SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9JJP2

- P73_MOUSE

UniProt

Q9JJP2 - P73_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Tumor protein p73
Gene
Tp73, P73, Trp73
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein.By similarity2 Publications

Cofactori

Binds 1 zinc ion per subunit By similarity.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi186 – 1861Zinc By similarityBy similarity
Metal bindingi189 – 1891Zinc By similarityBy similarity
Metal bindingi250 – 2501Zinc By similarityBy similarity
Metal bindingi254 – 2541Zinc By similarityBy similarity

GO - Molecular functioni

  1. DNA binding Source: MGI
  2. chromatin binding Source: RefGenome
  3. damaged DNA binding Source: RefGenome
  4. double-stranded DNA binding Source: RefGenome
  5. metal ion binding Source: UniProtKB-KW
  6. p53 binding Source: MGI
  7. protein binding Source: IntAct
  8. sequence-specific DNA binding Source: RefGenome
  9. sequence-specific DNA binding transcription factor activity Source: MGI
  10. transcription regulatory region DNA binding Source: InterPro

GO - Biological processi

  1. DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator Source: RefGenome
  2. cell cycle arrest Source: MGI
  3. cellular response to DNA damage stimulus Source: MGI
  4. cellular response to UV Source: RefGenome
  5. cerebrospinal fluid secretion Source: MGI
  6. digestive tract morphogenesis Source: MGI
  7. forebrain development Source: MGI
  8. hippocampus development Source: MGI
  9. inflammatory response Source: MGI
  10. intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator Source: UniProtKB
  11. mitotic G1 DNA damage checkpoint Source: RefGenome
  12. negative regulation of JUN kinase activity Source: MGI
  13. negative regulation of neuron apoptotic process Source: MGI
  14. negative regulation of transcription from RNA polymerase II promoter Source: RefGenome
  15. neuron development Source: MGI
  16. positive regulation of apoptotic signaling pathway Source: MGI
  17. positive regulation of cell size Source: MGI
  18. positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator Source: MGI
  19. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  20. positive regulation of transcription, DNA-templated Source: MGI
  21. post-embryonic development Source: MGI
  22. protein tetramerization Source: InterPro
  23. regulation of neuron apoptotic process Source: MGI
  24. release of cytochrome c from mitochondria Source: MGI
  25. response to X-ray Source: RefGenome
  26. response to gamma radiation Source: RefGenome
  27. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Apoptosis, Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor protein p73
Alternative name(s):
p53-like transcription factor
p53-related protein
Gene namesi
Name:Tp73
Synonyms:P73, Trp73
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:1336991. Trp73.

Subcellular locationi

Nucleus. Cytoplasm By similarity
Note: Accumulates in the nucleus in response to DNA damage.1 Publication

GO - Cellular componenti

  1. chromatin Source: RefGenome
  2. cytosol Source: RefGenome
  3. nucleus Source: MGI
  4. transcription factor complex Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice lacking Tp73 display a runting phenotype and high rates of mortality due to massive gastrointestinal hemorrhages or intracranial bleeding. The gastrointestinal tract suffers loss of enterocytes and excessive mucosecretions in the duodenum, ileum and cecum. Survivors exhibit hippocampal dysgenesis, hydrocephalus, chronic infections and inflammation, as well as abnormalities in pheromone sensory pathways.1 Publication

Keywords - Diseasei

Tumor suppressor

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 631631Tumor protein p73
PRO_0000370211Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei24 – 241Phosphothreonine; by PLK1 By similarity
Modified residuei25 – 251Phosphotyrosine; by SRC and HCK By similarity
Modified residuei91 – 911Phosphotyrosine; by ABL1 By similarity
Cross-linki622 – 622Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarityBy similarity

Post-translational modificationi

Sumoylated on Lys-622, which potentiates proteasomal degradation but does not affect transcriptional activity By similarity.
Phosphorylation by PLK1 and PLK3 inhibits the transcription regulator activity and pro-apoptotic function By similarity. Higher levels of phosphorylation seen in striatal neurons of. mutant huntingtin (htt) transgenic mice.
Polyubiquitinated by RCHY1/PIRH2; leading to its degradation by the proteasome By similarity.

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PRIDEiQ9JJP2.

PTM databases

PhosphoSiteiQ9JJP2.

Expressioni

Tissue specificityi

Found in striatal neurons of mutant huntingtin (htt) transgenic mice (at protein level). Isoform 1 is expressed in the nasal epithelium, the vomeronasal organ, the hippocampus and the hypothalamus.2 Publications

Gene expression databases

ArrayExpressiQ9JJP2.
BgeeiQ9JJP2.
GenevestigatoriQ9JJP2.

Interactioni

Subunit structurei

Found in a complex with p53/TP53 and CABLES1. The C-terminal oligomerization domain binds to the ABL1 tyrosine kinase SH3 domain. Interacts with HECW2, HIPK2, RANBP9 and WWOX By similarity. Interacts (via SAM domain) with FBXO45 (via B30.2/SPRY domain) By similarity. Interacts with YAP1 (phosphorylated form) By similarity. Interacts with HCK (via SH3 domain); this inhibits TP73 activity and degradation By similarity.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Yap1P469382EBI-1770138,EBI-1211949

Protein-protein interaction databases

BioGridi204326. 5 interactions.
DIPiDIP-41942N.
IntActiQ9JJP2. 2 interactions.
MINTiMINT-3388880.

Structurei

3D structure databases

ProteinModelPortaliQ9JJP2.
SMRiQ9JJP2. Positions 107-381, 486-542.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini479 – 54567SAM
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 4343Transactivation By similarityBy similarity
Add
BLAST
Regioni123 – 302180DNA-binding By similarityBy similarity
Add
BLAST
Regioni337 – 37842Oligomerization Reviewed prediction
Add
BLAST
Regioni337 – 37236Interaction with HIPK2 By similarityBy similarity
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi477 – 4815WW-bindingBy similarity

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5 – 106Poly-Ser
Compositional biasi383 – 3886Poly-Gln

Domaini

Possesses an acidic transactivation domain, a central DNA binding domain and a C-terminal oligomerization domain that binds to the ABL1 tyrosine kinase SH3 domain By similarity.By similarity
The WW-binding motif mediates interaction with WWOX By similarity.By similarity

Sequence similaritiesi

Belongs to the p53 family.By similarity

Phylogenomic databases

eggNOGiNOG80479.
GeneTreeiENSGT00390000015092.
InParanoidiB1AX90.
KOiK10148.
OrthoDBiEOG7JQBNW.
PhylomeDBiQ9JJP2.
TreeFamiTF106101.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
2.60.40.720. 1 hit.
4.10.170.10. 1 hit.
InterProiIPR008967. p53-like_TF_DNA-bd.
IPR012346. p53/RUNT-type_TF_DNA-bd.
IPR011615. p53_DNA-bd.
IPR010991. p53_tetrameristn.
IPR002117. p53_tumour_suppressor.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR011510. SAM_2.
[Graphical view]
PANTHERiPTHR11447. PTHR11447. 1 hit.
PfamiPF00870. P53. 1 hit.
PF07710. P53_tetramer. 1 hit.
PF07647. SAM_2. 1 hit.
[Graphical view]
PRINTSiPR00386. P53SUPPRESSR.
SMARTiSM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF47719. SSF47719. 1 hit.
SSF47769. SSF47769. 1 hit.
SSF49417. SSF49417. 1 hit.
PROSITEiPS00348. P53. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative promoter usage and alternative splicing. Align

Isoform 12 Publications (identifier: Q9JJP2-1) [UniParc]FASTAAdd to Basket

Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAQTSSSSSS TFEHLWSSLE PDSTYFDLPQ PSQGTSEASG SEESNMDVFH    50
LQGMAQFNLL SSAMDQMGSR AAPASPYTPE HAASAPTHSP YAQPSSTFDT 100
MSPAPVIPSN TDYPGPHHFE VTFQQSSTAK SATWTYSPLL KKLYCQIAKT 150
CPIQIKVSTP PPPGTAIRAM PVYKKAEHVT DIVKRCPNHE LGRDFNEGQS 200
APASHLIRVE GNNLAQYVDD PVTGRQSVVV PYEPPQVGTE FTTILYNFMC 250
NSSCVGGMNR RPILVIITLE TRDGQVLGRR SFEGRICACP GRDRKADEDH 300
YREQQALNES TTKNGAASKR AFKQSPPAIP ALGTNVKKRR HGDEDMFYMH 350
VRGRENFEIL MKVKESLELM ELVPQPLVDS YRQQQQQQLL QRPSHLQPPS 400
YGPVLSPMNK VHGGVNKLPS VNQLVGQPPP HSSAAGPNLG PMGSGMLNSH 450
GHSMPANGEM NGGHSSQTMV SGSHCTPPPP YHADPSLVSF LTGLGCPNCI 500
ECFTSQGLQS IYHLQNLTIE DLGALKVPDQ YRMTIWRGLQ DLKQSHDCGQ 550
QLLRSSSNAA TISIGGSGEL QRQRVMEAVH FRVRHTITIP NRGGAGAVTG 600
PDEWADFGFD LPDCKSRKQP IKEEFTETES H 631
Length:631
Mass (Da):69,096
Last modified:October 1, 2000 - v1
Checksum:iE364D566A90CBF1D
GO
Isoform 23 Publications (identifier: Q9JJP2-2) [UniParc]FASTAAdd to Basket

Also known as: dN-Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT

Note: Produced by alternative promoter usage.

Show »
Length:590
Mass (Da):64,725
Checksum:i8580C7EFA21B5797
GO
Isoform 31 Publication (identifier: Q9JJP2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT
     489-493: SFLTG → RTLGL
     494-631: Missing.

Note: Produced by alternative splicing of isoform 2. No experimental confirmation available.

Show »
Length:452
Mass (Da):49,392
Checksum:i13C8757F5A4A5FFC
GO
Isoform 41 Publication (identifier: Q9JJP2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT
     394-489: Missing.

Note: Produced by alternative splicing of isoform 2. No experimental confirmation available.

Show »
Length:494
Mass (Da):55,025
Checksum:iFA7D89986822E491
GO

Sequence cautioni

The sequence CAM18775.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5454MAQTS…HLQGM → MLYVGDPMRHLAT in isoform 2, isoform 3 and isoform 4. 4 Publications
VSP_053081Add
BLAST
Alternative sequencei394 – 48996Missing in isoform 4. 1 Publication
VSP_053082Add
BLAST
Alternative sequencei489 – 4935SFLTG → RTLGL in isoform 3. 1 Publication
VSP_053083
Alternative sequencei494 – 631138Missing in isoform 3. 1 Publication
VSP_053084Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti118 – 1181H → D in BAB30732. 1 Publication
Sequence conflicti127 – 1271S → G in BAE24089. 1 Publication
Sequence conflicti254 – 2541C → S in AAD32213. 1 Publication
Sequence conflicti352 – 3532RG → SAS in AAD32213. 1 Publication
Sequence conflicti376 – 3761P → H in AAD32213. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y19234 mRNA. Translation: CAB81953.1.
Y19235 mRNA. Translation: CAB81954.1.
AK017412 mRNA. Translation: BAB30732.1.
AK139633 mRNA. Translation: BAE24089.1.
AL806525 Genomic DNA. Translation: CAM18773.1.
AL806525 Genomic DNA. Translation: CAM18774.1.
AL806525 Genomic DNA. Translation: CAM18775.1. Different initiation.
CH466594 Genomic DNA. Translation: EDL14957.1.
BC066045 mRNA. Translation: AAH66045.1.
AF138873 Genomic DNA. Translation: AAD32213.1.
CCDSiCCDS51396.1. [Q9JJP2-4]
CCDS51397.1. [Q9JJP2-2]
RefSeqiNP_001119802.1. NM_001126330.1. [Q9JJP2-2]
NP_001119803.1. NM_001126331.1. [Q9JJP2-4]
NP_035772.2. NM_011642.3.
UniGeneiMm.78015.

Genome annotation databases

EnsembliENSMUST00000097762; ENSMUSP00000095368; ENSMUSG00000029026. [Q9JJP2-4]
ENSMUST00000105643; ENSMUSP00000101268; ENSMUSG00000029026. [Q9JJP2-3]
ENSMUST00000133533; ENSMUSP00000114418; ENSMUSG00000029026. [Q9JJP2-2]
GeneIDi22062.
KEGGimmu:22062.
UCSCiuc008wbg.2. mouse. [Q9JJP2-2]
uc008wbh.2. mouse. [Q9JJP2-1]
uc012dqi.1. mouse. [Q9JJP2-4]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y19234 mRNA. Translation: CAB81953.1 .
Y19235 mRNA. Translation: CAB81954.1 .
AK017412 mRNA. Translation: BAB30732.1 .
AK139633 mRNA. Translation: BAE24089.1 .
AL806525 Genomic DNA. Translation: CAM18773.1 .
AL806525 Genomic DNA. Translation: CAM18774.1 .
AL806525 Genomic DNA. Translation: CAM18775.1 . Different initiation.
CH466594 Genomic DNA. Translation: EDL14957.1 .
BC066045 mRNA. Translation: AAH66045.1 .
AF138873 Genomic DNA. Translation: AAD32213.1 .
CCDSi CCDS51396.1. [Q9JJP2-4 ]
CCDS51397.1. [Q9JJP2-2 ]
RefSeqi NP_001119802.1. NM_001126330.1. [Q9JJP2-2 ]
NP_001119803.1. NM_001126331.1. [Q9JJP2-4 ]
NP_035772.2. NM_011642.3.
UniGenei Mm.78015.

3D structure databases

ProteinModelPortali Q9JJP2.
SMRi Q9JJP2. Positions 107-381, 486-542.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204326. 5 interactions.
DIPi DIP-41942N.
IntActi Q9JJP2. 2 interactions.
MINTi MINT-3388880.

PTM databases

PhosphoSitei Q9JJP2.

Proteomic databases

PRIDEi Q9JJP2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000097762 ; ENSMUSP00000095368 ; ENSMUSG00000029026 . [Q9JJP2-4 ]
ENSMUST00000105643 ; ENSMUSP00000101268 ; ENSMUSG00000029026 . [Q9JJP2-3 ]
ENSMUST00000133533 ; ENSMUSP00000114418 ; ENSMUSG00000029026 . [Q9JJP2-2 ]
GeneIDi 22062.
KEGGi mmu:22062.
UCSCi uc008wbg.2. mouse. [Q9JJP2-2 ]
uc008wbh.2. mouse. [Q9JJP2-1 ]
uc012dqi.1. mouse. [Q9JJP2-4 ]

Organism-specific databases

CTDi 22062.
MGIi MGI:1336991. Trp73.

Phylogenomic databases

eggNOGi NOG80479.
GeneTreei ENSGT00390000015092.
InParanoidi B1AX90.
KOi K10148.
OrthoDBi EOG7JQBNW.
PhylomeDBi Q9JJP2.
TreeFami TF106101.

Miscellaneous databases

NextBioi 301868.
PROi Q9JJP2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9JJP2.
Bgeei Q9JJP2.
Genevestigatori Q9JJP2.

Family and domain databases

Gene3Di 1.10.150.50. 1 hit.
2.60.40.720. 1 hit.
4.10.170.10. 1 hit.
InterProi IPR008967. p53-like_TF_DNA-bd.
IPR012346. p53/RUNT-type_TF_DNA-bd.
IPR011615. p53_DNA-bd.
IPR010991. p53_tetrameristn.
IPR002117. p53_tumour_suppressor.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR011510. SAM_2.
[Graphical view ]
PANTHERi PTHR11447. PTHR11447. 1 hit.
Pfami PF00870. P53. 1 hit.
PF07710. P53_tetramer. 1 hit.
PF07647. SAM_2. 1 hit.
[Graphical view ]
PRINTSi PR00386. P53SUPPRESSR.
SMARTi SM00454. SAM. 1 hit.
[Graphical view ]
SUPFAMi SSF47719. SSF47719. 1 hit.
SSF47769. SSF47769. 1 hit.
SSF49417. SSF49417. 1 hit.
PROSITEi PS00348. P53. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "p73-deficient mice have neurological, pheromonal and inflammatory defects but lack spontaneous tumours."
    Yang A., Walker N., Bronson R., Kaghad M., Oosterwegel M., Bonnin J., Vagner C., Bonnet H., Dikkes P., Sharpe A., McKeon F., Caput D.
    Nature 404:99-103(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 118-631 (ISOFORM 1/2).
    Strain: C57BL/6J.
    Tissue: Egg and Head.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Fetal brain.
  6. "Mouse p73 gene maps to the distal part of chromosome 4 and might be involved in the progression of gamma-radiation-induced T-cell lymphomas."
    Herranz M., Santos J., Salido E., Fernandez-Piqueras J., Serrano M.
    Cancer Res. 59:2068-2071(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 136-631 (ISOFORMS 1/2), FUNCTION.
    Strain: 129/Sv.
  7. "p63 and p73 are required for p53-dependent apoptosis in response to DNA damage."
    Flores E.R., Tsai K.Y., Crowley D., Sengupta S., Yang A., McKeon F., Jacks T.
    Nature 416:560-564(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  8. "p73alpha is a candidate effector in the p53 independent apoptosis pathway of cisplatin damaged primary murine colonocytes."
    Oniscu A., Sphyris N., Morris R.G., Bader S., Harrison D.J.
    J. Clin. Pathol. 57:492-498(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  9. "Transcriptional repression induces a slowly progressive atypical neuronal death associated with changes of YAP isoforms and p73."
    Hoshino M., Qi M.-L., Yoshimura N., Tagawa K., Wada Y.-I., Enokido Y., Marubuchi S., Harjes P., Arai N., Oyanagi K., Blandino G., Sudol M., Rich T., Kanazawa I., Wanker E.E., Saitoe M., Okazawa H.
    J. Cell Biol. 172:589-604(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiP73_MOUSE
AccessioniPrimary (citable) accession number: Q9JJP2
Secondary accession number(s): B1AX89
, B1AX90, Q3UT91, Q9CU77, Q9JJP1, Q9WUJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 14, 2009
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Activated and stabilized by interaction with RANBP9 By similarity.By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi