Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase WNK1

Gene

Wnk1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition (By similarity).By similarity2 Publications
Isoform 5: Dominant-negative regulator of the longer isoform 1. Does not have kinase acitivity, does not directly inhibit WNK4 and has no direct effect on sodium and chloride ion transport. Downregulates sodium-chloride cotransporter activity indirectly by inhibiting isoform 1, it associates with isoform 1 and attenuates its kinase activity. In kidney, may play an important role regulating sodium and potassium balance.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Mg2+1 Publication

Enzyme regulationi

By hypertonicity. Activation requires autophosphorylation of Ser-382. Phosphorylation of Ser-378 also promotes increased activity.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei233ATPPROSITE-ProRule annotation1 Publication1
Active sitei349Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi227 – 235ATPPROSITE-ProRule annotationBy similarity9

GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • chloride channel inhibitor activity Source: Ensembl
  • magnesium ion binding Source: RGD
  • phosphatase binding Source: UniProtKB
  • potassium channel inhibitor activity Source: RGD
  • protein kinase binding Source: RGD
  • protein serine/threonine kinase activity Source: UniProtKB
  • protein serine/threonine kinase inhibitor activity Source: RGD

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Protein kinase inhibitor, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase WNK1 (EC:2.7.11.1)
Alternative name(s):
Protein kinase lysine-deficient 1
Protein kinase with no lysine 1
Gene namesi
Name:Wnk1
Synonyms:Hsn2, Prkwnk1
OrganismiRattus norvegicus (Rat)Imported
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi621141. Wnk1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: ParkinsonsUK-UCL
  • membrane Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi233K → G: Loss of kinase activity; when associated with K-250. 2 Publications1
Mutagenesisi233K → M: Loss of kinase activity. 2 Publications1
Mutagenesisi250C → A: No effect on kinase activity. 2 Publications1
Mutagenesisi250C → K: Reduced kinase activity. Loss of kinase activity; when associated with G-233. 2 Publications1
Mutagenesisi256K → M: No effect on kinase activity. 1 Publication1
Mutagenesisi259K → M: No effect on kinase activity. 1 Publication1
Mutagenesisi378S → A: Reduced kinase activity. 1 Publication1
Mutagenesisi378S → D: Increased kinase activity. 1 Publication1
Mutagenesisi382S → A: Loss of kinase activity. 1 Publication1
Mutagenesisi382S → D: Loss of kinase activity. 1 Publication1
Mutagenesisi524F → A: Reduced ability of autoinhibitory domain to regulate kinase activity. 1 Publication1
Mutagenesisi526F → A: Reduced ability of autoinhibitory domain to regulate kinase activity. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000868211 – 2126Serine/threonine-protein kinase WNK1Add BLAST2126

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphoserineBy similarity1
Modified residuei165PhosphoserineCombined sources1
Modified residuei172PhosphoserineCombined sources1
Modified residuei378Phosphoserine; by autocatalysis1 Publication1
Modified residuei382Phosphoserine; by autocatalysis1 Publication1
Modified residuei1007PhosphoserineBy similarity1
Modified residuei1723PhosphoserineBy similarity1
Modified residuei1755PhosphoserineBy similarity1
Modified residuei1756PhosphoserineBy similarity1
Modified residuei1771PhosphoserineBy similarity1
Modified residuei1773PhosphoserineCombined sources1
Modified residuei1776PhosphoserineCombined sources1
Modified residuei1865PhosphoserineBy similarity1
Modified residuei2014PhosphoserineBy similarity1
Modified residuei2030PhosphoserineBy similarity1
Modified residuei2114PhosphoserineBy similarity1
Modified residuei2116PhosphoserineBy similarity1

Post-translational modificationi

Ubiquitinated in vitro by the BCR(KLHL3) complex and in vivo by a BCR(KLHL2) complex, leading to proteasomal degradation.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ3S2I2.
Q9JIH7.
PRIDEiQ9JIH7.

PTM databases

iPTMnetiQ9JIH7.
PhosphoSitePlusiQ9JIH7.

Expressioni

Gene expression databases

ExpressionAtlasiQ9JIH7. baseline and differential.
GenevisibleiQ9JIH7. RN.

Interactioni

Subunit structurei

Interacts with SYT2. Interacts with KLHL3, WNK3 and WNK4 (PubMed:17975670). Isoform 5: Interacts with isoform 1 (PubMed:16204408).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Syt2P291019EBI-457953,EBI-458017

GO - Molecular functioni

  • phosphatase binding Source: UniProtKB
  • protein kinase binding Source: RGD

Protein-protein interaction databases

IntActiQ9JIH7. 6 interactors.
STRINGi10116.ENSRNOP00000013355.

Structurei

Secondary structure

12126
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi211 – 214Combined sources4
Beta strandi220 – 229Combined sources10
Beta strandi231 – 240Combined sources10
Turni241 – 243Combined sources3
Beta strandi246 – 252Combined sources7
Helixi254 – 256Combined sources3
Helixi259 – 273Combined sources15
Beta strandi283 – 291Combined sources9
Beta strandi294 – 302Combined sources9
Helixi309 – 316Combined sources8
Helixi321 – 339Combined sources19
Beta strandi341 – 343Combined sources3
Beta strandi354 – 359Combined sources6
Beta strandi364 – 366Combined sources3
Helixi371 – 374Combined sources4
Beta strandi377 – 379Combined sources3
Helixi392 – 396Combined sources5
Helixi402 – 417Combined sources16
Turni421 – 424Combined sources4
Helixi428 – 435Combined sources8
Turni436 – 438Combined sources3
Helixi442 – 446Combined sources5
Helixi450 – 459Combined sources10
Helixi464 – 466Combined sources3
Helixi470 – 474Combined sources5
Helixi477 – 479Combined sources3
Beta strandi484 – 491Combined sources8
Beta strandi498 – 507Combined sources10
Beta strandi511 – 515Combined sources5
Beta strandi521 – 527Combined sources7
Turni528 – 530Combined sources3
Helixi533 – 542Combined sources10
Helixi548 – 550Combined sources3
Helixi551 – 568Combined sources18

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LRUNMR-A480-572[»]
3FPQX-ray1.80A/B194-483[»]
4Q2AX-ray3.50A194-480[»]
5DRBX-ray1.65A194-483[»]
ProteinModelPortaliQ9JIH7.
SMRiQ9JIH7.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9JIH7.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini221 – 479Protein kinasePROSITE-ProRule annotationAdd BLAST259

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0584. Eukaryota.
ENOG410XQWZ. LUCA.
GeneTreeiENSGT00800000124049.
HOGENOMiHOG000168221.
HOVERGENiHBG079897.
InParanoidiQ9JIH7.
KOiK08867.
OMAiHERPVSF.
PhylomeDBiQ9JIH7.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR024678. Kinase_OSR1/WNK_CCT.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF12202. OSR1_C. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9JIH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDGTAEKQS GTPGFLSPPA PVPKNGSSSD SSVGEKLGAA VADSGIGRTE
60 70 80 90 100
EYRRRRHTMD KDSRGAAATT TPTEHRFFRR SVICDSNATA LELPGLPLSI
110 120 130 140 150
PQPSVPAVVP QSAPPEPHRE ETLTATVASQ VSQQPSAAAS PGEQAVVGSA
160 170 180 190 200
TATVPSSTSK DRPVSQPSLV GSKEEPPPSR SGSGSGGASA KEPQEERNQQ
210 220 230 240 250
QDDIEELETK AVGMSNDGRF LKFDIEIGRG SFKTVYKGLD TETTVEVAWC
260 270 280 290 300
ELQDRKLTKS ERQRFKEEAE MLKGLQHPNI VRFYDSWEST VKGKKCIVLV
310 320 330 340 350
TELMTSGTLK TYLKRFKVMK IKVLRSWCRQ ILKGLQFLHT RTPPIIHRDL
360 370 380 390 400
KCDNIFITGP TGSVKIGDLG LATLKRASFA KSVIGTPEFM APEMYEEKYD
410 420 430 440 450
ESVDVYAFGM CMLEMATSEY PYSECQNAAQ IYRRVTSGVK PASFDKVAIP
460 470 480 490 500
EVKEIIEGCI RQNKDERYSI KDLLNHAFFQ EETGVRVELA EEDDGEKIAI
510 520 530 540 550
KLWLRIEDIK KLKGKYKDNE AIEFSFDLER DVPEDVAQEM VESGYVCEGD
560 570 580 590 600
HKTMAKAIKD RVSLIKRKRE QRQLVREEQE KRKQEESSFK QQNEQQASVS
610 620 630 640 650
QAGIQPLSVA STGIPTAPTT SASVSTQVEP EEPEADQHQQ LQYQQPSISV
660 670 680 690 700
LSDGTVDSGQ GSSVFTESRV SSQQTVSYGS QHEQAHSIGT APGHTVSSIQ
710 720 730 740 750
AQSQPHGVYP PSSMAQGQNQ GQPSSSLAGV LSSQPVQHPQ QQGIQPTVPP
760 770 780 790 800
QQAVQYSLPQ AASSSEGTVQ PVSQPQVSAG TQSSTQGVSQ AAPPEQTPIT
810 820 830 840 850
QSQPTQPVPL VSSVDSAHSD VASGMSDGNE NAPSSSGRHE GRTTKRHYRK
860 870 880 890 900
SVRSRSRHEK TSRPKLRILN VSNKGDRVVE CQLETHNRKM VTFKFDLDGD
910 920 930 940 950
NPEEIATIMV NNDFILAIER ESFVAQVREI IEKADEMLSE DVSVEPEGDQ
960 970 980 990 1000
GLESLQGKDD YGFPGSQKLE GEFKQPIAVS SMPQQIGVPT SSLTQVVHSA
1010 1020 1030 1040 1050
GRRFIVSPVP ESRLRESKIF TSEIPDPVAA STSQGPGMNL SHSASSLSLQ
1060 1070 1080 1090 1100
QAFSELKHGQ MTEGPNTAPP NFNHPGPTFS PFLTSIAGVQ TVAASTPSVS
1110 1120 1130 1140 1150
VPITSSPLND ISTSVMQSEG ALPTDKGIGG VTTSTGVVAS GGLTTLSVSE
1160 1170 1180 1190 1200
TPTLSSAVSS STAPAVVTVS TTSQPVQAST SGSIASSTGS FPSGTFSTTT
1210 1220 1230 1240 1250
GTTVSSVAVP NAKPPTVLLQ QVAGNTAGVA IVTSVSTTTP FPAMASQPSL
1260 1270 1280 1290 1300
PLGSSTSAPT LAETVVVSAH SLDKASHSST AGLGLSFCAP SSSSSSGTAV
1310 1320 1330 1340 1350
SSSVSQPGIV HPLVISSAIA STPVLPQPAV PTSTPLLPQV PNIPPLVQPV
1360 1370 1380 1390 1400
ANVPAVQQTL IHSQPQPALL PNQPHTHCPE MDADTQSKAP GIDDIKTLEE
1410 1420 1430 1440 1450
KLRSLFSEHS SSGTQHASVS LETPLVVETV TPGIPTTAVA PSKLMTSTTS
1460 1470 1480 1490 1500
TCLPPTNLPL GTAGMPVMPV GTPGQVSTPG THASAPASTA TGAKPGTTPP
1510 1520 1530 1540 1550
KPSLTKTVVP PVGTELSAGT VPCEQLPPFP GPSLIQTQQP LEDLDAQLRR
1560 1570 1580 1590 1600
TLSPETIPVT PAVGPLSTMS STAVTEAGSQ PQKDGTEVHV TASSSGAGVV
1610 1620 1630 1640 1650
KMGRFQVSVT MDDAQKERKN RSEDTKSVHF ESSTSESSVL SSSSPESTLV
1660 1670 1680 1690 1700
KPEPNGITVS GISLDVPDST HRTPTPEAKS ETGQPTKVGR FQVTTTANKV
1710 1720 1730 1740 1750
GRFSVSRTED KVTELKKEGP VTSPFRDSEQ TVIPAAIPKK EKPELAEPSH
1760 1770 1780 1790 1800
LNGPSSDLEA AFLSRGGEDG SGSPHSPPHL CSKSLPIQTL SQSLSNSFNS
1810 1820 1830 1840 1850
SYMSSDNESD IEDEDLRLEL RRLREKHLKE IQDLQSRQKH EIESLYTKLG
1860 1870 1880 1890 1900
KVPPAVIIPP AAPLSGRRRR PTKSKGSKSS RSSSLGNKSP QLSGNLSGQS
1910 1920 1930 1940 1950
GTSVLNPQQT LHPPGNTPET GHNQLLQPLK PSPSSDNLYS AFTSDGAISV
1960 1970 1980 1990 2000
PSLSAPGQGT SSTNTVGGTV SSQAAQAQPP AMTSSRKGTF TDDLHKLVDN
2010 2020 2030 2040 2050
WARDAMNLSG RRGSKGHMNY EGPGMARKFS APGQLCISMT SNMGGSTPIS
2060 2070 2080 2090 2100
AASATSLGHF TKSMCPPQQY GFPAAPFGTQ WSGTGGPAPQ PLGQFQPVGT
2110 2120
TSLQNFNISN LQKSISNPPG SNLRTT
Length:2,126
Mass (Da):225,112
Last modified:November 30, 2010 - v2
Checksum:i89AC72F9CC8B07DF
GO
Isoform 2 (identifier: Q9JIH7-3) [UniParc]FASTAAdd to basket
Also known as: Brain and spinal cord variant

The sequence of this isoform differs from the canonical sequence as follows:
     714-714: M → MPRRGRSMSV...SSGGSALHPQ

Note: This isoform which includes the HSN2 exon has been identified in human and mouse. The sequence shown here is the result of gene prediction.
Show »
Length:2,625
Mass (Da):278,978
Checksum:i3A08561C46528F28
GO
Isoform 3 (identifier: Q9JIH7-2) [UniParc]FASTAAdd to basket
Also known as: Dorsal root ganglia and sciatic nerve variant, DRG and sciatic nerve variant

The sequence of this isoform differs from the canonical sequence as follows:
     714-714: M → MPQSVAHPCG...SSGGSALHPQ
     782-782: Q → QGFPSRLPPQ...TTSSQQAVLE

Note: This isoform which includes the HSN2 exon has been identified in human and mouse. The sequence shown here is the result of gene prediction.
Show »
Length:2,634
Mass (Da):279,566
Checksum:i16F6B2F0666858C7
GO
Isoform 4 (identifier: Q9JIH7-4) [UniParc]FASTAAdd to basket
Also known as: KS-WNK1-long, Kidney-Specific long form1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-437: MSDGTAEKQS...AAQIYRRVTS → MVVCISIYFP...CCSQKDCINE
     543-2126: Missing.

Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing.1 Publication
Show »
Length:160
Mass (Da):18,469
Checksum:i8FE8F697EDF503E5
GO
Isoform 5 (identifier: Q9JIH7-5) [UniParc]FASTAAdd to basket
Also known as: KS-WNK1-short, Kidney-Specific short form1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-437: MSDGTAEKQS...AAQIYRRVTS → MDFLKKDFCSVFVIVNSHCCCCSQKDCINE
     543-2126: Missing.

Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing.1 Publication
Show »
Length:135
Mass (Da):15,625
Checksum:i652E0035E5454FE8
GO

Sequence cautioni

The sequence DAA04492 differs from that shown. Reason: Erroneous gene model prediction. Includes 3' and 3' intronic sequences.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1179S → F in AAF74258 (PubMed:10828064).Curated1
Sequence conflicti1950V → I in AAF74258 (PubMed:10828064).Curated1
Sequence conflicti2120G → S in AAF74258 (PubMed:10828064).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0585941 – 437MSDGT…RRVTS → MVVCISIYFPPSFFLNSIKS VLPFLMDFLKKDFCSVFVIV NSHCCCCSQKDCINE in isoform 4. Add BLAST437
Alternative sequenceiVSP_0585951 – 437MSDGT…RRVTS → MDFLKKDFCSVFVIVNSHCC CCSQKDCINE in isoform 5. Add BLAST437
Alternative sequenceiVSP_058596543 – 2126Missing in isoform 4 and isoform 5. Add BLAST1584
Alternative sequenceiVSP_040279714M → MPRRGRSMSVCVPHLSAVPS LSRISPSAPSTPPPVLSAPL CPSLLRSAPEETFAEKLSKA LESVLPMHSASQRKHRRSSL PSLFVTTPQSVAHPCGGTPT YPESQIFFPTIHERPVSFSP PPTCPPKVAISQRRKSTSFL EAQTRHFQPLLRTVGQNHLP PGGSPTNWTPEAIVMLGTTA NRVNRELCEMQVQPVFETTQ IYSDYRPGLVLAEEAHYFIP QETVYLAGVHYQAHAAGQYE GISYNSPVLSSPMKQITEQK PVPGCPASSSVFEFPSGQAF LVGHLQNLRLDSGPSPASPL SSISAPNSTDATHLKFHPVF VPHSAPAVLTHSNENRSNCV FEFHAQTPSSSSGEGGGILP QRVYRNRQVAVDSSQEELSP QSVGLHCHLQPVTEEQRNNH TPELTISVVEPMGQNWPVGS PEYSSDSSQITSSDISDFQS PPPTGGTAAPFGSDVSLPYI RLPQTVLQESPLFFCFPQGT TSQQVLSASYSSGGSALHPQ in isoform 2. Curated1
Alternative sequenceiVSP_040278714M → MPQSVAHPCGGTPTYPESQI FFPTIHERPVSFSPPPTCPP KVAISQRRKSTSFLEAQTRH FQPLLRTVGQNHLPPGGSPT NWTPEAIVMLGTTANRVNRE LCEMQVQPVFETTQIYSDYR PGLVLAEEAHYFIPQETVYL AGVHYQAHAAGQYEGISYNS PVLSSPMKQITEQKPVPGCP ASSSVFEFPSGQAFLVGHLQ NLRLDSGPSPASPLSSISAP NSTDATHLKFHPVFVPHSAP AVLTHSNENRSNCVFEFHAQ TPSSSSGEGGGILPQRVYRN RQVAVDSSQEELSPQSVGLH CHLQPVTEEQRNNHTPELTI SVVEPMGQNWPVGSPEYSSD SSQITSSDISDFQSPPPTGG TAAPFGSDVSLPYIRLPQTV LQESPLFFCFPQGTTSQQVL SASYSSGGSALHPQ in isoform 3. Curated1
Alternative sequenceiVSP_040280782Q → QGFPSRLPPQYPGDSNIAPS SNVASVCIHSTVLAPPPMPT EALATQGYFPTVVQPYVEST PLVPMGSVGGQVQVSQPAVS LSQQPPTTSSQQAVLE in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF227741 mRNA. Translation: AAF74258.1.
DQ177457 mRNA. Translation: ABA02202.1.
AC106348 Genomic DNA. No translation available.
BK004106 Genomic DNA. Translation: DAA04492.1. Sequence problems.
RefSeqiNP_001002823.2. NM_001002823.2. [Q9JIH7-2]
NP_001186024.1. NM_001199095.1. [Q9JIH7-3]
NP_446246.2. NM_053794.2. [Q9JIH7-1]
UniGeneiRn.27409.

Genome annotation databases

EnsembliENSRNOT00000013355; ENSRNOP00000013355; ENSRNOG00000009956. [Q9JIH7-2]
ENSRNOT00000013621; ENSRNOP00000013622; ENSRNOG00000009956. [Q9JIH7-3]
ENSRNOT00000080788; ENSRNOP00000072173; ENSRNOG00000009956. [Q9JIH7-1]
GeneIDi116477.
KEGGirno:116477.
UCSCiRGD:621141. rat. [Q9JIH7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF227741 mRNA. Translation: AAF74258.1.
DQ177457 mRNA. Translation: ABA02202.1.
AC106348 Genomic DNA. No translation available.
BK004106 Genomic DNA. Translation: DAA04492.1. Sequence problems.
RefSeqiNP_001002823.2. NM_001002823.2. [Q9JIH7-2]
NP_001186024.1. NM_001199095.1. [Q9JIH7-3]
NP_446246.2. NM_053794.2. [Q9JIH7-1]
UniGeneiRn.27409.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LRUNMR-A480-572[»]
3FPQX-ray1.80A/B194-483[»]
4Q2AX-ray3.50A194-480[»]
5DRBX-ray1.65A194-483[»]
ProteinModelPortaliQ9JIH7.
SMRiQ9JIH7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9JIH7. 6 interactors.
STRINGi10116.ENSRNOP00000013355.

PTM databases

iPTMnetiQ9JIH7.
PhosphoSitePlusiQ9JIH7.

Proteomic databases

PaxDbiQ3S2I2.
Q9JIH7.
PRIDEiQ9JIH7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000013355; ENSRNOP00000013355; ENSRNOG00000009956. [Q9JIH7-2]
ENSRNOT00000013621; ENSRNOP00000013622; ENSRNOG00000009956. [Q9JIH7-3]
ENSRNOT00000080788; ENSRNOP00000072173; ENSRNOG00000009956. [Q9JIH7-1]
GeneIDi116477.
KEGGirno:116477.
UCSCiRGD:621141. rat. [Q9JIH7-1]

Organism-specific databases

CTDi65125.
RGDi621141. Wnk1.

Phylogenomic databases

eggNOGiKOG0584. Eukaryota.
ENOG410XQWZ. LUCA.
GeneTreeiENSGT00800000124049.
HOGENOMiHOG000168221.
HOVERGENiHBG079897.
InParanoidiQ9JIH7.
KOiK08867.
OMAiHERPVSF.
PhylomeDBiQ9JIH7.

Miscellaneous databases

EvolutionaryTraceiQ9JIH7.
PROiQ9JIH7.

Gene expression databases

ExpressionAtlasiQ9JIH7. baseline and differential.
GenevisibleiQ9JIH7. RN.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR024678. Kinase_OSR1/WNK_CCT.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF12202. OSR1_C. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiWNK1_RAT
AccessioniPrimary (citable) accession number: Q9JIH7
Secondary accession number(s): Q3S2I2, Q6IFS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: November 30, 2010
Last modified: November 30, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

Cys-250 is present instead of the conserved Lys which is expected to be an active site residue. Lys-233 appears to fulfill the required catalytic function.2 Publications
HSN2 was originally thought to be an intronless gene lying within a WNK1 gene intron. It has been shown to be an alternative exon of the WNK1 gene in other mammalian species, including human and mouse. Isoforms bearing this exon (isoform 2 and isoform 3 in this entry) are specifically expressed in the nervous system in these species. system.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.