Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin

Gene

OLFM1

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

May play an important role in regulating the production of neural crest cells by the neural tube.

GO - Molecular functioni

  1. beta-amyloid binding Source: Ensembl

GO - Biological processi

  1. negative regulation of beta-amyloid formation Source: Ensembl
  2. negative regulation of neuron migration Source: Ensembl
  3. protein oligomerization Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Pancortin
Gene namesi
Name:OLFM1
Synonyms:NOEL, NOEL1
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
ProteomesiUP000000539: Chromosome 17

Subcellular locationi

Secreted Curated. Cell junctionsynapse By similarity

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
  2. cell junction Source: UniProtKB-KW
  3. extracellular space Source: Ensembl
  4. synapse Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence AnalysisAdd
BLAST
Chaini17 – 485469NoelinPRO_0000020077Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
Glycosylationi307 – 3071N-linked (GlcNAc...)Sequence Analysis
Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
Glycosylationi431 – 4311N-linked (GlcNAc...)Sequence Analysis
Glycosylationi473 – 4731N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9IAK4.

Expressioni

Developmental stagei

Expressed in a graded pattern in the closing neural tube. Subsequently becomes restricted to the dorsal neural folds and migrating neural crest.

Interactioni

Subunit structurei

Component of the AMPAR complex.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ9IAK4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini226 – 478253Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili87 – 225139Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiNOG283888.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ9IAK4.
OMAiMVDFMNT.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ9IAK4.
TreeFamiTF315964.

Family and domain databases

Gene3Di2.130.10.80. 2 hits.
InterProiIPR015916. Gal_Oxidase_b-propeller.
IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9IAK4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLTAA SGGTLDRSTG
60 70 80 90 100
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK
110 120 130 140 150
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMR GLESKFKQVE ESHKQHLARQ
160 170 180 190 200
FKAIKAKMEE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG
210 220 230 240 250
AYDYEELQNR VSNLEERLRA CMQKLACGKL TGISDPITIK TSGSRFGSWM
260 270 280 290 300
TDPLAPEGEN KVWYMDSYHN NRFVREYKSM ADFMNTDNFT SHRLPHPWSG
310 320 330 340 350
TGQVVYNGSI YFNKYQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG
360 370 380 390 400
GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPNTLQSL QTWNTSYPKR
410 420 430 440 450
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS
460 470 480
MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL
Length:485
Mass (Da):55,530
Last modified:October 1, 2000 - v1
Checksum:i7B6481EAA497A948
GO
Isoform 2 (identifier: Q9IAK4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLTAASGGTLDRSTG → MQPASKLLTLFFLILMGTELTQ

Show »
Length:457
Mass (Da):52,861
Checksum:i1AB805499306FE5B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MSVPL…DRSTG → MQPASKLLTLFFLILMGTEL TQ in isoform 2. 1 PublicationVSP_003768Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF182815 mRNA. Translation: AAF40413.1.
AF239804 mRNA. Translation: AAF43715.1.
RefSeqiNP_990098.1. NM_204767.1. [Q9IAK4-1]
UniGeneiGga.3402.

Genome annotation databases

EnsembliENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. [Q9IAK4-1]
GeneIDi395535.
KEGGigga:395535.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF182815 mRNA. Translation: AAF40413.1.
AF239804 mRNA. Translation: AAF43715.1.
RefSeqiNP_990098.1. NM_204767.1. [Q9IAK4-1]
UniGeneiGga.3402.

3D structure databases

ProteinModelPortaliQ9IAK4.
ModBaseiSearch...
MobiDBiSearch...

Proteomic databases

PaxDbiQ9IAK4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. [Q9IAK4-1]
GeneIDi395535.
KEGGigga:395535.

Organism-specific databases

CTDi10439.

Phylogenomic databases

eggNOGiNOG283888.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ9IAK4.
OMAiMVDFMNT.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ9IAK4.
TreeFamiTF315964.

Miscellaneous databases

NextBioi20815612.
PROiQ9IAK4.

Family and domain databases

Gene3Di2.130.10.80. 2 hits.
InterProiIPR015916. Gal_Oxidase_b-propeller.
IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Noelin-1 is a secreted glycoprotein involved in generation of the neural crest."
    Barembaum M., Moreno T.A., LaBonne C., Sechrist J., Bronner-Fraser M.
    Nat. Cell Biol. 2:219-225(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).

Entry informationi

Entry nameiNOE1_CHICK
AccessioniPrimary (citable) accession number: Q9IAK4
Secondary accession number(s): Q9I9K5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: October 1, 2000
Last modified: February 4, 2015
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.