Q9JJP2 (P73_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 83.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tumor protein p73 Alternative name(s): p53-like transcription factor p53-related protein | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 631 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein. Ref.6 Ref.7 UniProtKB O15350 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. UniProtKB O15350 |
| Subunit structure | Found in a complex with p53/TP53 and CABLES1. The C-terminal oligomerization domain binds to the ABL1 tyrosine kinase SH3 domain. Interacts with HECW2, HIPK2, RANBP9 and WWOX By similarity. Interacts (via SAM domain) with FBXO45 (via B30.2/SPRY domain) By similarity. Interacts with YAP1 (phosphorylated form) By similarity. Interacts with HCK (via SH3 domain); this inhibits TP73 activity and degradation By similarity. UniProtKB O15350 |
| Subcellular location | Nucleus. Cytoplasm By similarity. Note: Accumulates in the nucleus in response to DNA damage. Ref.8 |
| Tissue specificity | Found in striatal neurons of mutant huntingtin (htt) transgenic mice (at protein level). Isoform 1 is expressed in the nasal epithelium, the vomeronasal organ, the hippocampus and the hypothalamus. Ref.1 Ref.9 |
| Domain | Possesses an acidic transactivation domain, a central DNA binding domain and a C-terminal oligomerization domain that binds to the ABL1 tyrosine kinase SH3 domain By similarity. UniProtKB O15350 The WW-binding motif mediates interaction with WWOX By similarity. UniProtKB O15350 |
| Post-translational modification | Sumoylated on Lys-622, which potentiates proteasomal degradation but does not affect transcriptional activity By similarity. Phosphorylation by PLK1 and PLK3 inhibits the transcription regulator activity and pro-apoptotic function By similarity. Higher levels of phosphorylation seen in striatal neurons of. mutant huntingtin (htt) transgenic mice. Ubiquitinated; leading to its degradation by the proteasome By similarity. |
| Disruption phenotype | Mice lacking Tp73 display a runting phenotype and high rates of mortality due to massive gastrointestinal hemorrhages or intracranial bleeding. The gastrointestinal tract suffers loss of enterocytes and excessive mucosecretions in the duodenum, ileum and cecum. Survivors exhibit hippocampal dysgenesis, hydrocephalus, chronic infections and inflammation, as well as abnormalities in pheromone sensory pathways. Ref.1 |
| Miscellaneous | Activated and stabilized by interaction with RANBP9 By similarity. UniProtKB O15350 |
| Sequence similarities | Belongs to the p53 family. UniProtKB O15350 Contains 1 SAM (sterile alpha motif) domain. |
| Sequence caution | The sequence CAM18775.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 Ref.3 (identifier: Q9JJP2-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 Ref.3 Ref.5 (identifier: Q9JJP2-2) Also known as: dN-Alpha; The sequence of this isoform differs from the canonical sequence as follows: 1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 3 Ref.3 (identifier: Q9JJP2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT 489-493: SFLTG → RTLGL 494-631: Missing. | ||||||
| Note: Produced by alternative splicing of isoform 2. No experimental confirmation available. | ||||||
| Isoform 4 Ref.2 (identifier: Q9JJP2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT 394-489: Missing. | ||||||
| Note: Produced by alternative splicing of isoform 2. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 631 | 631 | Tumor protein p73 | PRO_0000370211 | |||||
Regions | |||||||||
| Domain | 479 – 545 | 67 | SAM | ||||||
| Region | 1 – 43 | 43 | Transactivation By similarity UniProtKB O15350 | ||||||
| Region | 123 – 302 | 180 | DNA-binding By similarity UniProtKB O15350 | ||||||
| Region | 337 – 378 | 42 | Oligomerization Potential | ||||||
| Region | 337 – 372 | 36 | Interaction with HIPK2 By similarity UniProtKB O15350 | ||||||
| Motif | 477 – 481 | 5 | WW-binding UniProtKB O15350 | ||||||
| Compositional bias | 5 – 10 | 6 | Poly-Ser | ||||||
| Compositional bias | 383 – 388 | 6 | Poly-Gln | ||||||
Sites | |||||||||
| Metal binding | 186 | 1 | Zinc By similarity UniProtKB O15350 | ||||||
| Metal binding | 189 | 1 | Zinc By similarity UniProtKB O15350 | ||||||
| Metal binding | 250 | 1 | Zinc By similarity UniProtKB O15350 | ||||||
| Metal binding | 254 | 1 | Zinc By similarity UniProtKB O15350 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 24 | 1 | Phosphothreonine; by PLK1 By similarity | ||||||
| Modified residue | 25 | 1 | Phosphotyrosine; by SRC and HCK By similarity | ||||||
| Modified residue | 91 | 1 | Phosphotyrosine; by ABL1 By similarity | ||||||
| Cross-link | 622 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity UniProtKB O15350 | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 54 | 54 | MAQTS…HLQGM → MLYVGDPMRHLAT in isoform 2, isoform 3 and isoform 4. Ref.1 Ref.2 Ref.3 Ref.5 | VSP_053081 | |||||
| Alternative sequence | 394 – 489 | 96 | Missing in isoform 4. Ref.2 | VSP_053082 | |||||
| Alternative sequence | 489 – 493 | 5 | SFLTG → RTLGL in isoform 3. Ref.3 | VSP_053083 | |||||
| Alternative sequence | 494 – 631 | 138 | Missing in isoform 3. Ref.3 | VSP_053084 | |||||
Experimental info | |||||||||
| Sequence conflict | 118 | 1 | H → D in BAB30732. Ref.2 | ||||||
| Sequence conflict | 127 | 1 | S → G in BAE24089. Ref.2 | ||||||
| Sequence conflict | 254 | 1 | C → S in AAD32213. Ref.5 | ||||||
| Sequence conflict | 352 – 353 | 2 | RG → SAS in AAD32213. Ref.5 | ||||||
| Sequence conflict | 376 | 1 | P → H in AAD32213. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "p73-deficient mice have neurological, pheromonal and inflammatory defects but lack spontaneous tumours." Yang A., Walker N., Bronson R., Kaghad M., Oosterwegel M., Bonnin J., Vagner C., Bonnet H., Dikkes P., Sharpe A., McKeon F., Caput D. Nature 404:99-103(2000) [PubMed: 10716451] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 118-631 (ISOFORM 1/2). Strain: C57BL/6J. Tissue: Egg and Head. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Fetal brain. |
| [6] | "Mouse p73 gene maps to the distal part of chromosome 4 and might be involved in the progression of gamma-radiation-induced T-cell lymphomas." Herranz M., Santos J., Salido E., Fernandez-Piqueras J., Serrano M. Cancer Res. 59:2068-2071(1999) [PubMed: 10232589] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 136-631 (ISOFORMS 1/2), FUNCTION. Strain: 129/Sv. |
| [7] | "p63 and p73 are required for p53-dependent apoptosis in response to DNA damage." Flores E.R., Tsai K.Y., Crowley D., Sengupta S., Yang A., McKeon F., Jacks T. Nature 416:560-564(2002) [PubMed: 11932750] [Abstract] Cited for: FUNCTION. |
| [8] | "p73alpha is a candidate effector in the p53 independent apoptosis pathway of cisplatin damaged primary murine colonocytes." Oniscu A., Sphyris N., Morris R.G., Bader S., Harrison D.J. J. Clin. Pathol. 57:492-498(2004) [PubMed: 15113856] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [9] | "Transcriptional repression induces a slowly progressive atypical neuronal death associated with changes of YAP isoforms and p73." Hoshino M., Qi M.-L., Yoshimura N., Tagawa K., Wada Y.-I., Enokido Y., Marubuchi S., Harjes P., Arai N., Oyanagi K., Blandino G., Sudol M., Rich T., Kanazawa I., Wanker E.E., Saitoe M., Okazawa H. J. Cell Biol. 172:589-604(2006) [PubMed: 16461361] [Abstract] Cited for: PHOSPHORYLATION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y19234 mRNA. Translation: CAB81953.1. Y19235 mRNA. Translation: CAB81954.1. AK017412 mRNA. Translation: BAB30732.1. AK139633 mRNA. Translation: BAE24089.1. AL806525 Genomic DNA. Translation: CAM18773.1. AL806525 Genomic DNA. Translation: CAM18774.1. AL806525 Genomic DNA. Translation: CAM18775.1. Different initiation. CH466594 Genomic DNA. Translation: EDL14957.1. BC066045 mRNA. Translation: AAH66045.1. AF138873 Genomic DNA. Translation: AAD32213.1. |
| IPI | IPI00648269. IPI00648744. IPI00652590. IPI00896107. |
| RefSeq | NP_001119802.1. NM_001126330.1. NP_001119803.1. NM_001126331.1. NP_035772.2. NM_011642.3. |
| UniGene | Mm.78015. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1DXS based on UniProtKB O15350. |
| ProteinModelPortal | Q9JJP2. |
| SMR | Q9JJP2. Positions 104-307, 348-381, 486-542. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9JJP2. 2 interactions. |
| MINT | MINT-3388880. |
| STRING | Q9JJP2. |
PTM databases | |
| PhosphoSite | Q9JJP2. |
Proteomic databases | |
| PRIDE | Q9JJP2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000030892; ENSMUSP00000030892; ENSMUSG00000029026. ENSMUST00000097762; ENSMUSP00000095368; ENSMUSG00000029026. ENSMUST00000105643; ENSMUSP00000101268; ENSMUSG00000029026. ENSMUST00000105644; ENSMUSP00000101269; ENSMUSG00000029026. ENSMUST00000133533; ENSMUSP00000114418; ENSMUSG00000029026. |
| GeneID | 22062. |
| KEGG | mmu:22062. |
| UCSC | uc008wbg.2. mouse. uc008wbh.2. mouse. uc012dqi.1. mouse. |
Organism-specific databases | |
| CTD | 22062. |
| MGI | MGI:1336991. Trp73. |
Phylogenomic databases | |
| eggNOG | roNOG10897. |
| GeneTree | ENSGT00390000015092. |
| InParanoid | Q9JJP2. |
| OrthoDB | EOG4P5K8S. |
| PhylomeDB | Q9JJP2. |
Gene expression databases | |
| ArrayExpress | Q9JJP2. |
| Bgee | Q9JJP2. |
| Genevestigator | Q9JJP2. |
Family and domain databases | |
| InterPro | IPR008967. p53-like_TF_DNA-bd. IPR012346. p53/RUNT-type_TF_DNA-bd. IPR011615. p53_DNA-bd. IPR010991. p53_tetrameristn. IPR002117. p53_tumour_suppressor. IPR001660. SAM. IPR013761. SAM/pointed. IPR011510. SAM_2. [Graphical view] |
| Gene3D | G3DSA:2.60.40.720. p53_RUNT_DNA_bd. 1 hit. G3DSA:4.10.170.10. p53_tetrameristn. 1 hit. G3DSA:1.10.150.50. SAM_type. 1 hit. |
| KO | K10148. |
| PANTHER | PTHR11447. Trp53. 1 hit. |
| Pfam | PF00870. P53. 1 hit. PF07710. P53_tetramer. 1 hit. PF07647. SAM_2. 1 hit. [Graphical view] |
| PRINTS | PR00386. P53SUPPRESSR. |
| SMART | SM00454. SAM. 1 hit. [Graphical view] |
| SUPFAM | SSF49417. P53_like_DNA_bnd. 1 hit. SSF47719. p53_tetrameristn. 1 hit. SSF47769. SAM_homology. 1 hit. |
| PROSITE | PS00348. P53. 1 hit. PS50105. SAM_DOMAIN. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | P73_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9JJP2 Secondary accession number(s): B1AX89 Q9WUJ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with