Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

VPS10 domain-containing receptor SorCS1

Gene

Sorcs1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
VPS10 domain-containing receptor SorCS1
Short name:
mSorCS
Gene namesi
Name:Sorcs1
Synonyms:Sorcs
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1929666. Sorcs1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini34 – 1098LumenalSequence analysisAdd BLAST1065
Transmembranei1099 – 1119HelicalSequence analysisAdd BLAST21
Topological domaini1120 – 1167CytoplasmicSequence analysisAdd BLAST48

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 33Sequence analysisAdd BLAST33
ChainiPRO_000003317134 – 1167VPS10 domain-containing receptor SorCS1Add BLAST1134

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi184N-linked (GlcNAc...)Sequence analysis1
Glycosylationi352N-linked (GlcNAc...)Sequence analysis1
Glycosylationi433N-linked (GlcNAc...)Sequence analysis1
Glycosylationi775N-linked (GlcNAc...)Sequence analysis1
Glycosylationi815N-linked (GlcNAc...)Sequence analysis1
Glycosylationi846N-linked (GlcNAc...)Sequence analysis1
Glycosylationi907N-linked (GlcNAc...)Sequence analysis1
Glycosylationi928N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9JLC4.
PRIDEiQ9JLC4.

PTM databases

iPTMnetiQ9JLC4.
PhosphoSitePlusiQ9JLC4.

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in brain, and at lower levels in heart, liver and kidney. Detected in newborn brain and in adult olfactory bulb and cerebral cortex. Isoform 2 is highly expressed in liver, and at lower levels in heart, brain, kidney and testis.

Gene expression databases

CleanExiMM_SORCS1.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000072472.

Structurei

3D structure databases

ProteinModelPortaliQ9JLC4.
SMRiQ9JLC4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati208 – 219BNR 1Add BLAST12
Repeati256 – 267BNR 2Add BLAST12
Repeati492 – 503BNR 3Add BLAST12
Repeati569 – 580BNR 4Add BLAST12
Repeati611 – 622BNR 5Add BLAST12
Domaini802 – 893PKDPROSITE-ProRule annotationAdd BLAST92

Sequence similaritiesi

Contains 5 BNR repeats.Curated
Contains 1 PKD domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410ISX7. Eukaryota.
ENOG410Z4SB. LUCA.
HOVERGENiHBG059252.
InParanoidiQ9JLC4.
PhylomeDBiQ9JLC4.

Family and domain databases

Gene3Di2.60.40.670. 1 hit.
InterProiIPR000601. PKD_dom.
IPR031777. Sortilin_C.
IPR031778. Sortilin_N.
IPR006581. VPS10.
[Graphical view]
PfamiPF00801. PKD. 1 hit.
PF15902. Sortilin-Vps10. 1 hit.
PF15901. Sortilin_C. 1 hit.
[Graphical view]
SMARTiSM00602. VPS10. 1 hit.
[Graphical view]
SUPFAMiSSF49299. SSF49299. 2 hits.
PROSITEiPS50093. PKD. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9JLC4-1) [UniParc]FASTAAdd to basket
Also known as: SorCSb

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKVGAGDGS SAGLSALLAG AGLLMLLAPG VCSSLSCCPP QHPSSTPRRT
60 70 80 90 100
LTPRGFPHPG PLGRAPATPP PLFMRPLFAV APGDRALFLE RAGGSRVSVA
110 120 130 140 150
TAARSGRRRR SGTEPEKIEP GEGASRSRRD MLKDGGQQGL GTGARDPGKA
160 170 180 190 200
TRFRMEELRL TSTTFALTGD SAHNQAMVHW SGHNSSVILI LTKLYDYNLG
210 220 230 240 250
SITESSLWRS TDYGTTYEKL NDKVGLKTIL SYLYVCPTNK CKIMLLTDPE
260 270 280 290 300
IESSLLISSD EGATYQKYRL NFYLQSLLFH PKQEDWILAY SQDQKLYSSA
310 320 330 340 350
EFGRRWQLIQ ESVVPNRFYW SVMGSSKEPD LVHLEARTVD GHSIYLTCRM
360 370 380 390 400
QNCTEANRNK PFPGYIDPDS LIVQDDYVFV QLTSGGRPHY YVSYRRSPFA
410 420 430 440 450
QMKLPKYALP KDMHVISTDE NQVFAAVQEW NQNDTYNLYI SDTRGVYFTL
460 470 480 490 500
ALENVRSSRG PEGNVMIDLY EVAGIKGMFL ANKKIDNQVK TFITYNKGRD
510 520 530 540 550
WRLLQAPDAD LRGDPVHCLL PYCSLHLHLK VSENPYTSGI IASRDTAPSI
560 570 580 590 600
IVASGNIGSE LSDSDISMFV SSDAGNTWRQ IFEEEHSILY LDQGGVLVAM
610 620 630 640 650
KHTSLPIRHL WLSFDEGRSW SKYSFTSIPL FVDGVLGEPG EETLIMTVFG
660 670 680 690 700
HFSHRSEWQL VKVDYKSIFD RRCAEEDYRP WQLHSQGEAC IMGAKRIYKK
710 720 730 740 750
RKSERKCMQK YAGAMESEPC VCTEADFDCD YGYERHSNGQ CLPAFWFNPS
760 770 780 790 800
SLSKDCSLGQ SYLNSAGYRK VVSNNCTDGV REQYTAKPQK CPGKAPRGLR
810 820 830 840 850
IVTADGKLTA EQGHNVTLMV QLEEGDVQRT LIQVDFGDGI AVSYVNLSSM
860 870 880 890 900
EDGIKHVYQN VGIFRVTVQV DNSLGSDSAV LYLHVTCPLE HVHLSLPFVT
910 920 930 940 950
TKNKEVNATA VLWPSQVGTL TYVWWYGNNT EPLITLEGSI SFKFTSEGMN
960 970 980 990 1000
TITVQVSAGN AILQDTKTIA VYEEFRSLRL AFSPNLDDYN PDIPEWRRDI
1010 1020 1030 1040 1050
SRVIKKSLVE ATGIPSQHIL VAVLPGLPTA AELFVLPYQD GTRENKRSPE
1060 1070 1080 1090 1100
DLEQISEVLI HKLNQNLVHF ELKPGVQVLV HAAHLTAAPL VDLTPTHSGS
1110 1120 1130 1140 1150
AMLMLLSVVF VGLAVFVIYK FKRRVALPSP PSPSAQPGDS SLRLQRPRPA
1160
TPPSSPKRGS AGAQFAI
Length:1,167
Mass (Da):129,631
Last modified:October 1, 2000 - v1
Checksum:i3563396487105B73
GO
Isoform 2 (identifier: Q9JLC4-2) [UniParc]FASTAAdd to basket
Also known as: SorCSa

The sequence of this isoform differs from the canonical sequence as follows:
     1124-1167: RVALPSPPSPSAQPGDSSLRLQRPRPATPPSSPKRGSAGAQFAI → CVFLLLPSYPRPPPPSSFCQVQKQ

Show »
Length:1,147
Mass (Da):127,872
Checksum:i1360105BEB68CFA9
GO
Isoform 3 (identifier: Q9JLC4-3) [UniParc]FASTAAdd to basket
Also known as: SorCSc

The sequence of this isoform differs from the canonical sequence as follows:
     1124-1167: RVALPSPPSP...RGSAGAQFAI → KIPGINVYAQ...EKVESQLLGK

Show »
Length:1,178
Mass (Da):131,356
Checksum:i91D54F6CFA291654
GO
Isoform 4 (identifier: Q9JLC4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1124-1167: RVALPSPPSP...RGSAGAQFAI → KIPGINVYAQ...EKVESQLLGE

Show »
Length:1,178
Mass (Da):131,347
Checksum:i99F67F5FFA291654
GO

Sequence cautioni

The sequence AAH07486 differs from that shown. Reason: Frameshift at position 472.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti10S → Y in AAF24748 (PubMed:10600506).Curated1
Sequence conflicti709Q → QG in AAH07486 (PubMed:15489334).Curated1
Sequence conflicti766A → T in AAH07486 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0062051124 – 1167RVALP…AQFAI → CVFLLLPSYPRPPPPSSFCQ VQKQ in isoform 2. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0062061124 – 1167RVALP…AQFAI → KIPGINVYAQMQNEKEQELI NPVSHSESRPSVPHPDLRRP GQLVDEKVESQLLGK in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0062071124 – 1167RVALP…AQFAI → KIPGINVYAQMQNEKEQELI NPVSHSESRSSVPHPDLRRP GQLVDEKVESQLLGE in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF137367 mRNA. Translation: AAF24748.1.
AF195056 mRNA. Translation: AAF68196.1.
AF284755 mRNA. Translation: AAL56666.1.
BC007486 mRNA. Translation: AAH07486.1. Frameshift.
UniGeneiMm.313672.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF137367 mRNA. Translation: AAF24748.1.
AF195056 mRNA. Translation: AAF68196.1.
AF284755 mRNA. Translation: AAL56666.1.
BC007486 mRNA. Translation: AAH07486.1. Frameshift.
UniGeneiMm.313672.

3D structure databases

ProteinModelPortaliQ9JLC4.
SMRiQ9JLC4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000072472.

PTM databases

iPTMnetiQ9JLC4.
PhosphoSitePlusiQ9JLC4.

Proteomic databases

PaxDbiQ9JLC4.
PRIDEiQ9JLC4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:1929666. Sorcs1.

Phylogenomic databases

eggNOGiENOG410ISX7. Eukaryota.
ENOG410Z4SB. LUCA.
HOVERGENiHBG059252.
InParanoidiQ9JLC4.
PhylomeDBiQ9JLC4.

Miscellaneous databases

PROiQ9JLC4.
SOURCEiSearch...

Gene expression databases

CleanExiMM_SORCS1.

Family and domain databases

Gene3Di2.60.40.670. 1 hit.
InterProiIPR000601. PKD_dom.
IPR031777. Sortilin_C.
IPR031778. Sortilin_N.
IPR006581. VPS10.
[Graphical view]
PfamiPF00801. PKD. 1 hit.
PF15902. Sortilin-Vps10. 1 hit.
PF15901. Sortilin_C. 1 hit.
[Graphical view]
SMARTiSM00602. VPS10. 1 hit.
[Graphical view]
SUPFAMiSSF49299. SSF49299. 2 hits.
PROSITEiPS50093. PKD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSORC1_MOUSE
AccessioniPrimary (citable) accession number: Q9JLC4
Secondary accession number(s): Q8VI45, Q922I1, Q9QY21
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.