Q9IAK4 (NOE1_CHICK) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Noelin Alternative name(s): Neuronal olfactomedin-related ER localized protein Olfactomedin-1 Pancortin | ||||
| Gene names |
| ||||
| Organism | Gallus gallus (Chicken) [Reference proteome] | ||||
| Taxonomic identifier | 9031 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Archosauria › Dinosauria › Saurischia › Theropoda › Coelurosauria › Aves › Neognathae › Galliformes › Phasianidae › Phasianinae › Gallus![]() |
Protein attributes
| Sequence length | 485 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May play an important role in regulating the production of neural crest cells by the neural tube. |
| Subunit structure | Component of the AMPAR complex By similarity. |
| Subcellular location | Secreted Potential. Cell junction › synapse By similarity. |
| Developmental stage | Expressed in a graded pattern in the closing neural tube. Subsequently becomes restricted to the dorsal neural folds and migrating neural crest. |
| Post-translational modification | Glycosylated. |
| Sequence similarities | Contains 1 olfactomedin-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Secreted Synapse |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Signal |
| Molecular function | Developmental protein |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW protein oligomerizationInferred from electronic annotation. Source: Compara |
| Cellular_component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW extracellular spaceInferred from electronic annotation. Source: Compara synapseInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9IAK4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9IAK4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLTAASGGTLDRSTG → MQPASKLLTLFFLILMGTELTQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||||
| Chain | 17 – 485 | 469 | Noelin | PRO_0000020077 | |||||||
Regions | |||||||||||
| Domain | 226 – 478 | 253 | Olfactomedin-like | ||||||||
| Coiled coil | 87 – 225 | 139 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 187 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 307 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 394 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 431 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 473 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 227 ↔ 409 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 50 | 50 | MSVPL…DRSTG → MQPASKLLTLFFLILMGTEL TQ in isoform 2. | VSP_003768 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Noelin-1 is a secreted glycoprotein involved in generation of the neural crest." Barembaum M., Moreno T.A., LaBonne C., Sechrist J., Bronner-Fraser M. Nat. Cell Biol. 2:219-225(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF182815 mRNA. Translation: AAF40413.1. AF239804 mRNA. Translation: AAF43715.1. |
| IPI | IPI00595407. IPI00599305. |
| RefSeq | NP_990098.1. NM_204767.1. |
| UniGene | Gga.3402. |
3D structure databases | |
| ProteinModelPortal | Q9IAK4. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q9IAK4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. |
| GeneID | 395535. |
| KEGG | gga:395535. |
Organism-specific databases | |
| CTD | 10439. |
Phylogenomic databases | |
| eggNOG | NOG283888. |
| GeneTree | ENSGT00660000095208. |
| HOGENOM | HOG000232069. |
| HOVERGEN | HBG006513. |
| InParanoid | Q9IAK4. |
| OMA | MVDFMNT. |
Gene expression databases | |
| ArrayExpress | Q9IAK4. |
Family and domain databases | |
| Gene3D | 2.130.10.80. 2 hits. |
| InterPro | IPR015916. Gal_Oxidase_b-propeller. IPR022082. Noelin-1. IPR003112. Olfac-like. IPR011047. Quinonprotein_ADH-like_supfam. [Graphical view] |
| Pfam | PF12308. Noelin-1. 1 hit. PF02191. OLF. 1 hit. [Graphical view] |
| SMART | SM00284. OLF. 1 hit. [Graphical view] |
| SUPFAM | SSF50998. Quin_alc_DH_like. 1 hit. |
| PROSITE | PS00014. ER_TARGET. 1 hit. PS51132. OLF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20815612. |
Entry information
| Entry name | NOE1_CHICK | ||||||||
| Accession | Primary (citable) accession number: Q9IAK4 Secondary accession number(s): Q9I9K5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
