Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin

Gene

OLFM1

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Contributes to the regulation of axonal growth (By similarity). May play an important role in regulating the production of neural crest cells by the neural tube.By similarity1 Publication

GO - Biological processi

  • atrioventricular valve formation Source: AgBase
  • cardiac epithelial to mesenchymal transition Source: AgBase
  • negative regulation of gene expression Source: AgBase
  • neuronal signal transduction Source: UniProtKB
  • positive regulation of epithelial to mesenchymal transition Source: AgBase
  • positive regulation of gene expression Source: AgBase
  • regulation of axon extension Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Pancortin
Gene namesi
Name:OLFM1
Synonyms:NOEL, NOEL1
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Chromosome 17

Subcellular locationi

  • Secreted 1 Publication
  • Cell junctionsynapse By similarity
  • Endoplasmic reticulum By similarity
  • Cell projectionaxon By similarity
  • Perikaryon By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Endoplasmic reticulum, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000002007717 – 485NoelinAdd BLAST469

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi33N-linked (GlcNAc...)Sequence analysis1
Glycosylationi103N-linked (GlcNAc...)Sequence analysis1
Glycosylationi187N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi221InterchainBy similarity
Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
Glycosylationi288N-linked (GlcNAc...)Sequence analysis1
Glycosylationi307N-linked (GlcNAc...)Sequence analysis1
Glycosylationi394N-linked (GlcNAc...)Sequence analysis1
Glycosylationi431N-linked (GlcNAc...)Sequence analysis1
Glycosylationi473N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

Glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9IAK4.

Expressioni

Developmental stagei

Expressed in a graded pattern in the closing neural tube. Subsequently becomes restricted to the dorsal neural folds and migrating neural crest.1 Publication

Gene expression databases

BgeeiENSGALG00000002515.

Interactioni

Subunit structurei

Homotetramer; disulfide-linked. Dimer of dimers, giving rise to a V-shaped homotretramer. Component of the AMPAR complex.By similarity

Protein-protein interaction databases

STRINGi9031.ENSGALP00000003955.

Structurei

3D structure databases

ProteinModelPortaliQ9IAK4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini226 – 478Olfactomedin-likePROSITE-ProRule annotationAdd BLAST253

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili87 – 225Sequence analysisAdd BLAST139

Domaini

The protein contains a globular N-terminal tetramerization domain, a long stalk formed by the coiled coil region and a C-terminal olfactomedin-like domain. Interactions between dimers are mediated by the coiled coil region. The dimers interact mostly via the N-terminal tetramerization domain, giving rise to a V-shaped overall architecture of the tetramer.By similarity

Sequence similaritiesi

Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410INP4. Eukaryota.
ENOG41104PB. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ9IAK4.
OMAiQILQTWN.
OrthoDBiEOG091G05HN.
PhylomeDBiQ9IAK4.
TreeFamiTF315964.

Family and domain databases

Gene3Di2.130.10.80. 2 hits.
InterProiIPR015916. Gal_Oxidase_b-propeller.
IPR031217. Noelin.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PANTHERiPTHR23192:SF34. PTHR23192:SF34. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9IAK4-1) [UniParc]FASTAAdd to basket
Also known as: BMZ1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLTAA SGGTLDRSTG
60 70 80 90 100
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK
110 120 130 140 150
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMR GLESKFKQVE ESHKQHLARQ
160 170 180 190 200
FKAIKAKMEE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG
210 220 230 240 250
AYDYEELQNR VSNLEERLRA CMQKLACGKL TGISDPITIK TSGSRFGSWM
260 270 280 290 300
TDPLAPEGEN KVWYMDSYHN NRFVREYKSM ADFMNTDNFT SHRLPHPWSG
310 320 330 340 350
TGQVVYNGSI YFNKYQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG
360 370 380 390 400
GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPNTLQSL QTWNTSYPKR
410 420 430 440 450
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS
460 470 480
MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL
Length:485
Mass (Da):55,530
Last modified:October 1, 2000 - v1
Checksum:i7B6481EAA497A948
GO
Isoform 2 (identifier: Q9IAK4-2) [UniParc]FASTAAdd to basket
Also known as: AMZ1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLTAASGGTLDRSTG → MQPASKLLTLFFLILMGTELTQ

Show »
Length:457
Mass (Da):52,861
Checksum:i1AB805499306FE5B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0037681 – 50MSVPL…DRSTG → MQPASKLLTLFFLILMGTEL TQ in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF182815 mRNA. Translation: AAF40413.1.
AF239804 mRNA. Translation: AAF43715.1.
RefSeqiNP_990098.1. NM_204767.1. [Q9IAK4-1]
XP_015134803.1. XM_015279317.1. [Q9IAK4-2]
UniGeneiGga.3402.

Genome annotation databases

EnsembliENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. [Q9IAK4-1]
GeneIDi395535.
KEGGigga:395535.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF182815 mRNA. Translation: AAF40413.1.
AF239804 mRNA. Translation: AAF43715.1.
RefSeqiNP_990098.1. NM_204767.1. [Q9IAK4-1]
XP_015134803.1. XM_015279317.1. [Q9IAK4-2]
UniGeneiGga.3402.

3D structure databases

ProteinModelPortaliQ9IAK4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000003955.

Proteomic databases

PaxDbiQ9IAK4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. [Q9IAK4-1]
GeneIDi395535.
KEGGigga:395535.

Organism-specific databases

CTDi10439.

Phylogenomic databases

eggNOGiENOG410INP4. Eukaryota.
ENOG41104PB. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ9IAK4.
OMAiQILQTWN.
OrthoDBiEOG091G05HN.
PhylomeDBiQ9IAK4.
TreeFamiTF315964.

Miscellaneous databases

PROiQ9IAK4.

Gene expression databases

BgeeiENSGALG00000002515.

Family and domain databases

Gene3Di2.130.10.80. 2 hits.
InterProiIPR015916. Gal_Oxidase_b-propeller.
IPR031217. Noelin.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PANTHERiPTHR23192:SF34. PTHR23192:SF34. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNOE1_CHICK
AccessioniPrimary (citable) accession number: Q9IAK4
Secondary accession number(s): Q9I9K5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.