Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9IAK4

- NOE1_CHICK

UniProt

Q9IAK4 - NOE1_CHICK

Protein

Noelin

Gene

OLFM1

Organism
Gallus gallus (Chicken)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play an important role in regulating the production of neural crest cells by the neural tube.

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. protein oligomerization Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Noelin
    Alternative name(s):
    Neuronal olfactomedin-related ER localized protein
    Olfactomedin-1
    Pancortin
    Gene namesi
    Name:OLFM1
    Synonyms:NOEL, NOEL1
    OrganismiGallus gallus (Chicken)
    Taxonomic identifieri9031 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus
    ProteomesiUP000000539: Chromosome 17

    Subcellular locationi

    Secreted Curated. Cell junctionsynapse By similarity

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
    2. cell junction Source: UniProtKB-KW
    3. extracellular space Source: Ensembl
    4. synapse Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Secreted, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1616Sequence AnalysisAdd
    BLAST
    Chaini17 – 485469NoelinPRO_0000020077Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
    Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi307 – 3071N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi431 – 4311N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi473 – 4731N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Glycosylated.

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9IAK4.

    Expressioni

    Developmental stagei

    Expressed in a graded pattern in the closing neural tube. Subsequently becomes restricted to the dorsal neural folds and migrating neural crest.

    Interactioni

    Subunit structurei

    Component of the AMPAR complex.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ9IAK4.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini226 – 478253Olfactomedin-likePROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili87 – 225139Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Signal

    Phylogenomic databases

    eggNOGiNOG283888.
    GeneTreeiENSGT00750000117256.
    HOGENOMiHOG000232069.
    HOVERGENiHBG006513.
    InParanoidiQ9IAK4.
    OMAiQILQTWN.
    OrthoDBiEOG75F4CZ.
    PhylomeDBiQ9IAK4.
    TreeFamiTF315964.

    Family and domain databases

    Gene3Di2.130.10.80. 2 hits.
    InterProiIPR015916. Gal_Oxidase_b-propeller.
    IPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view]
    PfamiPF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view]
    SMARTiSM00284. OLF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50969. SSF50969. 2 hits.
    PROSITEiPS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9IAK4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLTAA SGGTLDRSTG    50
    VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK 100
    VQNMSQSIEV LDRRTQRDLQ YVEKMENQMR GLESKFKQVE ESHKQHLARQ 150
    FKAIKAKMEE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG 200
    AYDYEELQNR VSNLEERLRA CMQKLACGKL TGISDPITIK TSGSRFGSWM 250
    TDPLAPEGEN KVWYMDSYHN NRFVREYKSM ADFMNTDNFT SHRLPHPWSG 300
    TGQVVYNGSI YFNKYQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG 350
    GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPNTLQSL QTWNTSYPKR 400
    SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS 450
    MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL 485
    Length:485
    Mass (Da):55,530
    Last modified:October 1, 2000 - v1
    Checksum:i7B6481EAA497A948
    GO
    Isoform 2 (identifier: Q9IAK4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLTAASGGTLDRSTG → MQPASKLLTLFFLILMGTELTQ

    Show »
    Length:457
    Mass (Da):52,861
    Checksum:i1AB805499306FE5B
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5050MSVPL…DRSTG → MQPASKLLTLFFLILMGTEL TQ in isoform 2. 1 PublicationVSP_003768Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF182815 mRNA. Translation: AAF40413.1.
    AF239804 mRNA. Translation: AAF43715.1.
    RefSeqiNP_990098.1. NM_204767.1. [Q9IAK4-1]
    UniGeneiGga.3402.

    Genome annotation databases

    EnsembliENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. [Q9IAK4-1]
    GeneIDi395535.
    KEGGigga:395535.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF182815 mRNA. Translation: AAF40413.1 .
    AF239804 mRNA. Translation: AAF43715.1 .
    RefSeqi NP_990098.1. NM_204767.1. [Q9IAK4-1 ]
    UniGenei Gga.3402.

    3D structure databases

    ProteinModelPortali Q9IAK4.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q9IAK4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSGALT00000003964 ; ENSGALP00000003955 ; ENSGALG00000002515 . [Q9IAK4-1 ]
    GeneIDi 395535.
    KEGGi gga:395535.

    Organism-specific databases

    CTDi 10439.

    Phylogenomic databases

    eggNOGi NOG283888.
    GeneTreei ENSGT00750000117256.
    HOGENOMi HOG000232069.
    HOVERGENi HBG006513.
    InParanoidi Q9IAK4.
    OMAi QILQTWN.
    OrthoDBi EOG75F4CZ.
    PhylomeDBi Q9IAK4.
    TreeFami TF315964.

    Miscellaneous databases

    NextBioi 20815612.
    PROi Q9IAK4.

    Family and domain databases

    Gene3Di 2.130.10.80. 2 hits.
    InterProi IPR015916. Gal_Oxidase_b-propeller.
    IPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view ]
    Pfami PF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view ]
    SMARTi SM00284. OLF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50969. SSF50969. 2 hits.
    PROSITEi PS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Noelin-1 is a secreted glycoprotein involved in generation of the neural crest."
      Barembaum M., Moreno T.A., LaBonne C., Sechrist J., Bronner-Fraser M.
      Nat. Cell Biol. 2:219-225(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).

    Entry informationi

    Entry nameiNOE1_CHICK
    AccessioniPrimary (citable) accession number: Q9IAK4
    Secondary accession number(s): Q9I9K5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 92 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3