Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9IAK4 (NOE1_CHICK) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Pancortin
Gene names
Name:OLFM1
Synonyms:NOEL, NOEL1
OrganismGallus gallus (Chicken) [Reference proteome]
Taxonomic identifier9031 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus

Protein attributes

Sequence length485 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May play an important role in regulating the production of neural crest cells by the neural tube.

Subunit structure

Component of the AMPAR complex By similarity.

Subcellular location

Secreted Potential. Cell junctionsynapse By similarity.

Developmental stage

Expressed in a graded pattern in the closing neural tube. Subsequently becomes restricted to the dorsal neural folds and migrating neural crest.

Post-translational modification

Glycosylated.

Sequence similarities

Contains 1 olfactomedin-like domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9IAK4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9IAK4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLTAASGGTLDRSTG → MQPASKLLTLFFLILMGTELTQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1616 Potential
Chain17 – 485469Noelin
PRO_0000020077

Regions

Domain226 – 478253Olfactomedin-like
Coiled coil87 – 225139 Potential

Amino acid modifications

Glycosylation331N-linked (GlcNAc...) Potential
Glycosylation1031N-linked (GlcNAc...) Potential
Glycosylation1871N-linked (GlcNAc...) Potential
Glycosylation2881N-linked (GlcNAc...) Potential
Glycosylation3071N-linked (GlcNAc...) Potential
Glycosylation3941N-linked (GlcNAc...) Potential
Glycosylation4311N-linked (GlcNAc...) Potential
Glycosylation4731N-linked (GlcNAc...) Potential
Disulfide bond227 ↔ 409 By similarity

Natural variations

Alternative sequence1 – 5050MSVPL…DRSTG → MQPASKLLTLFFLILMGTEL TQ in isoform 2.
VSP_003768

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 7B6481EAA497A948

FASTA48555,530
        10         20         30         40         50         60 
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLTAA SGGTLDRSTG VLPTNPEESW 

        70         80         90        100        110        120 
QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK VQNMSQSIEV LDRRTQRDLQ 

       130        140        150        160        170        180 
YVEKMENQMR GLESKFKQVE ESHKQHLARQ FKAIKAKMEE LRPLIPVLEE YKADAKLVLQ 

       190        200        210        220        230        240 
FKEEVQNLTS VLNELQEEIG AYDYEELQNR VSNLEERLRA CMQKLACGKL TGISDPITIK 

       250        260        270        280        290        300 
TSGSRFGSWM TDPLAPEGEN KVWYMDSYHN NRFVREYKSM ADFMNTDNFT SHRLPHPWSG 

       310        320        330        340        350        360 
TGQVVYNGSI YFNKYQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG GHSDIDLMVD 

       370        380        390        400        410        420 
ENGLWAVYAT NQNAGNIVIS KLDPNTLQSL QTWNTSYPKR SAGEAFIICG TLYVTNGYSG 

       430        440        450        460        470        480 
GTKVHYAYQT NASTYEYIDI PFQNKYSHIS MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI 


RSDEL 

« Hide

Isoform 2 [UniParc].

Checksum: 1AB805499306FE5B
Show »

FASTA45752,861

References

[1]"Noelin-1 is a secreted glycoprotein involved in generation of the neural crest."
Barembaum M., Moreno T.A., LaBonne C., Sechrist J., Bronner-Fraser M.
Nat. Cell Biol. 2:219-225(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF182815 mRNA. Translation: AAF40413.1.
AF239804 mRNA. Translation: AAF43715.1.
RefSeqNP_990098.1. NM_204767.1. [Q9IAK4-1]
UniGeneGga.3402.

3D structure databases

ProteinModelPortalQ9IAK4.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PaxDbQ9IAK4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSGALT00000003964; ENSGALP00000003955; ENSGALG00000002515. [Q9IAK4-1]
GeneID395535.
KEGGgga:395535.

Organism-specific databases

CTD10439.

Phylogenomic databases

eggNOGNOG283888.
GeneTreeENSGT00750000117256.
HOGENOMHOG000232069.
HOVERGENHBG006513.
InParanoidQ9IAK4.
OMAQILQTWN.
OrthoDBEOG75F4CZ.
PhylomeDBQ9IAK4.
TreeFamTF315964.

Family and domain databases

Gene3D2.130.10.80. 2 hits.
InterProIPR015916. Gal_Oxidase_b-propeller.
IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMSSF50969. SSF50969. 2 hits.
PROSITEPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20815612.
PROQ9IAK4.

Entry information

Entry nameNOE1_CHICK
AccessionPrimary (citable) accession number: Q9IAK4
Secondary accession number(s): Q9I9K5
Entry history
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: October 1, 2000
Last modified: May 14, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families