Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9JKS4

- LDB3_MOUSE

UniProt

Q9JKS4 - LDB3_MOUSE

Protein

LIM domain-binding protein 3

Gene

Ldb3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.1 Publication

    GO - Molecular functioni

    1. muscle alpha-actinin binding Source: MGI
    2. protein binding Source: UniProtKB
    3. protein kinase C binding Source: UniProtKB
    4. zinc ion binding Source: InterPro

    GO - Biological processi

    1. sarcomere organization Source: MGI

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    LIM domain-binding protein 3
    Alternative name(s):
    Protein cypher
    Protein oracle
    Z-band alternatively spliced PDZ-motif protein
    Gene namesi
    Name:Ldb3Imported
    Synonyms:Kiaa0613
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 14

    Organism-specific databases

    MGIiMGI:1344412. Ldb3.

    Subcellular locationi

    Cytoplasmperinuclear region 1 Publication. Cell projectionpseudopodium 1 Publication. Cytoplasmcytoskeleton 1 Publication. CytoplasmmyofibrilsarcomereZ line 1 Publication
    Note: Localized to the cytoplasm around nuclei and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. Colocalizes with ACTN2 at the Z-lines.

    GO - Cellular componenti

    1. cytoskeleton Source: UniProtKB
    2. perinuclear region of cytoplasm Source: UniProtKB-SubCell
    3. pseudopodium Source: UniProtKB-SubCell
    4. Z disc Source: MGI

    Keywords - Cellular componenti

    Cell projection, Cytoplasm, Cytoskeleton

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 723723LIM domain-binding protein 3PRO_0000075768Add
    BLAST

    Proteomic databases

    MaxQBiQ9JKS4.
    PaxDbiQ9JKS4.
    PRIDEiQ9JKS4.

    PTM databases

    PhosphoSiteiQ9JKS4.

    Expressioni

    Tissue specificityi

    Expressed primarily in adult heart and skeletal muscle, and detected at lower levels in lung. Isoforms are expressed in a tissue-specific manner. Isoform 1, isoform 3 and isoform 5 are expressed in heart, whereas isoform 2, isoform 4 and isoform 6 are expressed in skeletal muscle.4 Publications

    Developmental stagei

    Initially expressed in a myocardium-specific manner at 8.5-9 dpc and remains cardiac-restricted until day 12. Strongly expressed throughout heart in all stages examined. At 12.5 dpc expressed at low levels in non-cardiac striated muscles. By day E14.5 expressed at high levels in both cardiac and skeletal muscle, and also strongly expressed in striated muscles of tongue, thoracic and abdominal muscles, leg and diaphragm. The various isoforms are developmentally regulated in both skeletal and cardiac muscle. Isoform 5 and isoform 6, which are barely detectable during embryogenesis are up-regulated postnatally. In heart, isoform 3 is up-regulated developmentally, whereas the predominant isoform 1 is expressed throughout development and into adulthood. In skeletal muscle, the predominant isoform 2 is gradually replaced by isoform 4 postnatally.2 Publications

    Gene expression databases

    ArrayExpressiQ9JKS4.
    BgeeiQ9JKS4.
    CleanExiMM_LDB3.
    GenevestigatoriQ9JKS4.

    Interactioni

    Subunit structurei

    Interacts via its LIM domains with various PKC isoforms. Interacts via its PDZ domain with the ACTN2 C-terminal region. Interacts with MYOZ1, MYOZ2 and MYOZ3.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi204912. 9 interactions.
    IntActiQ9JKS4. 2 interactions.
    MINTiMINT-97840.

    Structurei

    Secondary structure

    1
    723
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi2 – 109
    Beta strandi15 – 173
    Turni21 – 244
    Beta strandi28 – 325
    Helixi37 – 404
    Beta strandi48 – 547
    Beta strandi56 – 605
    Helixi62 – 7110
    Beta strandi74 – 818

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1WJLNMR-A1-83[»]
    ProteinModelPortaliQ9JKS4.
    SMRiQ9JKS4. Positions 5-83, 533-719.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9JKS4.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 8484PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini545 – 60359LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini604 – 66360LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini664 – 72360LIM zinc-binding 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 3 LIM zinc-binding domains.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiNOG286537.
    GeneTreeiENSGT00740000114891.
    HOVERGENiHBG051478.
    InParanoidiB2RSB0.
    OMAiLWAMSSK.
    OrthoDBiEOG7HXCQB.
    PhylomeDBiQ9JKS4.
    TreeFamiTF106408.

    Family and domain databases

    Gene3Di2.10.110.10. 3 hits.
    2.30.42.10. 1 hit.
    InterProiIPR001478. PDZ.
    IPR006643. ZASP.
    IPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00412. LIM. 3 hits.
    PF00595. PDZ. 1 hit.
    [Graphical view]
    SMARTiSM00132. LIM. 3 hits.
    SM00228. PDZ. 1 hit.
    SM00735. ZM. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 1 hit.
    PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 3 hits.
    PS50106. PDZ. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q9JKS4-1) [UniParc]FASTAAdd to Basket

    Also known as: Cypher1c1 Publication

    , Oracle 11 Publication

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSYSVTLTGP GPWGFRLQGG KDFNMPLTIS RITPGSKAAQ SQLSQGDLVV    50
    AIDGVNTDTM THLEAQNKIK SASYNLSLTL QKSKRPIPIS TTAPPIQSPL 100
    PVIPHQKDPA LDTNGSLATP SPSPEARASP GALEFGDTFS SSFSQTSVCS 150
    PLMEASGPVL PLGSPVAKAS SEGAQGSVSP KVLPGPSQPR QYNNPIGLYS 200
    AETLREMAQM YQMSLRGKAS GAGLLGGSLP VKDLAVDSAS PVYQAVIKTQ 250
    SKPEDEADEW ARRSSNLQSR SFRILAQMTG TEYMQDPDEE ALRRSSTPIE 300
    HAPVCTSQAT SPLLPASAQS PAAASPIAAS PTLATAAATH AAAASAAGPA 350
    ASPVENPRPQ ASAYSPAAAA SPAPSAHTSY SEGPAAPAPK PRVVTTASIR 400
    PSVYQPVPAS SYSPSPGANY SPTPYTPSPA PAYTPSPAPT YTPSPAPTYS 450
    PSPAPAYTPS PAPNYTPTPS AAYSGGPSES ASRPPWVTDD SFSQKFAPGK 500
    STTTVSKQTL PRGAPAYNPT GPQVTPLARG TFQRAERFPA SSRTPLCGHC 550
    NNVIRGPFLV AMGRSWHPEE FNCAYCKTSL ADVCFVEEQN NVYCERCYEQ 600
    FFAPICAKCN TKIMGEVMHA LRQTWHTTCF VCAACKKPFG NSLFHMEDGE 650
    PYCEKDYINL FSTKCHGCDF PVEAGDKFIE ALGHTWHDTC FICAVCHVNL 700
    EGQPFYSKKD KPLCKKHAHA INV 723
    Length:723
    Mass (Da):76,432
    Last modified:October 1, 2000 - v1
    Checksum:iCC67D38AC2FFA6B6
    GO
    Isoform 21 Publication (identifier: Q9JKS4-2) [UniParc]FASTAAdd to Basket

    Also known as: Cypher1s1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA

    Show »
    Length:684
    Mass (Da):72,752
    Checksum:iB8969D96ECC7C7C5
    GO
    Isoform 32 Publications (identifier: Q9JKS4-3) [UniParc]FASTAAdd to Basket

    Also known as: Cypher3c1 Publication

    , Oracle 21 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         296-357: Missing.

    Show »
    Length:661
    Mass (Da):70,751
    Checksum:i5DEFEEE78D45532F
    GO
    Isoform 41 Publication (identifier: Q9JKS4-4) [UniParc]FASTAAdd to Basket

    Also known as: Cypher3s1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA
         296-357: Missing.

    Show »
    Length:622
    Mass (Da):67,071
    Checksum:iABC92BB80C3B9903
    GO
    Isoform 51 Publication (identifier: Q9JKS4-5) [UniParc]FASTAAdd to Basket

    Also known as: Cypher2c1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS
         328-723: Missing.

    Show »
    Length:327
    Mass (Da):35,108
    Checksum:i603BEF5D6152B848
    GO
    Isoform 62 Publications (identifier: Q9JKS4-6) [UniParc]FASTAAdd to Basket

    Also known as: Cypher2s1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA
         296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS
         328-723: Missing.

    Show »
    Length:288
    Mass (Da):31,427
    Checksum:i65B11275409291B6
    GO

    Sequence cautioni

    The sequence BAB23128.1 differs from that shown. Reason: Sequencing errors.
    The sequence BAD32258.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti108 – 14538DPALD…SSFSQ → VVANSPANADYQERFNPSVL KGLSSVLKGLSSVHPQAH in BAB23128. (PubMed:16141072)CuratedAdd
    BLAST
    Sequence conflicti450 – 4501S → T in AAD42950. (PubMed:10391924)Curated
    Sequence conflicti450 – 4501S → T in AAO26188. (PubMed:12499364)Curated
    Sequence conflicti450 – 4501S → T in AAO26189. (PubMed:12499364)Curated
    Sequence conflicti512 – 5121R → W in BAD32258. (PubMed:15368895)Curated
    Isoform 21 Publication (identifier: Q9JKS4-2)
    Sequence conflicti176 – 18813AQGSD…ASPLA → AQGSDFSG in AAO26189. (PubMed:12499364)CuratedAdd
    BLAST

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei108 – 227120DPALD…GLLGG → VVANSPANADYQERFNPSVL KDSALSTHKPIEVKGLGGKA TIIHAQYNTPISMYSQDAIM DAIAGQAQAQGSDFSGASPL A in isoform 2, isoform 4 and isoform 6. 5 PublicationsVSP_051903Add
    BLAST
    Alternative sequencei296 – 35762Missing in isoform 3 and isoform 4. 3 PublicationsVSP_051904Add
    BLAST
    Alternative sequencei296 – 32732STPIE…AASPI → RERFETERNSPRFAKLRNWH HGLSAQILNVKS in isoform 5 and isoform 6. 5 PublicationsVSP_051905Add
    BLAST
    Alternative sequencei328 – 723396Missing in isoform 5 and isoform 6. 5 PublicationsVSP_051906Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF114378 mRNA. Translation: AAD42950.2.
    AF114379 mRNA. Translation: AAD42951.2.
    AJ005621 mRNA. Translation: CAB46747.1.
    AF228057 mRNA. Translation: AAF33847.1.
    AF228058 mRNA. Translation: AAF33848.1.
    AY206011 mRNA. Translation: AAO26187.1.
    AY206012 mRNA. Translation: AAO26188.1.
    AY206013 mRNA. Translation: AAO26189.1.
    AY206015 mRNA. Translation: AAO26190.1.
    AK172980 mRNA. Translation: BAD32258.1. Different initiation.
    AK004020 mRNA. Translation: BAB23128.1. Sequence problems.
    AK137181 mRNA. Translation: BAE23262.1.
    AK142292 mRNA. Translation: BAE25016.1.
    BC099596 mRNA. Translation: AAH99596.1.
    BC138793 mRNA. Translation: AAI38794.1.
    BC145420 mRNA. Translation: AAI45421.1.
    CCDSiCCDS26940.1. [Q9JKS4-3]
    CCDS26941.1. [Q9JKS4-1]
    CCDS26942.1. [Q9JKS4-5]
    CCDS36879.1. [Q9JKS4-2]
    RefSeqiNP_001034160.1. NM_001039071.2. [Q9JKS4-3]
    NP_001034161.1. NM_001039072.2.
    NP_001034162.1. NM_001039073.2. [Q9JKS4-4]
    NP_001034163.1. NM_001039074.2. [Q9JKS4-2]
    NP_001034164.1. NM_001039075.2. [Q9JKS4-6]
    NP_001034165.1. NM_001039076.2. [Q9JKS4-5]
    NP_036048.3. NM_011918.4. [Q9JKS4-1]
    XP_006519080.1. XM_006519017.1. [Q9JKS4-2]
    UniGeneiMm.29733.

    Genome annotation databases

    EnsembliENSMUST00000022327; ENSMUSP00000022327; ENSMUSG00000021798. [Q9JKS4-1]
    ENSMUST00000022328; ENSMUSP00000022328; ENSMUSG00000021798. [Q9JKS4-3]
    ENSMUST00000022330; ENSMUSP00000022330; ENSMUSG00000021798. [Q9JKS4-5]
    ENSMUST00000090040; ENSMUSP00000087494; ENSMUSG00000021798. [Q9JKS4-2]
    GeneIDi24131.
    KEGGimmu:24131.
    UCSCiuc007taz.1. mouse. [Q9JKS4-2]
    uc007tba.1. mouse. [Q9JKS4-4]
    uc007tbc.1. mouse. [Q9JKS4-1]
    uc007tbd.1. mouse. [Q9JKS4-3]
    uc007tbe.1. mouse. [Q9JKS4-6]
    uc007tbf.1. mouse. [Q9JKS4-5]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF114378 mRNA. Translation: AAD42950.2 .
    AF114379 mRNA. Translation: AAD42951.2 .
    AJ005621 mRNA. Translation: CAB46747.1 .
    AF228057 mRNA. Translation: AAF33847.1 .
    AF228058 mRNA. Translation: AAF33848.1 .
    AY206011 mRNA. Translation: AAO26187.1 .
    AY206012 mRNA. Translation: AAO26188.1 .
    AY206013 mRNA. Translation: AAO26189.1 .
    AY206015 mRNA. Translation: AAO26190.1 .
    AK172980 mRNA. Translation: BAD32258.1 . Different initiation.
    AK004020 mRNA. Translation: BAB23128.1 . Sequence problems.
    AK137181 mRNA. Translation: BAE23262.1 .
    AK142292 mRNA. Translation: BAE25016.1 .
    BC099596 mRNA. Translation: AAH99596.1 .
    BC138793 mRNA. Translation: AAI38794.1 .
    BC145420 mRNA. Translation: AAI45421.1 .
    CCDSi CCDS26940.1. [Q9JKS4-3 ]
    CCDS26941.1. [Q9JKS4-1 ]
    CCDS26942.1. [Q9JKS4-5 ]
    CCDS36879.1. [Q9JKS4-2 ]
    RefSeqi NP_001034160.1. NM_001039071.2. [Q9JKS4-3 ]
    NP_001034161.1. NM_001039072.2.
    NP_001034162.1. NM_001039073.2. [Q9JKS4-4 ]
    NP_001034163.1. NM_001039074.2. [Q9JKS4-2 ]
    NP_001034164.1. NM_001039075.2. [Q9JKS4-6 ]
    NP_001034165.1. NM_001039076.2. [Q9JKS4-5 ]
    NP_036048.3. NM_011918.4. [Q9JKS4-1 ]
    XP_006519080.1. XM_006519017.1. [Q9JKS4-2 ]
    UniGenei Mm.29733.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1WJL NMR - A 1-83 [» ]
    ProteinModelPortali Q9JKS4.
    SMRi Q9JKS4. Positions 5-83, 533-719.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204912. 9 interactions.
    IntActi Q9JKS4. 2 interactions.
    MINTi MINT-97840.

    PTM databases

    PhosphoSitei Q9JKS4.

    Proteomic databases

    MaxQBi Q9JKS4.
    PaxDbi Q9JKS4.
    PRIDEi Q9JKS4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000022327 ; ENSMUSP00000022327 ; ENSMUSG00000021798 . [Q9JKS4-1 ]
    ENSMUST00000022328 ; ENSMUSP00000022328 ; ENSMUSG00000021798 . [Q9JKS4-3 ]
    ENSMUST00000022330 ; ENSMUSP00000022330 ; ENSMUSG00000021798 . [Q9JKS4-5 ]
    ENSMUST00000090040 ; ENSMUSP00000087494 ; ENSMUSG00000021798 . [Q9JKS4-2 ]
    GeneIDi 24131.
    KEGGi mmu:24131.
    UCSCi uc007taz.1. mouse. [Q9JKS4-2 ]
    uc007tba.1. mouse. [Q9JKS4-4 ]
    uc007tbc.1. mouse. [Q9JKS4-1 ]
    uc007tbd.1. mouse. [Q9JKS4-3 ]
    uc007tbe.1. mouse. [Q9JKS4-6 ]
    uc007tbf.1. mouse. [Q9JKS4-5 ]

    Organism-specific databases

    CTDi 11155.
    MGIi MGI:1344412. Ldb3.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG286537.
    GeneTreei ENSGT00740000114891.
    HOVERGENi HBG051478.
    InParanoidi B2RSB0.
    OMAi LWAMSSK.
    OrthoDBi EOG7HXCQB.
    PhylomeDBi Q9JKS4.
    TreeFami TF106408.

    Miscellaneous databases

    EvolutionaryTracei Q9JKS4.
    NextBioi 304169.
    PROi Q9JKS4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9JKS4.
    Bgeei Q9JKS4.
    CleanExi MM_LDB3.
    Genevestigatori Q9JKS4.

    Family and domain databases

    Gene3Di 2.10.110.10. 3 hits.
    2.30.42.10. 1 hit.
    InterProi IPR001478. PDZ.
    IPR006643. ZASP.
    IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00412. LIM. 3 hits.
    PF00595. PDZ. 1 hit.
    [Graphical view ]
    SMARTi SM00132. LIM. 3 hits.
    SM00228. PDZ. 1 hit.
    SM00735. ZM. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 1 hit.
    PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 3 hits.
    PS50106. PDZ. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cypher, a striated muscle-restricted PDZ and LIM domain-containing protein, binds to alpha-actinin-2 and protein kinase C."
      Zhou Q., Ruiz-Lozano P., Martone M.E., Chen J.
      J. Biol. Chem. 274:19807-19813(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), INTERACTION WITH ACTN2 AND PKC, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: NIH SwissImported.
      Tissue: HeartImported and Skeletal muscleImported.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), TISSUE SPECIFICITY.
      Tissue: DiaphragmImported.
    3. "Oracle, a novel PDZ-LIM domain protein expressed in heart and skeletal muscle."
      Passier R., Richardson J.A., Olson E.N.
      Mech. Dev. 92:277-284(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY.
      Tissue: HeartImported.
    4. "Characterization and in vivo functional analysis of splice variants of cypher."
      Huang C., Zhou Q., Liang P., Hollander M.S., Sheikh F., Li X., Greaser M., Shelton G.D., Evans S., Chen J.
      J. Biol. Chem. 278:7360-7365(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: NIH SwissImported.
      Tissue: HeartImported and Skeletal muscleImported.
    5. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
      DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Fetal brainImported.
    6. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-145.
      Strain: C57BL/6JImported.
      Tissue: Embryo, HeartImported and Urinary bladderImported.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 6).
      Strain: C57BL/6JImported.
      Tissue: Lung and Mammary glandImported.
    8. "Solution structure of PDZ domain of mouse cypher protein."
      RIKEN structural genomics initiative (RSGI)
      Submitted (MAY-2004) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 1-83.

    Entry informationi

    Entry nameiLDB3_MOUSE
    AccessioniPrimary (citable) accession number: Q9JKS4
    Secondary accession number(s): B2RSB0
    , B7ZNT6, Q6A038, Q811P2, Q811P3, Q811P4, Q811P5, Q9D130, Q9JKS3, Q9R0Z1, Q9WVH1, Q9WVH2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 6, 2005
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 114 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3