Q9JKS4 (LDB3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM domain-binding protein 3 Alternative name(s): Protein cypher Protein oracle Z-band alternatively spliced PDZ-motif protein | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 723 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton. Ref.1 |
| Subunit structure | Interacts via its LIM domains with various PKC isoforms. Interacts via its PDZ domain with the ACTN2 C-terminal region. Interacts with MYOZ1, MYOZ2 and MYOZ3. Ref.1 UniProtKB O75112 |
| Subcellular location | Cytoplasm › perinuclear region. Cell projection › pseudopodium. Cytoplasm › cytoskeleton. Cytoplasm › myofibril › sarcomere › Z line. Note: Localized to the cytoplasm around nuclei and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. Colocalizes with ACTN2 at the Z-lines. Ref.1 |
| Tissue specificity | Expressed primarily in adult heart and skeletal muscle, and detected at lower levels in lung. Isoforms are expressed in a tissue-specific manner. Isoform 1, isoform 3 and isoform 5 are expressed in heart, whereas isoform 2, isoform 4 and isoform 6 are expressed in skeletal muscle. Ref.1 Ref.2 Ref.3 Ref.4 |
| Developmental stage | Initially expressed in a myocardium-specific manner at 8.5-9 dpc and remains cardiac-restricted until day 12. Strongly expressed throughout heart in all stages examined. At 12.5 dpc expressed at low levels in non-cardiac striated muscles. By day E14.5 expressed at high levels in both cardiac and skeletal muscle, and also strongly expressed in striated muscles of tongue, thoracic and abdominal muscles, leg and diaphragm. The various isoforms are developmentally regulated in both skeletal and cardiac muscle. Isoform 5 and isoform 6, which are barely detectable during embryogenesis are up-regulated postnatally. In heart, isoform 3 is up-regulated developmentally, whereas the predominant isoform 1 is expressed throughout development and into adulthood. In skeletal muscle, the predominant isoform 2 is gradually replaced by isoform 4 postnatally. Ref.1 Ref.4 |
| Sequence similarities | Contains 3 LIM zinc-binding domains. Contains 1 PDZ (DHR) domain. |
| Sequence caution | The sequence BAB23128.1 differs from that shown. Reason: Sequencing errors. The sequence BAD32258.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell projection Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | sarcomere organization Inferred from mutant phenotype PubMed 11696561. Source: MGI |
| Cellular_component | Z disc Inferred from direct assay PubMed 16481394PubMed 19047374. Source: MGI cytoskeletonInferred from sequence or structural similarity. Source: UniProtKB perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell pseudopodiumInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | muscle alpha-actinin binding Inferred from direct assay PubMed 11696561. Source: MGI protein kinase C bindingInferred from direct assay Ref.1. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9JKS4-1) Also known as: Cypher1c; Oracle 1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.4 (identifier: Q9JKS4-2) Also known as: Cypher1s; The sequence of this isoform differs from the canonical sequence as follows: 108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA | ||||||
| Isoform 3 Ref.2 Ref.4 (identifier: Q9JKS4-3) Also known as: Cypher3c; Oracle 2; The sequence of this isoform differs from the canonical sequence as follows: 296-357: Missing. | ||||||
| Isoform 4 Ref.4 (identifier: Q9JKS4-4) Also known as: Cypher3s; The sequence of this isoform differs from the canonical sequence as follows: 108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA 296-357: Missing. | ||||||
| Isoform 5 Ref.4 (identifier: Q9JKS4-5) Also known as: Cypher2c; The sequence of this isoform differs from the canonical sequence as follows: 296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS 328-723: Missing. | ||||||
| Isoform 6 Ref.1 Ref.2 (identifier: Q9JKS4-6) Also known as: Cypher2s; The sequence of this isoform differs from the canonical sequence as follows: 108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA 296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS 328-723: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 723 | 723 | LIM domain-binding protein 3 | PRO_0000075768 | |||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||
| Domain | 1 – 84 | 84 | PDZ | ||||||||||||||||||||||||
| Domain | 545 – 603 | 59 | LIM zinc-binding 1 | ||||||||||||||||||||||||
| Domain | 604 – 663 | 60 | LIM zinc-binding 2 | ||||||||||||||||||||||||
| Domain | 664 – 723 | 60 | LIM zinc-binding 3 | ||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||
| Alternative sequence | 108 – 227 | 120 | DPALD…GLLGG → VVANSPANADYQERFNPSVL KDSALSTHKPIEVKGLGGKA TIIHAQYNTPISMYSQDAIM DAIAGQAQAQGSDFSGASPL A in isoform 2, isoform 4 and isoform 6. Ref.1 Ref.2 Ref.4 | VSP_051903 | |||||||||||||||||||||||
| Alternative sequence | 296 – 357 | 62 | Missing in isoform 3 and isoform 4. Ref.3 Ref.4 | VSP_051904 | |||||||||||||||||||||||
| Alternative sequence | 296 – 327 | 32 | STPIE…AASPI → RERFETERNSPRFAKLRNWH HGLSAQILNVKS in isoform 5 and isoform 6. Ref.1 Ref.2 Ref.4 | VSP_051905 | |||||||||||||||||||||||
| Alternative sequence | 328 – 723 | 396 | Missing in isoform 5 and isoform 6. Ref.1 Ref.2 Ref.4 | VSP_051906 | |||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||
| Sequence conflict | 108 – 145 | 38 | DPALD…SSFSQ → VVANSPANADYQERFNPSVL KGLSSVLKGLSSVHPQAH in BAB23128. Ref.6 | ||||||||||||||||||||||||
| Sequence conflict | 450 | 1 | S → T in AAD42950. Ref.1 | ||||||||||||||||||||||||
| Sequence conflict | 450 | 1 | S → T in AAO26188. Ref.4 | ||||||||||||||||||||||||
| Sequence conflict | 450 | 1 | S → T in AAO26189. Ref.4 | ||||||||||||||||||||||||
| Sequence conflict | 512 | 1 | R → W in BAD32258. Ref.5 | ||||||||||||||||||||||||
| Isoform 2: | |||||||||||||||||||||||||||
| Sequence conflict | 176 – 188 | 13 | AQGSD…ASPLA → AQGSDFSG in AAO26189. Ref.4 | ||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||
| Beta strand | 2 – 10 | 9 | |||||||||||||||||||||||||
| Beta strand | 15 – 17 | 3 | |||||||||||||||||||||||||
| Turn | 21 – 24 | 4 | |||||||||||||||||||||||||
| Beta strand | 28 – 32 | 5 | |||||||||||||||||||||||||
| Helix | 37 – 40 | 4 | |||||||||||||||||||||||||
| Beta strand | 48 – 54 | 7 | |||||||||||||||||||||||||
| Beta strand | 56 – 60 | 5 | |||||||||||||||||||||||||
| Helix | 62 – 71 | 10 | |||||||||||||||||||||||||
| Beta strand | 74 – 81 | 8 | |||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cypher, a striated muscle-restricted PDZ and LIM domain-containing protein, binds to alpha-actinin-2 and protein kinase C." Zhou Q., Ruiz-Lozano P., Martone M.E., Chen J. J. Biol. Chem. 274:19807-19813(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), INTERACTION WITH ACTN2 AND PKC, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Strain: NIH Swiss. Tissue: Heart and Skeletal muscle. |
| [2] | "ZASP: a new Z-band alternatively spliced PDZ-motif protein." Faulkner G., Pallavicini A., Formentin E., Comelli A., Ievolella C., Trevisan S., Bortoletto G., Scannapieco P., Salamon M., Mouly V., Valle G., Lanfranchi G. J. Cell Biol. 146:465-475(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), TISSUE SPECIFICITY. Tissue: Diaphragm. |
| [3] | "Oracle, a novel PDZ-LIM domain protein expressed in heart and skeletal muscle." Passier R., Richardson J.A., Olson E.N. Mech. Dev. 92:277-284(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY. Tissue: Heart. |
| [4] | "Characterization and in vivo functional analysis of splice variants of cypher." Huang C., Zhou Q., Liang P., Hollander M.S., Sheikh F., Li X., Greaser M., Shelton G.D., Evans S., Chen J. J. Biol. Chem. 278:7360-7365(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Strain: NIH Swiss. Tissue: Heart and Skeletal muscle. |
| [5] | "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal brain. |
| [6] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-145. Strain: C57BL/6J. Tissue: Embryo, Heart and Urinary bladder. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 6). Strain: C57BL/6J. Tissue: Lung and Mammary gland. |
| [8] | "Solution structure of PDZ domain of mouse cypher protein." RIKEN structural genomics initiative (RSGI) Submitted (MAY-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1-83. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF114378 mRNA. Translation: AAD42950.2. AF114379 mRNA. Translation: AAD42951.2. AJ005621 mRNA. Translation: CAB46747.1. AF228057 mRNA. Translation: AAF33847.1. AF228058 mRNA. Translation: AAF33848.1. AY206011 mRNA. Translation: AAO26187.1. AY206012 mRNA. Translation: AAO26188.1. AY206013 mRNA. Translation: AAO26189.1. AY206015 mRNA. Translation: AAO26190.1. AK172980 mRNA. Translation: BAD32258.1. Different initiation. AK004020 mRNA. Translation: BAB23128.1. Sequence problems. AK137181 mRNA. Translation: BAE23262.1. AK142292 mRNA. Translation: BAE25016.1. BC099596 mRNA. Translation: AAH99596.1. BC138793 mRNA. Translation: AAI38794.1. BC145420 mRNA. Translation: AAI45421.1. | ||||||||||||
| IPI | IPI00123369. IPI00323030. IPI00403041. IPI00621572. IPI00625287. IPI00656173. | ||||||||||||
| RefSeq | NP_001034160.1. NM_001039071.2. NP_001034161.1. NM_001039072.2. NP_001034162.1. NM_001039073.2. NP_001034163.1. NM_001039074.2. NP_001034164.1. NM_001039075.2. NP_001034165.1. NM_001039076.2. NP_036048.3. NM_011918.4. | ||||||||||||
| UniGene | Mm.29733. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9JKS4. | ||||||||||||
| SMR | Q9JKS4. Positions 5-83, 533-691. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9JKS4. 1 interaction. | ||||||||||||
| MINT | MINT-97840. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9JKS4. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9JKS4. | ||||||||||||
| PRIDE | Q9JKS4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000022327; ENSMUSP00000022327; ENSMUSG00000021798. ENSMUST00000022328; ENSMUSP00000022328; ENSMUSG00000021798. ENSMUST00000022330; ENSMUSP00000022330; ENSMUSG00000021798. ENSMUST00000090040; ENSMUSP00000087494; ENSMUSG00000021798. | ||||||||||||
| GeneID | 24131. | ||||||||||||
| KEGG | mmu:24131. | ||||||||||||
| UCSC | uc007taz.1. mouse. uc007tba.1. mouse. uc007tbc.1. mouse. uc007tbd.1. mouse. uc007tbe.1. mouse. uc007tbf.1. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 11155. | ||||||||||||
| MGI | MGI:1344412. Ldb3. | ||||||||||||
| Rouge | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG286537. | ||||||||||||
| GeneTree | ENSGT00700000104411. | ||||||||||||
| HOVERGEN | HBG051478. | ||||||||||||
| InParanoid | B2RSB0. | ||||||||||||
| OMA | CTSQATT. | ||||||||||||
| OrthoDB | EOG4GTKDQ. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9JKS4. | ||||||||||||
| Bgee | Q9JKS4. | ||||||||||||
| CleanEx | MM_LDB3. | ||||||||||||
| Genevestigator | Q9JKS4. | ||||||||||||
| GermOnline | ENSMUSG00000021798. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.10.110.10. 3 hits. | ||||||||||||
| InterPro | IPR001478. PDZ. IPR006643. ZASP. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||
| Pfam | PF00412. LIM. 3 hits. PF00595. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00132. LIM. 3 hits. SM00228. PDZ. 1 hit. SM00735. ZM. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 1 hit. | ||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 3 hits. PS50106. PDZ. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9JKS4. | ||||||||||||
| NextBio | 304169. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | LDB3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9JKS4 Secondary accession number(s): B2RSB0 Q9WVH2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
