SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9IAK4

- NOE1_CHICK

UniProt

Q9IAK4 - NOE1_CHICK

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Noelin

Gene
OLFM1, NOEL, NOEL1
Organism
Gallus gallus (Chicken)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

May play an important role in regulating the production of neural crest cells by the neural tube.

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. protein oligomerization Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Pancortin
Gene namesi
Name:OLFM1
Synonyms:NOEL, NOEL1
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus
ProteomesiUP000000539: Chromosome 17

Subcellular locationi

Secreted Reviewed prediction. Cell junctionsynapse By similarity

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
  2. cell junction Source: UniProtKB-KW
  3. extracellular space Source: Ensembl
  4. synapse Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616 Reviewed predictionAdd
BLAST
Chaini17 – 485469NoelinPRO_0000020077Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...) Reviewed prediction
Glycosylationi103 – 1031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi187 – 1871N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi227 ↔ 409 By similarity
Glycosylationi288 – 2881N-linked (GlcNAc...) Reviewed prediction
Glycosylationi307 – 3071N-linked (GlcNAc...) Reviewed prediction
Glycosylationi394 – 3941N-linked (GlcNAc...) Reviewed prediction
Glycosylationi431 – 4311N-linked (GlcNAc...) Reviewed prediction
Glycosylationi473 – 4731N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9IAK4.

Expressioni

Developmental stagei

Expressed in a graded pattern in the closing neural tube. Subsequently becomes restricted to the dorsal neural folds and migrating neural crest.

Interactioni

Subunit structurei

Component of the AMPAR complex By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ9IAK4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini226 – 478253Olfactomedin-likeAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili87 – 225139 Reviewed predictionAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiNOG283888.
GeneTreeiENSGT00750000117256.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ9IAK4.
OMAiQILQTWN.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ9IAK4.
TreeFamiTF315964.

Family and domain databases

Gene3Di2.130.10.80. 2 hits.
InterProiIPR015916. Gal_Oxidase_b-propeller.
IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9IAK4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLTAA SGGTLDRSTG    50
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK 100
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMR GLESKFKQVE ESHKQHLARQ 150
FKAIKAKMEE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG 200
AYDYEELQNR VSNLEERLRA CMQKLACGKL TGISDPITIK TSGSRFGSWM 250
TDPLAPEGEN KVWYMDSYHN NRFVREYKSM ADFMNTDNFT SHRLPHPWSG 300
TGQVVYNGSI YFNKYQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG 350
GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPNTLQSL QTWNTSYPKR 400
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS 450
MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL 485
Length:485
Mass (Da):55,530
Last modified:October 1, 2000 - v1
Checksum:i7B6481EAA497A948
GO
Isoform 2 (identifier: Q9IAK4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLTAASGGTLDRSTG → MQPASKLLTLFFLILMGTELTQ

Show »
Length:457
Mass (Da):52,861
Checksum:i1AB805499306FE5B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MSVPL…DRSTG → MQPASKLLTLFFLILMGTEL TQ in isoform 2. VSP_003768Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF182815 mRNA. Translation: AAF40413.1.
AF239804 mRNA. Translation: AAF43715.1.
RefSeqiNP_990098.1. NM_204767.1. [Q9IAK4-1]
UniGeneiGga.3402.

Genome annotation databases

EnsembliENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. [Q9IAK4-1]
GeneIDi395535.
KEGGigga:395535.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF182815 mRNA. Translation: AAF40413.1 .
AF239804 mRNA. Translation: AAF43715.1 .
RefSeqi NP_990098.1. NM_204767.1. [Q9IAK4-1 ]
UniGenei Gga.3402.

3D structure databases

ProteinModelPortali Q9IAK4.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PaxDbi Q9IAK4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSGALT00000003964 ; ENSGALP00000003955 ; ENSGALG00000002515 . [Q9IAK4-1 ]
GeneIDi 395535.
KEGGi gga:395535.

Organism-specific databases

CTDi 10439.

Phylogenomic databases

eggNOGi NOG283888.
GeneTreei ENSGT00750000117256.
HOGENOMi HOG000232069.
HOVERGENi HBG006513.
InParanoidi Q9IAK4.
OMAi QILQTWN.
OrthoDBi EOG75F4CZ.
PhylomeDBi Q9IAK4.
TreeFami TF315964.

Miscellaneous databases

NextBioi 20815612.
PROi Q9IAK4.

Family and domain databases

Gene3Di 2.130.10.80. 2 hits.
InterProi IPR015916. Gal_Oxidase_b-propeller.
IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view ]
Pfami PF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view ]
SMARTi SM00284. OLF. 1 hit.
[Graphical view ]
SUPFAMi SSF50969. SSF50969. 2 hits.
PROSITEi PS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Noelin-1 is a secreted glycoprotein involved in generation of the neural crest."
    Barembaum M., Moreno T.A., LaBonne C., Sechrist J., Bronner-Fraser M.
    Nat. Cell Biol. 2:219-225(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).

Entry informationi

Entry nameiNOE1_CHICK
AccessioniPrimary (citable) accession number: Q9IAK4
Secondary accession number(s): Q9I9K5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: October 1, 2000
Last modified: May 14, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi