Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thyrotroph embryonic factor

Gene

Tef

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Transcription factor that binds to and transactivates the TSHB promoter. Binds to a minimal DNA-binding sequence 5'-[TC][AG][AG]TTA[TC][AG]-3' (By similarity). Also activates the telokin promoter in smooth muscle-specific and calcium-dependent manner.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Biological rhythms, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Thyrotroph embryonic factor
Gene namesi
Name:Tef
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:98663. Tef.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 301301Thyrotroph embryonic factorPRO_0000076513Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei30 – 301PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9JLC6.
PaxDbiQ9JLC6.
PRIDEiQ9JLC6.

PTM databases

iPTMnetiQ9JLC6.
PhosphoSiteiQ9JLC6.

Expressioni

Tissue specificityi

Isoform Alpha and isoform Beta are expressed at high levels in lung, bladder, kidney, gut and brain.

Inductioni

Accumulates according to a robust circadian rhythm in liver and kidney. In liver nuclei, the amplitude of daily oscillation has been estimated to be 9-fold. Expressed at nearly constant level in the brain.

Gene expression databases

BgeeiQ9JLC6.
CleanExiMM_TEF.
ExpressionAtlasiQ9JLC6. baseline and differential.
GenevisibleiQ9JLC6. MM.

Interactioni

Subunit structurei

Binds DNA as a homodimer or a heterodimer. Can form a heterodimer with DBP (By similarity).By similarity

Protein-protein interaction databases

BioGridi204106. 3 interactions.
STRINGi10090.ENSMUSP00000023024.

Structurei

3D structure databases

ProteinModelPortaliQ9JLC6.
SMRiQ9JLC6. Positions 259-292.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini231 – 29464bZIPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni233 – 25321Basic motifPROSITE-ProRule annotationAdd
BLAST
Regioni254 – 2618Leucine-zipperPROSITE-ProRule annotation

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi164 – 21552Pro-rich (proline/acidic region (PAR))Add
BLAST

Sequence similaritiesi

Belongs to the bZIP family. PAR subfamily.Curated
Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3119. Eukaryota.
ENOG410YJ8G. LUCA.
GeneTreeiENSGT00440000039070.
HOVERGENiHBG004983.
InParanoidiQ9JLC6.
KOiK09058.
OMAiCKNIVSK.
OrthoDBiEOG712TZJ.
PhylomeDBiQ9JLC6.
TreeFamiTF315869.

Family and domain databases

InterProiIPR004827. bZIP.
IPR029832. TEF/VBP.
[Graphical view]
PANTHERiPTHR11988:SF24. PTHR11988:SF24. 1 hit.
PfamiPF07716. bZIP_2. 1 hit.
[Graphical view]
SMARTiSM00338. BRLZ. 1 hit.
[Graphical view]
PROSITEiPS50217. BZIP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative promoter usage. AlignAdd to basket

Isoform Alpha (identifier: Q9JLC6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDAGGGKKP PVEPQAGPGP GRAAGERGLS GSFPLVLKKL MENPPRETRL
60 70 80 90 100
DKEKGKEKLE EDESAAASTM AVSASLMPPI WDKTIPYDGE SFHLEYMDLD
110 120 130 140 150
EFLLENGIPA SPTHLAQNLL LPVAELEGKE SASSSTASPP SSSTAIFQPS
160 170 180 190 200
ETVSSTESSL EKERETPSPI DPSCVEVDVN FNPDPADLVL SSVPGGELFN
210 220 230 240 250
PRKHRFAEED LKPQPMIKKA KKVFVPDEQK DEKYWTRRKK NNVAAKRSRD
260 270 280 290 300
ARRLKENQIT IRAAFLEKEN TALRTEVAEL RKEVGKCKTI VSKYETKYGP

L
Length:301
Mass (Da):33,145
Last modified:October 1, 2000 - v1
Checksum:iF83FFFC6D7E091A4
GO
Isoform Beta (identifier: Q9JLC6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSDAGGGKKP...MENPPRETRL → MSSCSQIGVAPAMDMPEVLKSLLEHSLPWSEKKA

Show »
Length:285
Mass (Da):31,707
Checksum:i9478FD36092F41EA
GO
Isoform 2 (identifier: Q9JLC6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPPRETRL → MDMPEVLKSLLEHSLPWSEKKA

Show »
Length:273
Mass (Da):30,575
Checksum:i49626F12DE8BAE6E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti38 – 381K → R in BAE26249 (PubMed:16141072).Curated
Sequence conflicti97 – 971M → V in BAC35849 (PubMed:16141072).Curated
Sequence conflicti191 – 1911S → C in BAE28255 (PubMed:16141072).Curated
Sequence conflicti219 – 2191K → E in BAE26249 (PubMed:16141072).Curated
Sequence conflicti224 – 2241F → L in BAE26249 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MSDAG…RETRL → MDMPEVLKSLLEHSLPWSEK KA in isoform 2. 1 PublicationVSP_011246Add
BLAST
Alternative sequencei1 – 5050MSDAG…RETRL → MSSCSQIGVAPAMDMPEVLK SLLEHSLPWSEKKA in isoform Beta. 2 PublicationsVSP_011245Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF194420 mRNA. Translation: AAF70830.1.
AY540631 mRNA. Translation: AAS45599.1.
AY540632 mRNA. Translation: AAS45600.1.
AK075601 mRNA. Translation: BAC35849.1.
AK141606 mRNA. Translation: BAE24760.1.
AK145125 mRNA. Translation: BAE26249.1.
AK147965 mRNA. Translation: BAE28255.1.
AK154472 mRNA. Translation: BAE32609.1.
BC017689 mRNA. Translation: AAH17689.1.
BC036982 mRNA. Translation: AAH36982.1.
CCDSiCCDS27671.2. [Q9JLC6-2]
CCDS27672.1. [Q9JLC6-1]
RefSeqiNP_059072.1. NM_017376.3. [Q9JLC6-1]
NP_705617.2. NM_153484.3. [Q9JLC6-2]
UniGeneiMm.270278.

Genome annotation databases

EnsembliENSMUST00000023024; ENSMUSP00000023024; ENSMUSG00000022389. [Q9JLC6-1]
ENSMUST00000109553; ENSMUSP00000105180; ENSMUSG00000022389. [Q9JLC6-2]
GeneIDi21685.
KEGGimmu:21685.
UCSCiuc007wxj.2. mouse. [Q9JLC6-2]
uc007wxk.2. mouse. [Q9JLC6-1]

Keywords - Coding sequence diversityi

Alternative promoter usage

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF194420 mRNA. Translation: AAF70830.1.
AY540631 mRNA. Translation: AAS45599.1.
AY540632 mRNA. Translation: AAS45600.1.
AK075601 mRNA. Translation: BAC35849.1.
AK141606 mRNA. Translation: BAE24760.1.
AK145125 mRNA. Translation: BAE26249.1.
AK147965 mRNA. Translation: BAE28255.1.
AK154472 mRNA. Translation: BAE32609.1.
BC017689 mRNA. Translation: AAH17689.1.
BC036982 mRNA. Translation: AAH36982.1.
CCDSiCCDS27671.2. [Q9JLC6-2]
CCDS27672.1. [Q9JLC6-1]
RefSeqiNP_059072.1. NM_017376.3. [Q9JLC6-1]
NP_705617.2. NM_153484.3. [Q9JLC6-2]
UniGeneiMm.270278.

3D structure databases

ProteinModelPortaliQ9JLC6.
SMRiQ9JLC6. Positions 259-292.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204106. 3 interactions.
STRINGi10090.ENSMUSP00000023024.

PTM databases

iPTMnetiQ9JLC6.
PhosphoSiteiQ9JLC6.

Proteomic databases

MaxQBiQ9JLC6.
PaxDbiQ9JLC6.
PRIDEiQ9JLC6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023024; ENSMUSP00000023024; ENSMUSG00000022389. [Q9JLC6-1]
ENSMUST00000109553; ENSMUSP00000105180; ENSMUSG00000022389. [Q9JLC6-2]
GeneIDi21685.
KEGGimmu:21685.
UCSCiuc007wxj.2. mouse. [Q9JLC6-2]
uc007wxk.2. mouse. [Q9JLC6-1]

Organism-specific databases

CTDi7008.
MGIiMGI:98663. Tef.

Phylogenomic databases

eggNOGiKOG3119. Eukaryota.
ENOG410YJ8G. LUCA.
GeneTreeiENSGT00440000039070.
HOVERGENiHBG004983.
InParanoidiQ9JLC6.
KOiK09058.
OMAiCKNIVSK.
OrthoDBiEOG712TZJ.
PhylomeDBiQ9JLC6.
TreeFamiTF315869.

Miscellaneous databases

ChiTaRSiTef. mouse.
PROiQ9JLC6.
SOURCEiSearch...

Gene expression databases

BgeeiQ9JLC6.
CleanExiMM_TEF.
ExpressionAtlasiQ9JLC6. baseline and differential.
GenevisibleiQ9JLC6. MM.

Family and domain databases

InterProiIPR004827. bZIP.
IPR029832. TEF/VBP.
[Graphical view]
PANTHERiPTHR11988:SF24. PTHR11988:SF24. 1 hit.
PfamiPF07716. bZIP_2. 1 hit.
[Graphical view]
SMARTiSM00338. BRLZ. 1 hit.
[Graphical view]
PROSITEiPS50217. BZIP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Involvement of thyrotroph embryonic factor in calcium-mediated regulation of gene expression."
    Krueger D.A., Warner E.A., Dowd D.R.
    J. Biol. Chem. 275:14524-14531(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    Strain: BALB/cJ.
    Tissue: Brain.
  2. "Activation of the smooth muscle-specific telokin gene by thyrotroph embryonic factor (TEF)."
    Zhou J., Hoggatt A.M., Herring B.P.
    J. Biol. Chem. 279:15929-15937(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA), ALTERNATIVE PROMOTER USAGE.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS ALPHA AND BETA).
    Strain: C57BL/6J and NOD.
    Tissue: Hippocampus, Kidney and Mammary gland.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS ALPHA AND 2).
    Strain: FVB/N.
    Tissue: Kidney and Mammary tumor.
  5. "The two PAR leucine zipper proteins, TEF and DBP, display similar circadian and tissue-specific expression, but have different target promoter preferences."
    Fonjallaz P., Ossipow V., Wanner G., Schibler U.
    EMBO J. 15:351-362(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: CIRCADIAN INDUCTION.
  6. "The loss of circadian PAR bZip transcription factors results in epilepsy."
    Gachon F., Fonjallaz P., Damiola F., Gos P., Kodama T., Zakany J., Duboule D., Petit B., Tafti M., Schibler U.
    Genes Dev. 18:1397-1412(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN EPILEPSY.

Entry informationi

Entry nameiTEF_MOUSE
AccessioniPrimary (citable) accession number: Q9JLC6
Secondary accession number(s): Q3U426
, Q3UGF4, Q3UM49, Q3URC8, Q6QHT6, Q8C6I0, Q8VD02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: October 1, 2000
Last modified: July 6, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Mice deficient for all three PAR bZIP proteins (DBP, HLF and TEF) display a dramatically shortened life span and are highly susceptible to generalized spontaneous and audiogenic epilepsies (due for example to the noise of a vacuum cleaner) that are frequently lethal. The down-regulation of pyridoxal kinase (Pdxk) expression in these mice may participate in this seizure phenotype.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.