GO
Isoform 2 (identifier: Q9JLG8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-921: Q → QGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPT
     978-1037: GREGMTCYYL...TQDSVPPLHR → VGGVLMGEGR...APQVLPACAM
     1038-1095: Missing.

Note: No experimental confirmation available.
Show »
Length:1,072
Mass (Da):115,346
Checksum:i77A7CC84EA7B7DD0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023363921Q → QGKGPSQMRPTPSFPTSEPQ SPPTGKLLAPLSTPPT in isoform 2. 1 Publication1
Alternative sequenceiVSP_023364978 – 1037GREGM…PPLHR → VGGVLMGEGRGWATTSPGPP TLCLCPGSRGHDLLLPDSWL GGTHRGSGEPAPQVLPACAM in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0233651038 – 1095Missing in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF180445 Genomic DNA Translation: AAF62871.1
BC058094 mRNA Translation: AAH58094.1
CCDSiCCDS28540.1 [Q9JLG8-1]
RefSeqiNP_056645.1, NM_015830.1 [Q9JLG8-1]
UniGeneiMm.216072
Mm.486289

Genome annotation databases

EnsembliENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326 [Q9JLG8-1]
ENSMUST00000212149; ENSMUSP00000148718; ENSMUSG00000037326 [Q9JLG8-1]
GeneIDi50817
KEGGimmu:50817
UCSCiuc008bcz.1 mouse [Q9JLG8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCAN15_MOUSE
AccessioniPrimary (citable) accession number: Q9JLG8
Secondary accession number(s): Q6PEE9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: October 1, 2000
Last modified: March 28, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health