Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9JKS4

- LDB3_MOUSE

UniProt

Q9JKS4 - LDB3_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

LIM domain-binding protein 3

Gene

Ldb3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.1 Publication

GO - Molecular functioni

  1. muscle alpha-actinin binding Source: MGI
  2. protein kinase C binding Source: UniProtKB
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. sarcomere organization Source: MGI
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain-binding protein 3
Alternative name(s):
Protein cypher
Protein oracle
Z-band alternatively spliced PDZ-motif protein
Gene namesi
Name:Ldb3Imported
Synonyms:Kiaa0613
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 14

Organism-specific databases

MGIiMGI:1344412. Ldb3.

Subcellular locationi

Cytoplasmperinuclear region 1 Publication. Cell projectionpseudopodium 1 Publication. Cytoplasmcytoskeleton 1 Publication. CytoplasmmyofibrilsarcomereZ line 1 Publication
Note: Localized to the cytoplasm around nuclei and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. Colocalizes with ACTN2 at the Z-lines.

GO - Cellular componenti

  1. cell projection Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB
  3. Z disc Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 723723LIM domain-binding protein 3PRO_0000075768Add
BLAST

Proteomic databases

MaxQBiQ9JKS4.
PaxDbiQ9JKS4.
PRIDEiQ9JKS4.

PTM databases

PhosphoSiteiQ9JKS4.

Expressioni

Tissue specificityi

Expressed primarily in adult heart and skeletal muscle, and detected at lower levels in lung. Isoforms are expressed in a tissue-specific manner. Isoform 1, isoform 3 and isoform 5 are expressed in heart, whereas isoform 2, isoform 4 and isoform 6 are expressed in skeletal muscle.4 Publications

Developmental stagei

Initially expressed in a myocardium-specific manner at 8.5-9 dpc and remains cardiac-restricted until day 12. Strongly expressed throughout heart in all stages examined. At 12.5 dpc expressed at low levels in non-cardiac striated muscles. By day E14.5 expressed at high levels in both cardiac and skeletal muscle, and also strongly expressed in striated muscles of tongue, thoracic and abdominal muscles, leg and diaphragm. The various isoforms are developmentally regulated in both skeletal and cardiac muscle. Isoform 5 and isoform 6, which are barely detectable during embryogenesis are up-regulated postnatally. In heart, isoform 3 is up-regulated developmentally, whereas the predominant isoform 1 is expressed throughout development and into adulthood. In skeletal muscle, the predominant isoform 2 is gradually replaced by isoform 4 postnatally.2 Publications

Gene expression databases

BgeeiQ9JKS4.
CleanExiMM_LDB3.
ExpressionAtlasiQ9JKS4. baseline and differential.
GenevestigatoriQ9JKS4.

Interactioni

Subunit structurei

Interacts via its LIM domains with various PKC isoforms. Interacts via its PDZ domain with the ACTN2 C-terminal region. Interacts with MYOZ1, MYOZ2 and MYOZ3.By similarity1 Publication

Protein-protein interaction databases

BioGridi204912. 9 interactions.
IntActiQ9JKS4. 2 interactions.
MINTiMINT-97840.

Structurei

Secondary structure

1
723
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi2 – 109Combined sources
Beta strandi15 – 173Combined sources
Turni21 – 244Combined sources
Beta strandi28 – 325Combined sources
Helixi37 – 404Combined sources
Beta strandi48 – 547Combined sources
Beta strandi56 – 605Combined sources
Helixi62 – 7110Combined sources
Beta strandi74 – 818Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WJLNMR-A1-83[»]
ProteinModelPortaliQ9JKS4.
SMRiQ9JKS4. Positions 5-83, 533-691.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9JKS4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 8484PDZPROSITE-ProRule annotationAdd
BLAST
Domaini545 – 60359LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini604 – 66360LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST
Domaini664 – 72360LIM zinc-binding 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiNOG286537.
GeneTreeiENSGT00760000118910.
HOVERGENiHBG051478.
InParanoidiQ9JKS4.
OMAiLWAMSSK.
OrthoDBiEOG7HXCQB.
PhylomeDBiQ9JKS4.
TreeFamiTF106408.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
IPR006643. ZASP.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
SM00735. ZM. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q9JKS4-1) [UniParc]FASTAAdd to Basket

Also known as: Cypher1c1 Publication

, Oracle 11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSYSVTLTGP GPWGFRLQGG KDFNMPLTIS RITPGSKAAQ SQLSQGDLVV
60 70 80 90 100
AIDGVNTDTM THLEAQNKIK SASYNLSLTL QKSKRPIPIS TTAPPIQSPL
110 120 130 140 150
PVIPHQKDPA LDTNGSLATP SPSPEARASP GALEFGDTFS SSFSQTSVCS
160 170 180 190 200
PLMEASGPVL PLGSPVAKAS SEGAQGSVSP KVLPGPSQPR QYNNPIGLYS
210 220 230 240 250
AETLREMAQM YQMSLRGKAS GAGLLGGSLP VKDLAVDSAS PVYQAVIKTQ
260 270 280 290 300
SKPEDEADEW ARRSSNLQSR SFRILAQMTG TEYMQDPDEE ALRRSSTPIE
310 320 330 340 350
HAPVCTSQAT SPLLPASAQS PAAASPIAAS PTLATAAATH AAAASAAGPA
360 370 380 390 400
ASPVENPRPQ ASAYSPAAAA SPAPSAHTSY SEGPAAPAPK PRVVTTASIR
410 420 430 440 450
PSVYQPVPAS SYSPSPGANY SPTPYTPSPA PAYTPSPAPT YTPSPAPTYS
460 470 480 490 500
PSPAPAYTPS PAPNYTPTPS AAYSGGPSES ASRPPWVTDD SFSQKFAPGK
510 520 530 540 550
STTTVSKQTL PRGAPAYNPT GPQVTPLARG TFQRAERFPA SSRTPLCGHC
560 570 580 590 600
NNVIRGPFLV AMGRSWHPEE FNCAYCKTSL ADVCFVEEQN NVYCERCYEQ
610 620 630 640 650
FFAPICAKCN TKIMGEVMHA LRQTWHTTCF VCAACKKPFG NSLFHMEDGE
660 670 680 690 700
PYCEKDYINL FSTKCHGCDF PVEAGDKFIE ALGHTWHDTC FICAVCHVNL
710 720
EGQPFYSKKD KPLCKKHAHA INV
Length:723
Mass (Da):76,432
Last modified:October 1, 2000 - v1
Checksum:iCC67D38AC2FFA6B6
GO
Isoform 21 Publication (identifier: Q9JKS4-2) [UniParc]FASTAAdd to Basket

Also known as: Cypher1s1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA

Show »
Length:684
Mass (Da):72,752
Checksum:iB8969D96ECC7C7C5
GO
Isoform 32 Publications (identifier: Q9JKS4-3) [UniParc]FASTAAdd to Basket

Also known as: Cypher3c1 Publication

, Oracle 21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     296-357: Missing.

Show »
Length:661
Mass (Da):70,751
Checksum:i5DEFEEE78D45532F
GO
Isoform 41 Publication (identifier: Q9JKS4-4) [UniParc]FASTAAdd to Basket

Also known as: Cypher3s1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA
     296-357: Missing.

Show »
Length:622
Mass (Da):67,071
Checksum:iABC92BB80C3B9903
GO
Isoform 51 Publication (identifier: Q9JKS4-5) [UniParc]FASTAAdd to Basket

Also known as: Cypher2c1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS
     328-723: Missing.

Show »
Length:327
Mass (Da):35,108
Checksum:i603BEF5D6152B848
GO
Isoform 62 Publications (identifier: Q9JKS4-6) [UniParc]FASTAAdd to Basket

Also known as: Cypher2s1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA
     296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS
     328-723: Missing.

Show »
Length:288
Mass (Da):31,427
Checksum:i65B11275409291B6
GO

Sequence cautioni

The sequence BAB23128.1 differs from that shown. Reason: Sequencing errors.Curated
The sequence BAD32258.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti108 – 14538DPALD…SSFSQ → VVANSPANADYQERFNPSVL KGLSSVLKGLSSVHPQAH in BAB23128. (PubMed:16141072)CuratedAdd
BLAST
Sequence conflicti450 – 4501S → T in AAD42950. (PubMed:10391924)Curated
Sequence conflicti450 – 4501S → T in AAO26188. (PubMed:12499364)Curated
Sequence conflicti450 – 4501S → T in AAO26189. (PubMed:12499364)Curated
Sequence conflicti512 – 5121R → W in BAD32258. (PubMed:15368895)Curated
Isoform 21 Publication (identifier: Q9JKS4-2)
Sequence conflicti176 – 18813AQGSD…ASPLA → AQGSDFSG in AAO26189. (PubMed:12499364)CuratedAdd
BLAST

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei108 – 227120DPALD…GLLGG → VVANSPANADYQERFNPSVL KDSALSTHKPIEVKGLGGKA TIIHAQYNTPISMYSQDAIM DAIAGQAQAQGSDFSGASPL A in isoform 2, isoform 4 and isoform 6. 5 PublicationsVSP_051903Add
BLAST
Alternative sequencei296 – 35762Missing in isoform 3 and isoform 4. 3 PublicationsVSP_051904Add
BLAST
Alternative sequencei296 – 32732STPIE…AASPI → RERFETERNSPRFAKLRNWH HGLSAQILNVKS in isoform 5 and isoform 6. 5 PublicationsVSP_051905Add
BLAST
Alternative sequencei328 – 723396Missing in isoform 5 and isoform 6. 5 PublicationsVSP_051906Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114378 mRNA. Translation: AAD42950.2.
AF114379 mRNA. Translation: AAD42951.2.
AJ005621 mRNA. Translation: CAB46747.1.
AF228057 mRNA. Translation: AAF33847.1.
AF228058 mRNA. Translation: AAF33848.1.
AY206011 mRNA. Translation: AAO26187.1.
AY206012 mRNA. Translation: AAO26188.1.
AY206013 mRNA. Translation: AAO26189.1.
AY206015 mRNA. Translation: AAO26190.1.
AK172980 mRNA. Translation: BAD32258.1. Different initiation.
AK004020 mRNA. Translation: BAB23128.1. Sequence problems.
AK137181 mRNA. Translation: BAE23262.1.
AK142292 mRNA. Translation: BAE25016.1.
BC099596 mRNA. Translation: AAH99596.1.
BC138793 mRNA. Translation: AAI38794.1.
BC145420 mRNA. Translation: AAI45421.1.
CCDSiCCDS26940.1. [Q9JKS4-3]
CCDS26941.1. [Q9JKS4-1]
CCDS26942.1. [Q9JKS4-5]
CCDS36879.1. [Q9JKS4-2]
RefSeqiNP_001034160.1. NM_001039071.2. [Q9JKS4-3]
NP_001034161.1. NM_001039072.2.
NP_001034162.1. NM_001039073.2. [Q9JKS4-4]
NP_001034163.1. NM_001039074.2. [Q9JKS4-2]
NP_001034164.1. NM_001039075.2. [Q9JKS4-6]
NP_001034165.1. NM_001039076.2. [Q9JKS4-5]
NP_036048.3. NM_011918.4. [Q9JKS4-1]
XP_006519080.1. XM_006519017.1. [Q9JKS4-2]
UniGeneiMm.29733.

Genome annotation databases

EnsembliENSMUST00000022327; ENSMUSP00000022327; ENSMUSG00000021798. [Q9JKS4-1]
ENSMUST00000022328; ENSMUSP00000022328; ENSMUSG00000021798. [Q9JKS4-3]
ENSMUST00000022330; ENSMUSP00000022330; ENSMUSG00000021798. [Q9JKS4-5]
ENSMUST00000090040; ENSMUSP00000087494; ENSMUSG00000021798. [Q9JKS4-2]
GeneIDi24131.
KEGGimmu:24131.
UCSCiuc007taz.1. mouse. [Q9JKS4-2]
uc007tba.1. mouse. [Q9JKS4-4]
uc007tbc.1. mouse. [Q9JKS4-1]
uc007tbd.1. mouse. [Q9JKS4-3]
uc007tbe.1. mouse. [Q9JKS4-6]
uc007tbf.1. mouse. [Q9JKS4-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114378 mRNA. Translation: AAD42950.2 .
AF114379 mRNA. Translation: AAD42951.2 .
AJ005621 mRNA. Translation: CAB46747.1 .
AF228057 mRNA. Translation: AAF33847.1 .
AF228058 mRNA. Translation: AAF33848.1 .
AY206011 mRNA. Translation: AAO26187.1 .
AY206012 mRNA. Translation: AAO26188.1 .
AY206013 mRNA. Translation: AAO26189.1 .
AY206015 mRNA. Translation: AAO26190.1 .
AK172980 mRNA. Translation: BAD32258.1 . Different initiation.
AK004020 mRNA. Translation: BAB23128.1 . Sequence problems.
AK137181 mRNA. Translation: BAE23262.1 .
AK142292 mRNA. Translation: BAE25016.1 .
BC099596 mRNA. Translation: AAH99596.1 .
BC138793 mRNA. Translation: AAI38794.1 .
BC145420 mRNA. Translation: AAI45421.1 .
CCDSi CCDS26940.1. [Q9JKS4-3 ]
CCDS26941.1. [Q9JKS4-1 ]
CCDS26942.1. [Q9JKS4-5 ]
CCDS36879.1. [Q9JKS4-2 ]
RefSeqi NP_001034160.1. NM_001039071.2. [Q9JKS4-3 ]
NP_001034161.1. NM_001039072.2.
NP_001034162.1. NM_001039073.2. [Q9JKS4-4 ]
NP_001034163.1. NM_001039074.2. [Q9JKS4-2 ]
NP_001034164.1. NM_001039075.2. [Q9JKS4-6 ]
NP_001034165.1. NM_001039076.2. [Q9JKS4-5 ]
NP_036048.3. NM_011918.4. [Q9JKS4-1 ]
XP_006519080.1. XM_006519017.1. [Q9JKS4-2 ]
UniGenei Mm.29733.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1WJL NMR - A 1-83 [» ]
ProteinModelPortali Q9JKS4.
SMRi Q9JKS4. Positions 5-83, 533-691.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204912. 9 interactions.
IntActi Q9JKS4. 2 interactions.
MINTi MINT-97840.

PTM databases

PhosphoSitei Q9JKS4.

Proteomic databases

MaxQBi Q9JKS4.
PaxDbi Q9JKS4.
PRIDEi Q9JKS4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000022327 ; ENSMUSP00000022327 ; ENSMUSG00000021798 . [Q9JKS4-1 ]
ENSMUST00000022328 ; ENSMUSP00000022328 ; ENSMUSG00000021798 . [Q9JKS4-3 ]
ENSMUST00000022330 ; ENSMUSP00000022330 ; ENSMUSG00000021798 . [Q9JKS4-5 ]
ENSMUST00000090040 ; ENSMUSP00000087494 ; ENSMUSG00000021798 . [Q9JKS4-2 ]
GeneIDi 24131.
KEGGi mmu:24131.
UCSCi uc007taz.1. mouse. [Q9JKS4-2 ]
uc007tba.1. mouse. [Q9JKS4-4 ]
uc007tbc.1. mouse. [Q9JKS4-1 ]
uc007tbd.1. mouse. [Q9JKS4-3 ]
uc007tbe.1. mouse. [Q9JKS4-6 ]
uc007tbf.1. mouse. [Q9JKS4-5 ]

Organism-specific databases

CTDi 11155.
MGIi MGI:1344412. Ldb3.
Rougei Search...

Phylogenomic databases

eggNOGi NOG286537.
GeneTreei ENSGT00760000118910.
HOVERGENi HBG051478.
InParanoidi Q9JKS4.
OMAi LWAMSSK.
OrthoDBi EOG7HXCQB.
PhylomeDBi Q9JKS4.
TreeFami TF106408.

Miscellaneous databases

EvolutionaryTracei Q9JKS4.
NextBioi 304169.
PROi Q9JKS4.
SOURCEi Search...

Gene expression databases

Bgeei Q9JKS4.
CleanExi MM_LDB3.
ExpressionAtlasi Q9JKS4. baseline and differential.
Genevestigatori Q9JKS4.

Family and domain databases

Gene3Di 2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProi IPR001478. PDZ.
IPR006643. ZASP.
IPR001781. Znf_LIM.
[Graphical view ]
Pfami PF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view ]
SMARTi SM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
SM00735. ZM. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 1 hit.
PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cypher, a striated muscle-restricted PDZ and LIM domain-containing protein, binds to alpha-actinin-2 and protein kinase C."
    Zhou Q., Ruiz-Lozano P., Martone M.E., Chen J.
    J. Biol. Chem. 274:19807-19813(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6), INTERACTION WITH ACTN2 AND PKC, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: NIH SwissImported.
    Tissue: HeartImported and Skeletal muscleImported.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), TISSUE SPECIFICITY.
    Tissue: DiaphragmImported.
  3. "Oracle, a novel PDZ-LIM domain protein expressed in heart and skeletal muscle."
    Passier R., Richardson J.A., Olson E.N.
    Mech. Dev. 92:277-284(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY.
    Tissue: HeartImported.
  4. "Characterization and in vivo functional analysis of splice variants of cypher."
    Huang C., Zhou Q., Liang P., Hollander M.S., Sheikh F., Li X., Greaser M., Shelton G.D., Evans S., Chen J.
    J. Biol. Chem. 278:7360-7365(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: NIH SwissImported.
    Tissue: HeartImported and Skeletal muscleImported.
  5. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
    DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Fetal brainImported.
  6. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-145.
    Strain: C57BL/6JImported.
    Tissue: Embryo, HeartImported and Urinary bladderImported.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 6).
    Strain: C57BL/6JImported.
    Tissue: Lung and Mammary glandImported.
  8. "Solution structure of PDZ domain of mouse cypher protein."
    RIKEN structural genomics initiative (RSGI)
    Submitted (MAY-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 1-83.

Entry informationi

Entry nameiLDB3_MOUSE
AccessioniPrimary (citable) accession number: Q9JKS4
Secondary accession number(s): B2RSB0
, B7ZNT6, Q6A038, Q811P2, Q811P3, Q811P4, Q811P5, Q9D130, Q9JKS3, Q9R0Z1, Q9WVH1, Q9WVH2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: October 1, 2000
Last modified: November 26, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3