Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9I7U4

- TITIN_DROME

UniProt

Q9I7U4 - TITIN_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Titin

Gene

sls

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Key component in the assembly and functioning of adult and embryonic striated muscles and muscle tendons. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.6 Publications

GO - Molecular functioni

  1. actin binding Source: UniProtKB
  2. structural constituent of muscle Source: UniProtKB

GO - Biological processi

  1. locomotion Source: UniProtKB
  2. mesoderm development Source: FlyBase
  3. mitotic chromosome condensation Source: UniProtKB
  4. muscle attachment Source: UniProtKB
  5. muscle organ development Source: FlyBase
  6. myoblast fusion Source: UniProtKB
  7. regulation of hemocyte proliferation Source: FlyBase
  8. sarcomere organization Source: UniProtKB
  9. sister chromatid cohesion Source: UniProtKB
  10. skeletal muscle tissue development Source: UniProtKB
  11. somatic muscle development Source: BHF-UCL
  12. visceral muscle development Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Enzyme and pathway databases

SignaLinkiQ9I7U4.

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Titin
Alternative name(s):
D-Titin
Kettin
Gene namesi
Name:sls
Synonyms:titinImported
ORF Names:CG1915
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0086906. sls.

Subcellular locationi

Cytoplasm. Nucleus. Chromosome
Note: Uniformly distributed along condensed mitotic chromosomes.

GO - Cellular componenti

  1. condensed nuclear chromosome Source: UniProtKB
  2. I band Source: FlyBase
  3. microtubule associated complex Source: FlyBase
  4. sarcomere Source: UniProtKB
  5. striated muscle myosin thick filament Source: FlyBase
  6. Z disc Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Flies exhibit chromosome undercondensation, chromosome breakage, loss of diploidy, and premature sister chromatid separation. They also exhibit defects in myoblast fusion, muscle organization and gut morphogenesis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 1814118141TitinPRO_0000247656Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi393 ↔ 445PROSITE-ProRule annotation
Disulfide bondi1312 ↔ 1365PROSITE-ProRule annotation
Disulfide bondi1446 ↔ 1499PROSITE-ProRule annotation
Disulfide bondi1579 ↔ 1632PROSITE-ProRule annotation
Disulfide bondi1846 ↔ 1899PROSITE-ProRule annotation
Disulfide bondi2111 ↔ 2164PROSITE-ProRule annotation
Disulfide bondi2775 ↔ 2828PROSITE-ProRule annotation
Disulfide bondi3152 ↔ 3205PROSITE-ProRule annotation
Disulfide bondi3560 ↔ 3613PROSITE-ProRule annotation
Disulfide bondi3698 ↔ 3751PROSITE-ProRule annotation
Disulfide bondi3832 ↔ 3885PROSITE-ProRule annotation
Disulfide bondi3976 ↔ 4029PROSITE-ProRule annotation
Disulfide bondi4625 ↔ 4676PROSITE-ProRule annotation
Disulfide bondi6557 ↔ 6608PROSITE-ProRule annotation
Disulfide bondi6964 ↔ 7016PROSITE-ProRule annotation
Disulfide bondi16940 ↔ 16989PROSITE-ProRule annotation
Disulfide bondi17494 ↔ 17542PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ9I7U4.
PRIDEiQ9I7U4.

Expressioni

Tissue specificityi

Expressed in the mesoderm at stage 11, several hours before myoblast fusion, and persists in most muscle cells, somatic, visceral and pharyngeal muscles and their precursors, until the third instar. Also expressed in adult flight muscle Z-disks.6 Publications

Developmental stagei

Expressed both maternally and zygotically.1 Publication

Gene expression databases

BgeeiQ9I7U4.

Interactioni

Protein-protein interaction databases

BioGridi68776. 3 interactions.
IntActiQ9I7U4. 1 interaction.
MINTiMINT-1723019.

Structurei

3D structure databases

ProteinModelPortaliQ9I7U4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 17792Ig-like 1Sequence AnalysisAdd
BLAST
Domaini255 – 34389Ig-like 2Sequence AnalysisAdd
BLAST
Domaini372 – 46190Ig-like 3Sequence AnalysisAdd
BLAST
Domaini471 – 55989Ig-like 4Sequence AnalysisAdd
BLAST
Domaini618 – 70891Ig-like 5Sequence AnalysisAdd
BLAST
Domaini751 – 84292Ig-like 6Sequence AnalysisAdd
BLAST
Domaini890 – 98192Ig-like 7Sequence AnalysisAdd
BLAST
Domaini1024 – 111592Ig-like 8Sequence AnalysisAdd
BLAST
Domaini1158 – 124992Ig-like 9Sequence AnalysisAdd
BLAST
Domaini1291 – 138191Ig-like 10Sequence AnalysisAdd
BLAST
Domaini1424 – 151592Ig-like 11Sequence AnalysisAdd
BLAST
Domaini1558 – 164386Ig-like 12Sequence AnalysisAdd
BLAST
Domaini1691 – 178191Ig-like 13Sequence AnalysisAdd
BLAST
Domaini1824 – 191794Ig-like 14Sequence AnalysisAdd
BLAST
Domaini1958 – 205093Ig-like 15Sequence AnalysisAdd
BLAST
Domaini2089 – 218092Ig-like 16Sequence AnalysisAdd
BLAST
Domaini2222 – 231392Ig-like 17Sequence AnalysisAdd
BLAST
Domaini2356 – 244994Ig-like 18Sequence AnalysisAdd
BLAST
Domaini2488 – 258194Ig-like 19Sequence AnalysisAdd
BLAST
Domaini2622 – 271594Ig-like 20Sequence AnalysisAdd
BLAST
Domaini2754 – 284491Ig-like 21Sequence AnalysisAdd
BLAST
Domaini2891 – 298393Ig-like 22Sequence AnalysisAdd
BLAST
Domaini3029 – 311688Ig-like 23Sequence AnalysisAdd
BLAST
Domaini3130 – 322192Ig-like 24Sequence AnalysisAdd
BLAST
Domaini3263 – 335492Ig-like 25Sequence AnalysisAdd
BLAST
Domaini3401 – 349494Ig-like 26Sequence AnalysisAdd
BLAST
Domaini3539 – 362587Ig-like 27Sequence AnalysisAdd
BLAST
Domaini3676 – 376792Ig-like 28Sequence AnalysisAdd
BLAST
Domaini3811 – 390191Ig-like 29Sequence AnalysisAdd
BLAST
Repeati3910 – 394435TPR 1Sequence AnalysisAdd
BLAST
Domaini3954 – 404794Ig-like 30Sequence AnalysisAdd
BLAST
Domaini4092 – 418190Ig-like 31Sequence AnalysisAdd
BLAST
Domaini4394 – 448289Ig-like 32Sequence AnalysisAdd
BLAST
Repeati4403 – 443836TPR 2Sequence AnalysisAdd
BLAST
Domaini4497 – 458589Ig-like 33Sequence AnalysisAdd
BLAST
Domaini4604 – 469289Ig-like 34Sequence AnalysisAdd
BLAST
Domaini4703 – 479189Ig-like 35Sequence AnalysisAdd
BLAST
Repeati5575 – 561339TPR 3Sequence AnalysisAdd
BLAST
Domaini6536 – 662489Ig-like 36Sequence AnalysisAdd
BLAST
Domaini6633 – 672896Ig-like 37Sequence AnalysisAdd
BLAST
Domaini6741 – 683090Ig-like 38Sequence AnalysisAdd
BLAST
Domaini6841 – 692989Ig-like 39Sequence AnalysisAdd
BLAST
Domaini6942 – 703493Ig-like 40Sequence AnalysisAdd
BLAST
Domaini7066 – 715186Ig-like 41Sequence AnalysisAdd
BLAST
Domaini7189 – 727991Ig-like 42Sequence AnalysisAdd
BLAST
Repeati11872 – 1190534TPR 4Add
BLAST
Repeati13566 – 1359934TPR 5Add
BLAST
Repeati14904 – 1493633TPR 6Add
BLAST
Domaini16396 – 1647075SH3PROSITE-ProRule annotationAdd
BLAST
Domaini16501 – 1659090Ig-like 43Add
BLAST
Domaini16625 – 1671995Ig-like 44Add
BLAST
Domaini16728 – 1681184Ig-like 45Add
BLAST
Domaini16822 – 1691695Ig-like 46Add
BLAST
Domaini16919 – 1700183Ig-like 47Add
BLAST
Domaini17007 – 1709185Ig-like 48Add
BLAST
Domaini17097 – 1718084Ig-like 49Add
BLAST
Domaini17184 – 1727087Ig-like 50Add
BLAST
Domaini17277 – 1736387Ig-like 51Add
BLAST
Domaini17374 – 1746794Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini17473 – 1755886Ig-like 52Add
BLAST
Domaini17563 – 1765391Ig-like 53Add
BLAST
Domaini17660 – 1775596Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Repeati17694 – 1772835TPR 7Add
BLAST
Domaini17760 – 17861102Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini17862 – 1795897Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST
Domaini17982 – 1807897Fibronectin type-III 5PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili4204 – 422926Sequence AnalysisAdd
BLAST
Coiled coili7621 – 766343Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi2 – 6059Gln-richSequence AnalysisAdd
BLAST
Compositional biasi4979 – 5300322Gln-richSequence AnalysisAdd
BLAST
Compositional biasi5299 – 64161118Glu-richSequence AnalysisAdd
BLAST
Compositional biasi6294 – 631825Lys-richSequence AnalysisAdd
BLAST
Compositional biasi7346 – 7451106Glu-richSequence AnalysisAdd
BLAST
Compositional biasi9327 – 163567030Glu-richAdd
BLAST
Compositional biasi9386 – 113261941Lys-richAdd
BLAST
Compositional biasi11740 – 12109370Lys-richAdd
BLAST
Compositional biasi14784 – 15234451Lys-richAdd
BLAST
Compositional biasi17528 – 17651124Thr-richAdd
BLAST

Sequence similaritiesi

Contains 5 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 53 Ig-like (immunoglobulin-like) domains.Sequence Analysis
Contains 1 SH3 domain.PROSITE-ProRule annotation
Contains 7 TPR repeats.Sequence Analysis

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Repeat, SH3 domain, TPR repeat

Phylogenomic databases

eggNOGiNOG12793.
InParanoidiQ9I7U4.
OrthoDBiEOG7327MW.

Family and domain databases

Gene3Di2.60.40.10. 58 hits.
InterProiIPR010939. DUF1136.
IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF06582. DUF1136. 13 hits.
PF00041. fn3. 5 hits.
PF07679. I-set. 53 hits.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 5 hits.
SM00409. IG. 34 hits.
SM00408. IGc2. 15 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 3 hits.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50853. FN3. 5 hits.
PS50835. IG_LIKE. 51 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform C1 Publication (identifier: Q9I7U4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRQNPNPYQ QQNQQHQQVQ QFSSQEYSHS SQEQHQEQRI SRTEQHVQRS
60 70 80 90 100
QVTTQRQVQQ HHGGSIGGAY VPPSLTHVYA QGDISPPVFE QIFKNARFAQ
110 120 130 140 150
GGNALFEGRL RGNPKPFVTW TRKGAPLLES QKFRMSYNEA TGDVSLLINQ
160 170 180 190 200
IGPGDEGEYT CTARNQYGEA ICSVYIQPEG APMPALQPIQ NLEKNIYSNG
210 220 230 240 250
YSYTSIEEEF RVDTFEYRLL REVSFREAIT RRSGYEQDSQ LSQELDRNQG
260 270 280 290 300
PAQAPQISQK PRSSKLIEGS DAVFTARVGS NPKPRLTWFH NGQRLVASQK
310 320 330 340 350
YEISYSSGVA TLRVKNATAR DGGHYTLLAE NLQGCVVSSA VLAVEPAAET
360 370 380 390 400
AYEPKPVDVM AEQLEAGKAL PPAFVKAFGD REITEGRMTR FDCRVTGNPY
410 420 430 440 450
PEVFWLINGR QVRDDASHKI LVNESGSHSL MITNVTRLDA GAVQCLARNK
460 470 480 490 500
AGEVAIEAQL NVLEKEQVVA PQFVQRFSTM TVREGEPITM SANAIGTPQP
510 520 530 540 550
RITWQKDGVQ ISSTAERFVG IDGGATCLEI PRVTANDAGW YQCTAQNIAG
560 570 580 590 600
STANRARLYV EVPREQPNYE QRRLNLPRPT KVIEPEPIPG PEIIYLRHVE
610 620 630 640 650
RAKPHLRPGE EDRVYPPPQF IIPLQNVQQT EGGRVHMEAR IEPVGDPTMV
660 670 680 690 700
VEWYLNGRPL AASARATSVF KFGFIALDLL SIMGHDSGEY MCRVTNASGV
710 720 730 740 750
AESRAILSVV QRPSIEQSSQ NPNSLQYINQ LEDYSRYQRT ESIDEQLNQA
760 770 780 790 800
PQFIRPLRDL GEFEEGKNVH FEAQVTPVND PSMRVEWYKD GLPITASSRI
810 820 830 840 850
TAIFNFGYVS LNILHLRAED AGTYTVRAVN RIGEAISQSS IRVHSRSQVT
860 870 880 890 900
ADLGIPEQQR YIEKVEELED YRKSQQRRHV QEAAEAIAPP QFKTPIQNQL
910 920 930 940 950
DLREHAHAHF EARLEPVGDS TMRVEWLKDG QPLEASSRIT TYHNFGYVAL
960 970 980 990 1000
TIKQLTIYDA GTYTCRAYNA MGQDTTVAQL TVISKNEIVS ESQHPGGLQK
1010 1020 1030 1040 1050
IQHLEDSSRY GRREEEETYI TQAPRFLGPL KGTTKILEGQ RAHFEARVEP
1060 1070 1080 1090 1100
QSDLGLVIEW YHNGRSITAA NRIQTYYDFG YVALDISQVR AEDAGVYLVV
1110 1120 1130 1140 1150
ARNKLGEAQQ QATMIVETRS SIDTSSMHRG LYEKTQNLEN KPFVEPQYDI
1160 1170 1180 1190 1200
EEISKSKPVF VTPLSDPKPI HDGKNIHLEC RLEPMGDPTM RVEWFHNGRP
1210 1220 1230 1240 1250
VTVGSRFRTY YDFGFVALDI IKATAADSGE YTVRATNHLG TAHTSACVRV
1260 1270 1280 1290 1300
IDHTDVVTET QNEQSLEQIQ LLEDSRRRHH QEEDITIMQA PQFTRGLHNI
1310 1320 1330 1340 1350
ETIEGTNVHL ECRLQPVGDP SMRIEWFVNG KPVKTGHRFR PAYEFDYVAL
1360 1370 1380 1390 1400
DLLGCYAIDS GVYTCQARNQ LGEAVTSCSV RIIAKNDLIL ETQNESGLQK
1410 1420 1430 1440 1450
IQYLEDSTRH RRSEFVDEVV NIRPRFLTHP KSLTNTREGG HAHFECKIEP
1460 1470 1480 1490 1500
VTDPNLKVEW FKNGRPITVG HRFRPIHDFG YVALDIVHLI AEDSGVYTCR
1510 1520 1530 1540 1550
AVNLIGSDET QVELQCRSGE QIVTVTQNEA GLEQIHYLED RSRYTRREEI
1560 1570 1580 1590 1600
DESTKQAPVF TTSLKNVEIK ENQRAHFECR LIPVSDPSMR VEWYHNNLPL
1610 1620 1630 1640 1650
KSGSRFTETN NFGFVALDIM STLPEDAGTY TCRAYNAVGE AITSAVAVVH
1660 1670 1680 1690 1700
TKKSIYLESQ HETALPRLQH LEDGSKRQRI SVQDEFVSQA PVFTMPVRDV
1710 1720 1730 1740 1750
RVAENQAVHF EARLIPVGDP KLTVEWLRNG QPIEASNRTT TMHDFGYVAL
1760 1770 1780 1790 1800
NMKYVNPEDS GTYTCRAVNE LGQAVTSASL IVQSKTSIQL ETQHEAAMHK
1810 1820 1830 1840 1850
IHQLEDHSRY QRREEEEYTV TTAPVFVTKL IGPSNLVEGQ SAHYECRIEP
1860 1870 1880 1890 1900
YPDPNLKVEW FHNGKPLSTG HRFRTTYDFG FAALDILTVY AEDSGEYTCR
1910 1920 1930 1940 1950
VTNNLGEAIN SIVLNVTSRS SIIHETQHEE ALTKIQHLED TSRFQRKTDE
1960 1970 1980 1990 2000
EQFHAERPQF GRPLRNAKVN EGAPVHLEAT LIPVNDPTMK VEWYCNGRPI
2010 2020 2030 2040 2050
QTGHRFKTTY DFGFVALDIL YAHAEDTGTY MCKAKNAIGE AVTTCAVNVT
2060 2070 2080 2090 2100
ANKTLDLDTL DAQRLEKIRQ LETYAPPPKP VVEEKGQKPI FLTPLSNLEH
2110 2120 2130 2140 2150
LKEGEHAHLE CRVEPINDPN LKIEWFCNGK QLPTGHRYRT THDFGYVALD
2160 2170 2180 2190 2200
ILYVYGEDTG TYICKATNQL GEAVNTCNVR VLNRRSMILD TQHPDALEKI
2210 2220 2230 2240 2250
QKLESKVPNA RTEVGDAPIS PPHFTAELRG STEIYEGQTA HFEAQVAPVH
2260 2270 2280 2290 2300
DPNLRIEFYH NGKPLPSASR FHITFDFGYV SLDITHAVAE DAGEYSVRAV
2310 2320 2330 2340 2350
NALGQAVSST NLRVIPRGTI ISDTQHPEGL EKIRKLESTA PHQRQEPETP
2360 2370 2380 2390 2400
GTRQRPVFTQ PLQNIDRINE HQTAHFEARL IPVGDPNLKV EWYRNEKIIE
2410 2420 2430 2440 2450
DSSRITKQHD FGFVSLDISH IRKEDEGVYM CRAVNPLGEA VTTASMRVVS
2460 2470 2480 2490 2500
EASIQMDTQH PDSISRIHQL EKPLAPRPTE PERLFEKPIF TQLLTGPSEL
2510 2520 2530 2540 2550
WEGTHAHFEA RVVPVGDPSL KFEWFINGVE LQMGSRLRTT HDFGFVTLDI
2560 2570 2580 2590 2600
TAVVPEDAGV YMCRAYNAAG EAVSSTAMKV KTKSNIDGQP LIPESWEAIR
2610 2620 2630 2640 2650
LKEAAMNRVP EMFVDSTPQQ APVFTTHLQS YDKLHEGQHV LLEAQVEPRA
2660 2670 2680 2690 2700
DPNLRIEWFK NGISLTTGSR IRSTFDFGLV TLSINGLRAD DSAIYTCKAT
2710 2720 2730 2740 2750
NQVGEAVSTS SLKIEDRHWL QAESLHPDSL PRIGELEAPK EGRPEAPEPT
2760 2770 2780 2790 2800
YETPVFITHL NNIECKESDN VRFECNVEPA RDPTMSIEWF YNGQPLQAAA
2810 2820 2830 2840 2850
KFKSIYDFGY CALDLTNSYA ENSGVYTCKA TNSKGSATTS GTLKCTGGKT
2860 2870 2880 2890 2900
MFLDTQHPQG EAGLEAVQET EEELANRYTS KTTKPETQYP PPVWTKPLQA
2910 2920 2930 2940 2950
EFHLSEAQPI HLEANVEPKE DPNLFIEWYF NGKMLNHGSR FKMTSEFGFV
2960 2970 2980 2990 3000
TMDMIEVYAR DQGIYTCKAY NKAGEAFTST TIFCSSKENI IESTQHPKGA
3010 3020 3030 3040 3050
EGLEQIQDLE DSLRKDGSKP EQPDLGIPPR FTTEFVNIAD IGEGELAHFE
3060 3070 3080 3090 3100
ANLIPVGDQS MVIEWFYNGK VLEASHRVRT IYAFGTVALE VLGTKIEDTG
3110 3120 3130 3140 3150
TYTCRATNKH GTAEISCNLE CVDKPRGQKP RFTSHIQPLE GLKDGQSAHF
3160 3170 3180 3190 3200
ECTLIPVNDP DLKVEWYHNG KLMRHSNRIK TVSDFGYVVL DISYLQDHDS
3210 3220 3230 3240 3250
GEYVCRAWNK YGEDFTRTTL NCGGRGGVFY DSLQPDSLQR IRELECPQGQ
3260 3270 3280 3290 3300
QADTSAPLVA EPPKFITQIV DVTKLVEGQS AHFEARLTPI TDPDLVVEWY
3310 3320 3330 3340 3350
FNGKKLPHGH RFRTFHDFGI VILDILYCYE ENSGVYEARA RNKYGEDVTR
3360 3370 3380 3390 3400
ASLKCASKSS LILDSQLPRG MEGGLEKIAN LEYSMVRTRE ETTEETKGKA
3410 3420 3430 3440 3450
PVFTVPLENI ENLREGENAH FEARITPADD PKLKVEWYWN GRPLKAGSRF
3460 3470 3480 3490 3500
RTFCDFGFVI LEISPVYPED SGEYSCRAIN EYGEAVTTAT MKIQGKRSII
3510 3520 3530 3540 3550
MESQLPKGME GTIDRIAELE GLGSRSTEFV PDDDTGKPPE FITSPFDMVI
3560 3570 3580 3590 3600
GENALAHFEC RLQPINDPSM RVDWFHNGKA LWAGSRIKTI NDFGFVILEI
3610 3620 3630 3640 3650
AGCYQRDSGL YTCKATNKHG EATVSCKLQV KGRQGIVMEP QLPSNFRTGT
3660 3670 3680 3690 3700
ESLQKLEETM HKREELVTED EQPNPPKFTE EIKDNLDVPE GGPIHFDCRV
3710 3720 3730 3740 3750
EPVGDPTMRI EWFYNGHVMA TGSRVHQLND FGFIALDVDY IYARDSGEYT
3760 3770 3780 3790 3800
CRATNKWGTA TTSAKVTCKG KHNIVYESQL PEGMTSEKLK ELERGRIPEA
3810 3820 3830 3840 3850
PKVVEEVFGP PKFTTQITSV TVDEAEAVRF ECQVEPKTDP SLRVEWYRNG
3860 3870 3880 3890 3900
KPLPSGHRYR NIFDMGFVSL DILYVYGEDS GEYVCRAINN YGEDRTRATV
3910 3920 3930 3940 3950
SCKKLPTILL QNQVPRGMKR SDALTQMEAT IKKYTSEVHL TEDDLFDPDR
3960 3970 3980 3990 4000
KQPPRFVTQI KEQLTLTEMA VTKFECQLAP VGDPNMKVEW FFNGKPLLHK
4010 4020 4030 4040 4050
NRFQPIYDFG YVAMNFGWVY PEDSGEYVCR ATNLYGKDET RAIIKVSGKP
4060 4070 4080 4090 4100
GIVYDSQLPA HMQSIDRIRE MEASWQVVPD EVDPDAKPRT KPVFVSKLEP
4110 4120 4130 4140 4150
QTVEEGDPAR FCVRVTGHPR PRVMWLINGH TVVHGSRYKL TNDGMFHLDV
4160 4170 4180 4190 4200
PKTRQYDTGK VEVIARNSVG ESIATTELKV VARSDDYRNV LKNSPRPWYD
4210 4220 4230 4240 4250
YELAAYQKER QENELEKVFD ERKQVLSEQS SHTLKGVEHL KPKQYKPPTP
4260 4270 4280 4290 4300
DWQQNVKAKK SEDYYNKLQT LETEQLLKET NLRRDTHQYA IPGEKVVSSS
4310 4320 4330 4340 4350
QAKGMAQSYE ENLQEKTSTT EVQAAPPKGI AQPSESSVHG REVHMNKQQQ
4360 4370 4380 4390 4400
VQKEIQGDLE ITRKITATET TEVEHKGTIQ ERVVQGPVKP AKAPVFTKKI
4410 4420 4430 4440 4450
QPCRVFENEQ AKFEVEFEGE PNPTVKWYRE SFPIQNSPDL QIHTFSGKSI
4460 4470 4480 4490 4500
LIIRQVFVED SAVFSCVAEN RGGTAKCSAN LVVEERRRAG KGGIQPPSFV
4510 4520 4530 4540 4550
TTIQSTTVAT GQLARFDAKV TGTRPLDVYW LKNGMKIQPS IKFKMLEEDS
4560 4570 4580 4590 4600
VHTLLIIEPF AEDSGRYECV AVNAAGEARC DGDCIVQSPS KPEKPTTPGS
4610 4620 4630 4640 4650
EKAPHIVEQL KSQTVEEGSK VIFRCRVDGK PTPTARWMRG ENFVKPSRYF
4660 4670 4680 4690 4700
QMSRQGEYYQ LVISEAFPED EGTYKCVAEN KLGSIQTSAQ LKVRPIENLD
4710 4720 4730 4740 4750
APPTITALKD VSVTEGMPAQ FKTTVTGKVK ATSVQWFREG QLIPETPDFQ
4760 4770 4780 4790 4800
MIFDGNSAVL LIGTTYEEDS GIFTVRVTSS TGQVESSAKL TVKKRRISAF
4810 4820 4830 4840 4850
QLRTIDSAED ESSSSGREDS APESPHAFQP GQQPGQQFGQ FLGVNGQGQH
4860 4870 4880 4890 4900
QGRSRQKKPK VRSKSLQPAT KVIPWRKSSR PTRGRSLDKG VFLPGFKPEP
4910 4920 4930 4940 4950
VKSWTEETIN LKATPIEKKK PAPKLEAAKV VLKSIKTERD QGIMSLGATL
4960 4970 4980 4990 5000
EQIIAGKTEK EAIPWITMRE KLKAVESVQQ QLNKFDLDEV YLQPLEGQIE
5010 5020 5030 5040 5050
TEGQLPQQAQ VEQVQRTKEI QRLKSMESVE IMEMTDQIDK LITQQQNAKD
5060 5070 5080 5090 5100
LIPWKEMRQQ LKSVQRVTKQ IDKFKIEEVE LRHLQAQQAI TEEYQTGTAE
5110 5120 5130 5140 5150
ETVVMIDESS KGSISKVLRR DEQLQYEDQS NIYKQKFITT EDVNIMHVSE
5160 5170 5180 5190 5200
REKLEAQRLI REQQAVNWRQ QQQRPQLQPL TSVEDTVISQ TSERQKLVQQ
5210 5220 5230 5240 5250
QSFIEEAQRQ QFVQVEDSQM MSLEEYEHQK IINQRTQQEA FSWRQPREPQ
5260 5270 5280 5290 5300
KFIQVEDSTL LHLQERHDTQ EQQLLQQQPV MWDRGRKKPD QPQYVQPQEQ
5310 5320 5330 5340 5350
RVKEEFVEKP KTYEEMHDEL VEPTPIEQPQ PVPVMWERGK KKPQPQEKTF
5360 5370 5380 5390 5400
EEAHDELVEP TPVQQPEPVP VMWERGKKKV AQQETVLSQE VVQTSQVVEQ
5410 5420 5430 5440 5450
QIVEETKKTA VRRVIPPREP EQKVEQVTLK PTPRPRPKEA VKAEEIQLKP
5460 5470 5480 5490 5500
LRSTRPVPQP VEAEQKAYEE ATDELTEEPI PQPQPVMWER GKKKPQKPQE
5510 5520 5530 5540 5550
EVTEIPKTLE IAVDTLEEEV PKPTEPQPQP VLWARGQKKP QKPDEQKQEL
5560 5570 5580 5590 5600
PKSLEIAVDT IEEDLIKPVQ PEPQPVLWER KKKKPQPQDV IEEKLDVAPT
5610 5620 5630 5640 5650
KTYEKAVDVL PDEPKVEEKP EPVLWQRGKK KIPKSEPTEE VHPDEVDAQI
5660 5670 5680 5690 5700
ETVVKEDEMI VEEKRRIKKT KRPKSTKEVT EELFEEQPEE EISPEEEVPQ
5710 5720 5730 5740 5750
KEVIEEIEEI VEEKRRLKKT KKPKLTQQVT EEETPHEEII KESEEVVQEQ
5760 5770 5780 5790 5800
EEIVEEKKKV KKVKKPKTVA EKQLKEEEIP TEETVEEEET AEDQQLVVEE
5810 5820 5830 5840 5850
SKKVKKVKKP TGTVEKTDVE ELPGEEVPVE EVPVEEVPED VAPEEELIEE
5860 5870 5880 5890 5900
QEEIVDQDEI QEQKRKVKKA KKPKKTIEKT EIEIEEDQPE EEVLQEEIIG
5910 5920 5930 5940 5950
EQEEITERQR KVKSIKKPKK VVTEKTVDQT EQPEKPEESQ AEEVKETVTE
5960 5970 5980 5990 6000
EPKKPKPAPE EAKVEQVEKI SLKPAPRKQR LLPEKEQVEE VLLKPVKKIV
6010 6020 6030 6040 6050
AVSEAEQPET PETEFEVKEF AITTTEDILD VTKKRVKKKK PKTKVAAEES
6060 6070 6080 6090 6100
TEEPAEETEE FEEEATQPEE VQPVEEIPEE PQVKEVADER KTAPKPKPRK
6110 6120 6130 6140 6150
EEIIEKVEEV ALKRVTRPKK ELPQEATIEE VRLKPTQRTS IKPEEVKLEE
6160 6170 6180 6190 6200
VDLQHVEKKE DEIVQEEKRK TRKVKKPKHE DLPEIPDAEP TQLEEAEHIE
6210 6220 6230 6240 6250
LEKQPKPEED QPQVPWKRGE KKQPVEEVLE EKKWPSGKRR PLPEQQPEEV
6260 6270 6280 6290 6300
QLKPIPSKPI EEQQKPEKAI PGPQLVPEEK PESEEEELEL EPLKLPEDKK
6310 6320 6330 6340 6350
PKEPKAKKEK KKKPKLKKAT PSVDEVSEEV AEPFDEPIAE EDEVEEMPVD
6360 6370 6380 6390 6400
DVKVVAVSED VLPEEEVVPT EETPEAKQKA HKKRTKRLKE ASVEGQPQLL
6410 6420 6430 6440 6450
EAAIAEIEKV DEISQEISQK TITLLKKTED TRPQFITTEQ LIELDVEDVR
6460 6470 6480 6490 6500
RDLEMKVTSN IIKKEKRRVV LDDSQPLPEL ELITQKRIQE GIDKVADEEL
6510 6520 6530 6540 6550
IEDQQLIQNQ QETTTSEVIG QERKLVKKKK KEIKPPRITE KLRPRQCVPE
6560 6570 6580 6590 6600
EPTVLECKVE GVPFPEIKWY FNDILLFASE KYEITVMEQV AKLKIAKVTP
6610 6620 6630 6640 6650
SDVGVYTCEA KNEAGVATSR TNIILEKEQG VPPQFTKPLK IEFIEEKQPE
6660 6670 6680 6690 6700
RLKVTVTCQV TGKPNPEVKW YRGIEEVIPS ETVQMFYDEK TGDVALEVIN
6710 6720 6730 6740 6750
PTPNEAVVYS VQAQNQFGRA IGNANILSRV DEVPREILKA PTVTPLSAVV
6760 6770 6780 6790 6800
VPTGGTLFFE AKYDGLPRPE VKWMRNGREI IENEETIIET TETTTTIKVV
6810 6820 6830 6840 6850
NMTRKRTGKY EVWAKNKVGE AKSSGSVVVS DQKPDEQIKP PRFIQPLEPK
6860 6870 6880 6890 6900
YFGEHEVAII EAIVESEPLS SFQWFVHNEP IKSSNEVRIV SQANKSTLLI
6910 6920 6930 6940 6950
ENFQSKFVGP FTCRAENVGG SVTSTATVNL IPQEEAEEFE SPRFVEELVQ
6960 6970 6980 6990 7000
PVEVMDGEAL LLTCQVTGKP TPKVEWYHNA EKITENKETT ISQDLQGVCQ
7010 7020 7030 7040 7050
LQITEVFPEN EGQYECVATN KIGKSVSKTN VKIQAFEYIP DSEITGLTGS
7060 7070 7080 7090 7100
EEDLLDRTLS IDEQAPKIIK KLPEKIEPKE GEQAKLEVKV VGKPKPKVKW
7110 7120 7130 7140 7150
LRDDEQIFAS EEYQIENFED GTSVLVINHV YPDDLGTISF EAYNPLGVAV
7160 7170 7180 7190 7200
TTALFAVEGI VGSKDYRKPE WVSQMEEMQV ALKAAKCSPS LLNEMRDCRA
7210 7220 7230 7240 7250
ALGETAKFSI QFAGNPIPDI QWYFNNVQLR ASEKYRMVVQ EQEATLEIMK
7260 7270 7280 7290 7300
ITSEDCGYYN CKLINEIGMT MTRAKFDISS TSTIVEETKA KTTVKKKSGK
7310 7320 7330 7340 7350
KTMVKRSGAS ESQNVQKTEI RIIPTSAVET SMNVIKVKQP VSVLVEKSEI
7360 7370 7380 7390 7400
SEVLVVKDRE VADAEERSSQ LIEEIEEEEE IEEKVQHDEE DEVEVQVEQK
7410 7420 7430 7440 7450
ETYTSSKKIE ITKTVELIRT KISEKIITIE DVQVLSHHEE VQWLLESIEA
7460 7470 7480 7490 7500
ESFGQIGESA LRDLATIGLL LRYGCEHYEI TYMYEQNIFI SLKKPESQSA
7510 7520 7530 7540 7550
LVQLVEREGH EELISQILSE SSNEDETILA ATVGFKAFIR MIQTYEITIE
7560 7570 7580 7590 7600
IVIRKFVRED FISQDWKICG KERIVETSQI IESHEAITHV KIETATTKVE
7610 7620 7630 7640 7650
KLFKKQEQEH VQNLEQQEQV KIQVQTKQIA QMNTKIKKHK KHKQQEQEVS
7660 7670 7680 7690 7700
ETTIQCEQKE TLAHETSAEL PQSETLEQIE ESLSTYETLP IQNLSKDTLQ
7710 7720 7730 7740 7750
TVAVSVTTEL STPSPTASRV QEEILPQKVL AINEEVLPLD EFGLRKESPR
7760 7770 7780 7790 7800
PKENKLTENI EVRLKHALNV SHAKTAESSK ELPSKIPKSV KAQRKMKESR
7810 7820 7830 7840 7850
SLVVEAPNAE EAIEDLKPLK AVSQEVQSDI LFSHEITEEQ HQALETIEKL
7860 7870 7880 7890 7900
KPTSAIEDTV QQKLLSQEEL IIAEVLPSET VGRDVTDVRP PGETISPRLT
7910 7920 7930 7940 7950
PNMSLCITEC QPEDSIGEMQ QAAKERMETP SMSVTESKAV GGQELEVLEN
7960 7970 7980 7990 8000
VDHMPLITQP TKGLADYTIK AEEVPVQVQE IITFDSLERE TVAKTQTAKS
8010 8020 8030 8040 8050
NALELFELSE GLVSSTADSH SPIAEDLPIF EKDVKEATID MQMQHHVTTS
8060 8070 8080 8090 8100
ETVSNENAVK DLKAVDTPKM AEGTLGQSSA LTIGETQQMN LVETTVELIE
8110 8120 8130 8140 8150
PNVESTKPAK GALTEAYGTA ESNEETLLES LGLVPDDNRK IEQGKVNISE
8160 8170 8180 8190 8200
GEYVAKVQTT TVTDTEGEFV SVAPKLVNPK FDFVEQSALQ IKQDTTVEKE
8210 8220 8230 8240 8250
EILSSNIELA PQLATSNMFP AELKVTSIYE VQPGLTSSDI ITEQTKSVSA
8260 8270 8280 8290 8300
NQVFETMSIG VTSKPDMLES TSHIDAFQHP EFKTGDTILD ENQQPLEVTN
8310 8320 8330 8340 8350
VQITESSTDI IDVLPNQKLT KAETVTDGFK YAEGLVVLPM ESTIDKTEDT
8360 8370 8380 8390 8400
KPTAVNADIS MHQQFGTDVR EQEPLESTLT RTEDLKPQTQ TTESQFGLLQ
8410 8420 8430 8440 8450
SLETSSCVTL EGESVLSVKE RHPEQSAAIG TSSALQVANI TRPQHMESLD
8460 8470 8480 8490 8500
RLDEQKVPYY QANVNIGEIT LPNVEKIDSF DVLSDLNTPD YNKSSKGRVQ
8510 8520 8530 8540 8550
LIESTTSLKT TTAVVSESTE ELKDLNITQP VHIKPKPYES DQKISISEQT
8560 8570 8580 8590 8600
NVLEHVSSLN PVLPALETIQ SSIKSLHEIN VRETDILEKE ESLKDVDHIS
8610 8620 8630 8640 8650
GRLAKIILDC TTGIAQVRQE ETLEHEEDLK APLIPLEKAI PASSELHRLP
8660 8670 8680 8690 8700
LTEYVQEQQG TSDMTDFKVS NKCASPNIDH LYETKSSEMI VYDSSINSVD
8710 8720 8730 8740 8750
SEFPAGIVPQ KSLVPFRHTM VTENVAFNAS ENFEILSADQ QIATNVQDSL
8760 8770 8780 8790 8800
SQSIIAEDQI AFETEQNLGL ETTPTHKPKL LKDDQNLHAK LVDEATVYEA
8810 8820 8830 8840 8850
MGQEQKVDKY NIQQAEITHD LPQVYATDLQ QTFEAEKEIT TREQSYVAAT
8860 8870 8880 8890 8900
TDIIPSRLGL AMTTKTHPVE GIDVLLSSPP KPSLAQTNYE ETQHEVRVRE
8910 8920 8930 8940 8950
TQAIEESEEL TDGRLLPVSA VESIDSTFKV TSDSQQPPVF DKELSIPTVS
8960 8970 8980 8990 9000
PLEARAKPSL NLLQGTTTFD VIPLESSVLL KDTHVAVQKA QQEYVAQVES
9010 9020 9030 9040 9050
NKVHVQMDNL VMHKEDIFEN AEIENFCKPI TEGTQLETVV IEVVPIDNVG
9060 9070 9080 9090 9100
GIHLAPQPST LLATLTSTDI VNQSHVIDTQ VPLEMESEAQ APLDNIAQAR
9110 9120 9130 9140 9150
IKSAEDHVHT NVSEVNVYEQ TKAIQDQNKH GLFVKVSKNS DTSKAYLTTI
9160 9170 9180 9190 9200
QSTFLKEDIL PKPNILQDTA QAAADELQSL VTEEVVSVSS IQETYELKIP
9210 9220 9230 9240 9250
LQKTANLTQQ TPQNSVNVCQ QLAYEETPDI AFEPHALTRA TTSSVPTFLK
9260 9270 9280 9290 9300
PAENATVNIY ENIEGHGDFK PGTVNLTSNS NLNSELVVSV VQEVTSVPSL
9310 9320 9330 9340 9350
GSLATVEPQE LKAMPVTKSS TNLAYSEEVK GNKQEFTKIE TVEEDDKQPE
9360 9370 9380 9390 9400
TTVTVEELPY EEEKPEEIQE LPEEVCVVET VTEDGKPKKK KIRTRVIKKV
9410 9420 9430 9440 9450
KGDKQEVTKI ETVEEDDKQP ETTVTVEEVP YEEEKPEEIQ ELPEEVRVVE
9460 9470 9480 9490 9500
TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK IETVEEDDKQ PETTVTVEEV
9510 9520 9530 9540 9550
PYEEEKPEEI QELPEEVRVV ETVTEDGKPK KKKIRTRFIK KVKGDKQEVT
9560 9570 9580 9590 9600
KIETVEEDDK QPETTVTVEE VPYEEEKPEE IQELPEEVRV VETVTEDGKP
9610 9620 9630 9640 9650
KKKKIRTRVI KKVKGDKQEV TKIETVEEDD KQPETTVTVE EVPYEEEKPE
9660 9670 9680 9690 9700
EIQELPEEVR VVETVTEDGK PKKKKIRTRV IKKVKGDKQE VTKIETVEED
9710 9720 9730 9740 9750
DKQPETTVTV EEVPYEEEKP EEIQELPEEV RVVETVTEDG KPKKKKIRTR
9760 9770 9780 9790 9800
VIKKVKGDKQ EVTKIETVEE DDKQPETTVT VEEVPYEEEK PEEIQELPEE
9810 9820 9830 9840 9850
VRVVETVTED GKPKKKKIRT RVIKKVKGDK QEVTKIETAE EDDKQPETTV
9860 9870 9880 9890 9900
TVEEVPYEEE KPEEIQELPE EVRVVETVTE DGKPKKKKIR TRVIKKVKGD
9910 9920 9930 9940 9950
KQEVTKIETV EEDDKQPETT VTVEEVPYEE EKPEEIQELP EEVRVVETVT
9960 9970 9980 9990 10000
EDGKPKKKKI RTRVIKKVKG DKQEVTKIET VEEDDKQPET TVTVEEVPYE
10010 10020 10030 10040 10050
EEKPEEIQEL PEEVRVVETV TEDGKPKKKK IRTRVIKKVK GDKQEVTKIE
10060 10070 10080 10090 10100
TVEEDDKQPE TTVTVEEVPY EEEKPEEIQE LPEEVRVVET VTEDGKPKKK
10110 10120 10130 10140 10150
KIRTRVIKKV KGDKQEVTKI ETVEENDKQP ETTVTVEEVP YEEEKPEEIQ
10160 10170 10180 10190 10200
ELPEEVRVVE TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK IETVEEDDKQ
10210 10220 10230 10240 10250
PKTTVTVEEV PYEEEKPEEI QELPEEVRVV ETVTEDGKPK KKKIRTRVIK
10260 10270 10280 10290 10300
KVKGDNQEVT KIETVEEDDK QPETTVTVEE VPYEEEKPEE IQELPEEVRV
10310 10320 10330 10340 10350
VETVTEDGKP KKKKIRTRVI KKVKGDKQEV TKIETVEEDD KQPETTVTVE
10360 10370 10380 10390 10400
EVPYEEEKPE EIQELPEEVR VVETVTEDGK PKKKKIRTRV IKKVKGDMQE
10410 10420 10430 10440 10450
VTKIETVEED DKQPETTVTV EEVPYEEEKP EEIQELPEEV RVVETVTEDG
10460 10470 10480 10490 10500
KPKKKKIRTR VIKKVKGDKQ EVTKIETVEE DDKQPETTVT VEEVPYEEEK
10510 10520 10530 10540 10550
PEEIQELPEE VRVVETVTED GKPKKKKIRT RVIKKVKGDK QEVTKIETVE
10560 10570 10580 10590 10600
EDDKQPETTV TVEEVPYEEE KPEEIQELPE EVRVVETVTE DGKPKKKKIR
10610 10620 10630 10640 10650
TRVIKKVKGD KQEVTKIETV EEDDKQPETT VTVEEVPYEE EKPEEIQELP
10660 10670 10680 10690 10700
EEVRVVETVT EDGKPKKKKI RTRVIKKVKG DKQEVTKIET VEEDDKQPET
10710 10720 10730 10740 10750
TVTVEEVPYE EEKPEEIQEL PEEVRVVETV TEDGKPKKKK IRTRVIKKVK
10760 10770 10780 10790 10800
GDKQEVTKIE TVEEDDKQPE TTVTVEEVPY EEEKPEEIQE LPEEVRVVET
10810 10820 10830 10840 10850
VTEDGKPKKK KIRTRVIKKV KGDKQEVTKI ETVEEDDKQP ETTVTVEEVP
10860 10870 10880 10890 10900
YEEEKPEEIQ ELPEEVRVVE TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK
10910 10920 10930 10940 10950
IETVEEDDKQ PETTVTVEEV PYEEEKPEEI QELPEEVRVV ETVTEDGKPK
10960 10970 10980 10990 11000
KKKIRTRVIK KVKGDKQEVT KIETVEEDDK QPETTVTVEE VPYEVEKPDE
11010 11020 11030 11040 11050
IQELPEEVRV VETVTEDGKP KKKKIRTRVI KKVKGDKQEV TKIETVEEDD
11060 11070 11080 11090 11100
KQPETTVTVE EVPYEEEKPE EIQELPEEVR VVETVTEDGK PKKKKIRTRV
11110 11120 11130 11140 11150
IKKVKGDKQE VTKIETVEED DKQPETTVTV EEVPYEEEKP EEIQELPEEV
11160 11170 11180 11190 11200
RVVETVTEDG KPKKKKIRTR VIKKVKGDKQ EVTKIETVEE DDKQPETTVT
11210 11220 11230 11240 11250
VEEVPYEEEK PEEIQELPEE VRVVETVTED GKPKKKKIRT RVIKKVKGDK
11260 11270 11280 11290 11300
QEVTKIETVE EDDKQPETTV TVEEVPYEEE KPEEIQELPE EVRVVETVTE
11310 11320 11330 11340 11350
DGKPKKKKIR TRVIKKVKGD KQEVTKIETV EEDDKQPETT VTVEEVPYEE
11360 11370 11380 11390 11400
EKLEEIQELP EEVRVVETVT EDGKPKKKKI RTRVIKKVKG DKQEVTTIET
11410 11420 11430 11440 11450
VEEDDKKAET TVTVEETELS APSVGKVQLK KRVIVQKPED AVTVFELPER
11460 11470 11480 11490 11500
KSVILSEKED GTPTKTVIKT RIIKKIQGPN MEVTKVQTVE EYEKAPQTIV
11510 11520 11530 11540 11550
SVEKFNTPFP ELPEERLSEV VMLPDEVFES EAVDEEGRLK MIKTKKRIIR
11560 11570 11580 11590 11600
KPALDNTEEV TEIGIIEQDN VEPIYSVKIQ ERPLTESKPE DSKLIELPEH
11610 11620 11630 11640 11650
VTELNVILPD GKKKRRTVKS RAFKKSLDDD LDEVTTIHII EEEDKEPLTK
11660 11670 11680 11690 11700
VNIEVVPSDE ISITPIPIEE LPEETVFTEE LDENKKPKKK TTKTRTFKKR
11710 11720 11730 11740 11750
GPDDDEYFQI QTIDEEGKEP ISLIRVVSDE NIADIIDISK LDDEKVLKHK
11760 11770 11780 11790 11800
QKPHKHKDQY YKEYTITEPE EASADALQKP TKDKTPKQKK TLETPIEEVD
11810 11820 11830 11840 11850
ETVIIDEGTG EQTDQIAIKR KPRKVQGNVQ VEAVDEKPIE KKEKAKKKKV
11860 11870 11880 11890 11900
VKTKRDEMDD YIQFLIHQEI PKTVLQPYQR TEMELPQRAR RDSSFKQPVK
11910 11920 11930 11940 11950
LTPMKIEKVE FKKPKMVEIS SVVEFPQMLK LKAPKQRPQE EKKKKNEASF
11960 11970 11980 11990 12000
KNKKLKSWIR FVPYAPYCFP YVVTELETNR EVGELSRNVD EAEEVLKLRP
12010 12020 12030 12040 12050
KKFKHSKPEK AELEEADLGA YESDHSDKSN KELLHPKYKR GKKEKIETPD
12060 12070 12080 12090 12100
ESRKLKFGKG KVPQNEEASE EVNLKPVKLD IAEIEDAEMP VRTQEEEVVK
12110 12120 12130 12140 12150
KKKPKKSSKP EEGLQFEPIE FEEMERTSDI REESDTSVSV DTSTQEKPIY
12160 12170 12180 12190 12200
KKKKKVTPSP QKNQYKILPG QPREFEETPE DDLNLRKRQG ERPDDDKADT
12210 12220 12230 12240 12250
KLKPFYKFEV LDLEPEGVQA ETVPLSETIA KEPKKKRKIK VKTEQEDNTI
12260 12270 12280 12290 12300
EIVPLSPEDN DEQIFEITVT SSEIPQGDAK AKTIGKKKVK RMNKQELDDF
12310 12320 12330 12340 12350
VTELQEEPNQ EVYETRMSDF YEVKLTELPS EMDSDKPTKR ILRHEKGDEV
12360 12370 12380 12390 12400
QVLEIVESVV APGEEPFYEI NVISSANTEG DSEEITTDKI KKKSRKIKKD
12410 12420 12430 12440 12450
DLDAYIQQLI NAEIPVTELE KYEKIDVDGK AKKPKKLKAK TKKPIIDEGE
12460 12470 12480 12490 12500
TLQVGVTEHE PTKKLKTKKP EEKKNVIEKE LAEHEAVPEY DEFLINKTES
12510 12520 12530 12540 12550
ERPQEKRVEE TEKDIVPIVD KVLADLNDCL PFVVVEEDLK DMPLATDVIA
12560 12570 12580 12590 12600
LEDEKIIRKR KVRAKKDSKQ YEIEIIETEK PGDIPDEARV IVITTEVSGD
12610 12620 12630 12640 12650
TIDGPAPSTT EAPKKSVRKV KKEKLKEFIV NIVEEAPLDH VSEIYEDVLR
12660 12670 12680 12690 12700
TPFRESSEKE DIPSFTTTVV EDEIVNPVLP EKIKTVDDVR VPKDKKKKID
12710 12720 12730 12740 12750
NQKKIKISEF EPTPTSEDST IEEYTPKLSE HDEDLQTDEY SVDVKDSLPK
12760 12770 12780 12790 12800
SKKKSTKKQK KESLPGPISL YTIRIEETTP EPITEKIYED GKEVVRVINK
12810 12820 12830 12840 12850
RRIKKKAGPK EYLIEVIETY EDNNPEADVV IRTIETTPSI DSKPQEDHKI
12860 12870 12880 12890 12900
QVVQEKKPKT ESLDNYIQKL IDQEIPQVDH KEFKATVLET SPESKKAKKI
12910 12920 12930 12940 12950
KKHHKKTTEV IDGIPITVIE VTIQETETDD EDFKPDEVTL KEIDHENAEE
12960 12970 12980 12990 13000
APKVLKSKVS EEKPKSKKEK SLEFKIAEED KPKPVLEDIS EDVQVVQIIE
13010 13020 13030 13040 13050
EDGTPKQVEI KKKKVSRKHG PKEQVFEITE TKAIDEPLSE VTVVEITDEQ
13060 13070 13080 13090 13100
PQEEVLPAQE KKPIKKQKKL KPEDVNTYVV KVLEELTEPT QFETIPEDAD
13110 13120 13130 13140 13150
DKPQPVIEDI SENVQVVQII EEDGTPKQVE IKKKKVSPKH GPKEQVFEIT
13160 13170 13180 13190 13200
ETRPSDEPLA EVTIVELTEE GLNKDIVIPQ EKKTVKKPKK LKPEDIQSYV
13210 13220 13230 13240 13250
IRVLEEFNEP QWPASTEKPI IEDIAESIEI VPVTEEDGIT KEVEVKKKKV
13260 13270 13280 13290 13300
SRKQGTKNQV FEIIETKTSD EPLAEVTILE LSGDKSQEVT ILPKEKKPIK
13310 13320 13330 13340 13350
KTIKLKPEDV ESYVVNVLEE FCEPQSFESP EPTEGEAHET KTKTKKPKKP
13360 13370 13380 13390 13400
IVKAPENVIL IEEMAPETVI ENIVNEIGEE VKQVKTTKKL KKKEGPKEYL
13410 13420 13430 13440 13450
IEIKETYEEN KPEGDIEITT TELVPEGSPD ASDDQPVIVV QKIKKKKPVK
13460 13470 13480 13490 13500
DDLDKYIQQL IEQEITKTPL EEYEPTEMDS KKKPKKKVKS HNKKTIEVID
13510 13520 13530 13540 13550
GLPVTIHEFN VEDIVSEPED METPKTLLDE IKEIPQLPDD SSKYLVNISD
13560 13570 13580 13590 13600
EFGEADKPIK QPTQDQPIKK EKPLKKKKDV EYPVSLEAFD HTVKVVSEPT
13610 13620 13630 13640 13650
LEGTVKEVTV KKRKVSRRKG SKDHIFEITE TTSEDRPTAE VTVVELSSDE
13660 13670 13680 13690 13700
VLDSEEKPKH ERKIVKKPKQ LKKDDVEEYI INIIEEFIQP IPVGLVEDEV
13710 13720 13730 13740 13750
EKVQKEETKK PKKSPITYIA TEQEDNDNNY DALVKEDLDQ PIERALEKPS
13760 13770 13780 13790 13800
SPLEYTISVE EDSVGEEQKQ PKPKKISKPK SIKQPSVDKS PDYLVNVISE
13810 13820 13830 13840 13850
ESIIDEPIPE DYVVTEAAEE KPSEEPTFKV EELETEAVEK EVTDDDKGET
13860 13870 13880 13890 13900
TKQSVTKRKI KKLVGPKEEI IEIVETKTGD TPEYEVIVTT EEVQEKSKEA
13910 13920 13930 13940 13950
PEEKKAKTVR KAKKIPKDDL QDYIQKLIEQ DIPKTELEKY EKIDLDEPVK
13960 13970 13980 13990 14000
MKRKPIKKVK QSEEQPKEET EEPIEDKPVE KISEYSEVDS DEPKLTVAVK
14010 14020 14030 14040 14050
EFIPEKPEEK PFEIVVLEET VESKREPDEE GKVREKVVKT KKIKQNRGSV
14060 14070 14080 14090 14100
EVVHDIVEEI DTDTNESVIT VTTTVPTETP DQDQPSVKQK RTKKIKKDEV
14110 14120 14130 14140 14150
EDFVKRVIEE EAPQPEGSVD LVVIEDFVPK PSSEKRKKKP IKDKHTSVEE
14160 14170 14180 14190 14200
ETPHEDEVLL IESVPEDSPL SDDLITVVDS VPIEEEPENK VNQIEDTKKP
14210 14220 14230 14240 14250
EKKKKPKPSA KILEENVPED TVEKPLEALH TDSDLEKPDV QEFSISIKEE
14260 14270 14280 14290 14300
EQKHTHPEKK KSSKISSEQP KQPSTEQYEI SVTEHDLKPE EEKPFTVQVI
14310 14320 14330 14340 14350
QSETNVEETK DDTGKVHKQV TTKRMLRRPA GEGEIEIIEV VRDDQPEAEI
14360 14370 14380 14390 14400
TIVEYEPEPV NQDEKPKEPK KKTRKVKKDD IHDYIQKLIE LETPKTELEK
14410 14420 14430 14440 14450
YEKIEFEPIV KDKPLDSPID VLDESPKEVQ KKDKKSRSTK VPNEETPVQE
14460 14470 14480 14490 14500
QYAKVNVVEE EAPEQPEIPV QILEVKPVEV DVKEVITEDG KPVQEKTTKR
14510 14520 14530 14540 14550
VLKKIGPEEQ TTFKITMIES EDNDSVTVIV DEEPEIASPQ SIEEHPEQSK
14560 14570 14580 14590 14600
EKLAPKPKKT VRKVKKDDLS DYVKKLIEEE IPKVDLEKYE KVEMPEKPVK
14610 14620 14630 14640 14650
LTVSDSIPEE PKPDKSQPIS VLPDTTKPKK TKTPKTPKTE DTDQQVPDEP
14660 14670 14680 14690 14700
TETTVDTTDI PELTPTQTAQ PEDTATAQIT PSAQEEKSTQ DDTKDTIQKT
14710 14720 14730 14740 14750
VKHKKTKPDT QKSVETSELP EVHKDYQISI IHEELVEEEQ PEKILEVRVI
14760 14770 14780 14790 14800
DEVAEVEESQ PIVEEVEDEE PQPATEETVE DVTKPKSKKK KVVKKKTDDH
14810 14820 14830 14840 14850
DELIKKMLEQ EIEKTELEKY EKIEFDVPKK LKPEFAALEP IKIERKEQKP
14860 14870 14880 14890 14900
TKVTILDATD VPKTVKLKPS KRKEKPAEEL TVQLPKFRLK ARMVLVEYPP
14910 14920 14930 14940 14950
APLIPKTTDI GAIKDNGELS RNIEEAEEIL KFKPHKTKKI KKIKDDLEKV
14960 14970 14980 14990 15000
ELEKYEKYIS SEEEPEEKTP YKKPEKAPKP EEKQEDVKLK LGKGKKKPKE
15010 15020 15030 15040 15050
EEAPENVTLK NIPQKPQEVE EEVELKQKPK EVEIVEEQTK KPKDGEFVVE
15060 15070 15080 15090 15100
PFEPSEFDRP EYVPDELEQI EHPEIPEKVK KPSKTKYKPK DKSKSEPETI
15110 15120 15130 15140 15150
VSEIVAGVPK EEEAIPEQDV KFRKPERDAP EETDSEIKLR PVPQASKDEN
15160 15170 15180 15190 15200
PDEQALVTPK AEEPIPQEIE DKAIDDEKKP KKSKPKKVQP KEQEIAKEEP
15210 15220 15230 15240 15250
EEFEVSVKEE EALVDKPIEI EKPKDVKVKE KKPKEAPVSE VVVIEEEPKP
15260 15270 15280 15290 15300
EEVPEEIPVE YKITTTVLEP EDAPKEHQVK VIDFDERQET TEEVIEEKVV
15310 15320 15330 15340 15350
TRKKKPKPQQ PEEFEVTLKE PKEEQIQPDV VSAEISLPIE EPEQKPEQYE
15360 15370 15380 15390 15400
VELKITQTTP EEPNDVQIAV KEKVKTKPVK KVKEDKIVVV EAEEEKQPVE
15410 15420 15430 15440 15450
ETIVEVEKQE EKKKSEKPKS YEFKISETQS IEEKPIEVAE EAPEETPKVV
15460 15470 15480 15490 15500
EKKVAEKFDS YEFTLKETDE EKVITVDDQP EEEAPVEVVF KKKPKEPEAV
15510 15520 15530 15540 15550
EAEFVMTEPK IVEETSVETA IKQKKTKKPK KDEEEAQLAI KVVESEAPVA
15560 15570 15580 15590 15600
EEVFSEAPES KIVEEEVIAE EKPKEFTIRV SESEPKPEEP SVEQFTVKKR
15610 15620 15630 15640 15650
KPSVTFADEP ATEIVIKESK PAEVVTEDAH IKTKKPKKKV TDVEAEELKI
15660 15670 15680 15690 15700
KITEEVPQEI PILEEVSEEE VITETKKTAP VVEEKTYKIG IKETEPEKPA
15710 15720 15730 15740 15750
EAIVEEEEPV VTEPIEEAPK PEVFEEHKVR VIEETPRELV EEVIEEEVKV
15760 15770 15780 15790 15800
IRRKKPKPEI KEEPEAEVTV STPKPVEEVE ATSSIAVIPE QPTEEEAADL
15810 15820 15830 15840 15850
KITIIEEETP PQELVQEIEE IEIVEEPKAP EEQPTDFTFA TKDSEKKPTV
15860 15870 15880 15890 15900
EELPEEQVTI QKKKKKAPVP EVVEEPEAEF LVKPKTPVQE VTEEAKITKS
15910 15920 15930 15940 15950
KKPVKEEEAA AELKVTITEE IPTEPEVQEI IEEIEEIEEE KPAEYVIEVK
15960 15970 15980 15990 16000
ESQPEAVEDK EVSLPKKKPK APIVEEPEAE ITLKPKVKSE EVQEEAKIVK
16010 16020 16030 16040 16050
KKPKKIDEVA VADELTVKVE EEVVPEPIVE EEVIEEFEIK KKPKEPEPED
16060 16070 16080 16090 16100
IVDAAIVKLK KPEPVDADEV VAEVTLKPKA KTEVTEEEFS VDVKLPKEKK
16110 16120 16130 16140 16150
ERPVEIEEEE IIEEAVVIRK KPKKPFEPTV EDLEETEFSL SFKKPHTINE
16160 16170 16180 16190 16200
GVEEAATVLK KRPVKPTTLD EAAAELSIKR QEEEYEEGED IEEFVVSQQR
16210 16220 16230 16240 16250
KPKPLQITEE DEEAYTVKKL KRRKQVDIPE YADVENVTFR ARSTKTKEDV
16260 16270 16280 16290 16300
DQEFNIALDS YAEEEISMSG KVKLKKPIKK TFSEAADEAK IKIIQDFDDG
16310 16320 16330 16340 16350
EEPIIEEIRD DEDTIDEVEE PEEYFVEELP PDEVDFKLKP KKHPKPAYSV
16360 16370 16380 16390 16400
QDEEEEQFLI GIRHPKRDSV TYDEDSLTFK KKRKVVQQLF NEDGASLNIT
16410 16420 16430 16440 16450
REMNVEESEN LNIMYSICNY IADNNEAINL VEGEKVTVVG RHSSEWWYVK
16460 16470 16480 16490 16500
KSTTEEEGWV PAQYLMEPEE YAQYVQNKLH EKIDKLPVFE RPGPEDKPIA
16510 16520 16530 16540 16550
PRFIEKLQPI HTPDGYTVQF ECKVEGNPRP QIAWFRETAI IKPSQDFQMF
16560 16570 16580 16590 16600
YDDDNVATLI IREVFPEDAG QFTVVAKNAA GFTSSTTELI VESPLSDHGS
16610 16620 16630 16640 16650
DATALSRRSM SRESSLADIL EGIPPTFSKK PKAQYVDENT NVILECRLVA
16660 16670 16680 16690 16700
VPEPDIVWTF NGEDIDEEEI KNVRIVTESD MHMYCSVVHI SKVKKSQEGT
16710 16720 16730 16740 16750
YEVIATNREG EARLPITLKV RTTDKEAPQI LEPLRNMVIR EGESVVLSTQ
16760 16770 16780 16790 16800
IVGNPPPKVT WYKDGKPVKN AKSDKDLHTL TLITPQKSEK GEYTVKAVNP
16810 16820 16830 16840 16850
LGSVETTANL TIEEPAGGNA EPPLFVERFE EQNVPQKGEI RLPAKVSGNP
16860 16870 16880 16890 16900
VPEVQWLFNN TPLFPSERIQ QVYDGENIEL IIKDANPETD SGDYKCIASN
16910 16920 16930 16940 16950
PIGKTSHGAR VIVEVDEVTF TKKLKKTITI EEVQSLTLEC ETSHVVTTKW
16960 16970 16980 16990 17000
FFNGKELSGM DHRVVVEDGK THKLVIRNTN LRDSGTYTCK VKKQETQSTV
17010 17020 17030 17040 17050
EVLQRKPDFI KVLEDYEVTE KDTAILDVEL TTEATEVTWY KDGEKITPEN
17060 17070 17080 17090 17100
KNVEFIKDGK ARRLVIRDVT IHDEGQYTCK IEGQECSCEL VVIELPPEIV
17110 17120 17130 17140 17150
EPLNDVAVTK GENAVFEVEL SKGDALVKWF KNGKEIVFNE RIQLAIDGKK
17160 17170 17180 17190 17200
QSLRIVKAKP EDVGEYSVQV GEQTSKAKLT VEEPLVDFVI RLPDITLATK
17210 17220 17230 17240 17250
TTDAEFTVQL SQPDVEVTWC KKGKPIKPNQ KHEVFVEGTV RRLVIHDASD
17260 17270 17280 17290 17300
EDAGEISCVA ENVTSSTKLC VEELKLPPVI TSDKDQTIKV KENDDVTFTV
17310 17320 17330 17340 17350
KYTGVPTPEA CWTTRKVVIP KSKRTIPTID EQSAKLTIKK VVDDDEGEYT
17360 17370 17380 17390 17400
VKLVNPVGEA EASLHLVIMR KPTAPGTPQP LEIMHDSITL YWKAPEDDGK
17410 17420 17430 17440 17450
SEIIEYILEY QDVKEEKWTE IRKIKDTTYT ISKLKIDTEY VFRSIAVNEV
17460 17470 17480 17490 17500
GPSPPSPLSP PIRLVPKVET KAPSVQEPLQ DVVSELDKEV TLSCVFGGIP
17510 17520 17530 17540 17550
EPKVTWKKNG QVFESRSIRY ENRVAKYTIE KTTIETEATY TCVATNEKGS
17560 17570 17580 17590 17600
AETSCRLKLQ QKPVLEVEDK YLTQKLRTGS ILTIPATVRG YPQPTVTWHK
17610 17620 17630 17640 17650
ETIEQKTTKS VTIETTETTS TYTVKKVTRE QSGKYKVTAT NESGTTYVEC
17660 17670 17680 17690 17700
TVQVIDKPSR PQSLEIKDIK KDSIVLEWTP PVDDGGLDIE KYTLEKCDVQ
17710 17720 17730 17740 17750
NNVWMKVSDF NKDIKSYAVQ KLSMNAQYMF RVVAANPIGE SEPTESDPVT
17760 17770 17780 17790 17800
ITKKFEKPSP PRGPTTVSGM NDTSFNLAWE PSETDGGSKI IEYIVEIREE
17810 17820 17830 17840 17850
TETTYRSVGV TLGTVTNIHV EKVVRNKGYF FRIYARNEVG TSEAFETTEK
17860 17870 17880 17890 17900
IVLGRKITPP SPPQNLRAPD VTSRSVTLDW EVPARNGGSE ITGYCVEKRS
17910 17920 17930 17940 17950
STSTNWTKVI TLDAHQLHYT IDNLKEKCEY WFRVSAENEV GLGAPAVTES
17960 17970 17980 17990 18000
ISLKTHASEF ILVVRNCGSY TEFGFLKAVP SPPTGPLEAR VLAANAHIFE
18010 18020 18030 18040 18050
WGLPESDGGA PLLGYHIAIR DMKKTMWIEV GRVPAGVLKF QIRDLQENHE
18060 18070 18080 18090 18100
YMIRIFAKNE IGLSEPLESE EPYKAMTAGH ESLPDEPRTE MSSCNTSSWL
18110 18120 18130 18140
RDHHMDADIH SYARGRLLQR DEYFFRLWAE LPKSKKKKSS K

Note: No experimental confirmation available.Curated

Length:18,141
Mass (Da):2,065,766
Last modified:March 18, 2008 - v3
Checksum:i41CA5977EB611933
GO
Isoform A2 Publications (identifier: Q9I7U4-2) [UniParc]FASTAAdd to Basket

Also known as: KetImported

, KettinImported

The sequence of this isoform differs from the canonical sequence as follows:
     4794-4796: KRR → SKD
     4797-18074: Missing.

Show »
Length:4,863
Mass (Da):548,598
Checksum:iF39A3B9B7230A7E5
GO
Isoform B1 Publication (identifier: Q9I7U4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-57: QRQNPNPYQQ...QRSQVTTQRQ → NKVSSLYNDV...RSLSLLLALG
     586-663: EPIPGPEIIY...YLNGRPLAAS → G
     1106-1118: GEAQQQATMIVET → A
     4751-4753: MIF → QPG
     4754-4835: Missing.
     6626-6634: EKEQGVPPQ → GK
     7030-7213: Missing.
     7214-7218: GNPIP → NVKIQ
     7577-7592: TSQIIESHEAITHVKI → RSTLSLFNYITFT
     9111-9114: NVSE → NVSEVNVYEQTKAIQDQNKHGLFVKVSKNSDTSKAYLTTIQSTFLKEDILPKPNILQ
     9329-9525: VKGNKQEFTK...EVRVVETVTE → GGIPYVQITV...TRLIKKVKGN
     9526-11249: Missing.
     14333-14478: Missing.
     16100-16100: K → KTKLYSSRKRRSRRSPVEEAADELKLQQTVVE
     16492-16498: PGPEDKP → KLLPKQK
     16499-16573: Missing.
     17341-17344: VVDD → DVVS
     17345-17484: Missing.
     17686-18141: GLDIEKYTLE...PKSKKKKSSK → DEDEVKRSAE...TENEQDCICL

Show »
Length:17,970
Mass (Da):2,041,306
Checksum:iC16FBFC3C09569CA
GO
Isoform D1 Publication (identifier: Q9I7U4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     9335-11180: Missing.
     14438-14457: STKVPNEETPVQEQYAKVNV → TICKGQC

Show »
Length:16,282
Mass (Da):1,849,153
Checksum:i8419A8664D293917
GO
Isoform E1 Publication (identifier: Q9I7U4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     16100-16100: K → KVTEETSDQTVQLKKKKKPQKPVEEAADELKLQQTVVE

Show »
Length:18,178
Mass (Da):2,069,971
Checksum:i737C3E6C5D524D9B
GO

Sequence cautioni

The sequence AAM11102.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti7 – 71N → S in CAB76253. (PubMed:10669599)Curated
Sequence conflicti382 – 3821E → G in AAC23966. (PubMed:9548712)Curated
Sequence conflicti568 – 5681N → S in BAA90301. (PubMed:10629221)Curated
Sequence conflicti568 – 5681N → S in AAC23966. (PubMed:9548712)Curated
Sequence conflicti568 – 5681N → S(PubMed:10669599)Curated
Sequence conflicti722 – 7221P → S in CAB76253. (PubMed:10669599)Curated
Sequence conflicti875 – 8806QQRRHV → PASVVM in AAC23966. (PubMed:9548712)Curated
Sequence conflicti1059 – 10591E → G in CAB76253. (PubMed:10669599)Curated
Sequence conflicti1345 – 13451F → L in CAB76253. (PubMed:10669599)Curated
Sequence conflicti1405 – 14051E → G in BAA90301. (PubMed:10629221)Curated
Sequence conflicti1691 – 16922PV → NS in CAB76253. (PubMed:10669599)Curated
Sequence conflicti1779 – 17791S → P in CAB76253. (PubMed:10669599)Curated
Sequence conflicti1905 – 19051L → H in BAA90301. (PubMed:10629221)Curated
Sequence conflicti1905 – 19051L → H in CAB76253. (PubMed:10669599)Curated
Sequence conflicti1952 – 19521Q → H in CAB76253. (PubMed:10669599)Curated
Sequence conflicti2050 – 20501T → TVT in CAB76253. (PubMed:10669599)Curated
Sequence conflicti2104 – 21041G → R in CAB76253. (PubMed:10669599)Curated
Sequence conflicti2661 – 26611N → S in CAB76253. (PubMed:10669599)Curated
Sequence conflicti2934 – 29341M → V in CAB76253. (PubMed:10669599)Curated
Sequence conflicti3091 – 30944VLGT → EGVR in AAF61414. (PubMed:11062264)Curated
Sequence conflicti3091 – 30944VLGT → EGVR in AAG40155. (PubMed:11062264)Curated
Sequence conflicti3174 – 31741R → C in CAB76253. (PubMed:10669599)Curated
Sequence conflicti3174 – 31741R → C in CAA09971. (PubMed:9917396)Curated
Sequence conflicti3303 – 33031G → D in AAF61414. (PubMed:11062264)Curated
Sequence conflicti3303 – 33031G → D in AAG40155. (PubMed:11062264)Curated
Sequence conflicti3379 – 33813ANL → RGM in CAB76253. (PubMed:10669599)Curated
Sequence conflicti3500 – 35023IME → FMD in BAA90301. (PubMed:10629221)Curated
Sequence conflicti3526 – 35283STE → GTG in BAA90301. (PubMed:10629221)Curated
Sequence conflicti3592 – 35921D → E in CAB76253. (PubMed:10669599)Curated
Sequence conflicti3598 – 35992LE → PQ in CAB76253. (PubMed:10669599)Curated
Sequence conflicti3701 – 37011E → D in BAA90301. (PubMed:10629221)Curated
Sequence conflicti3857 – 38571H → N in BAA90301. (PubMed:10629221)Curated
Sequence conflicti3891 – 38911Y → H in BAA90301. (PubMed:10629221)Curated
Sequence conflicti3997 – 39971L → F in BAA90301. (PubMed:10629221)Curated
Sequence conflicti4130 – 41301H → Q in BAA90301. (PubMed:10629221)Curated
Sequence conflicti4229 – 42291Q → H in BAA90301. (PubMed:10629221)Curated
Sequence conflicti4330 – 43301I → T in BAA90301. (PubMed:10629221)Curated
Sequence conflicti4512 – 452918QLARF…PLDVY → SWLASMPRLQALAHWMCT in BAA90301. (PubMed:10629221)CuratedAdd
BLAST
Sequence conflicti6650 – 66501E → K in AAF62351. (PubMed:11062264)Curated
Sequence conflicti6650 – 66501E → K in AAF44704. (PubMed:11062264)Curated
Sequence conflicti7412 – 74121T → S in AAC23965. (PubMed:9548712)Curated
Sequence conflicti7450 – 74501A → T in AAC23965. (PubMed:9548712)Curated
Sequence conflicti7454 – 74541G → A in AAC23965. (PubMed:9548712)Curated
Sequence conflicti7525 – 75251D → G in AAC23965. (PubMed:9548712)Curated
Sequence conflicti7532 – 75321T → P in AAC23965. (PubMed:9548712)Curated
Sequence conflicti7537 – 75371A → P in CAB93524. (PubMed:10731132)Curated
Sequence conflicti7552 – 75521V → A in AAC23965. (PubMed:9548712)Curated
Sequence conflicti10456 – 104572KI → EF in AAC23963. (PubMed:9548712)Curated
Sequence conflicti11204 – 112074VPYE → LPFQ in CAB93524. (PubMed:10731132)Curated
Sequence conflicti11217 – 112171L → I in CAB93524. (PubMed:10731132)Curated
Sequence conflicti11444 – 114441V → T in AAC23964. (PubMed:9548712)Curated
Sequence conflicti11460 – 114612DG → KK in AAC23964. (PubMed:9548712)Curated
Sequence conflicti11863 – 118631Q → H in CAB93524. (PubMed:10731132)Curated
Sequence conflicti13709 – 137091K → T in CAB96531. (PubMed:10934048)Curated
Sequence conflicti13713 – 137153KSP → ESR in CAB96531. (PubMed:10934048)Curated
Sequence conflicti13723 – 137231Q → S in CAB96531. (PubMed:10934048)Curated
Sequence conflicti14433 – 144331D → K in AAM11102. (PubMed:12537569)Curated
Sequence conflicti14436 – 144361S → K in AAM11102. (PubMed:12537569)Curated
Sequence conflicti15987 – 159871V → A in CAB43739. (PubMed:10934048)Curated
Sequence conflicti17206 – 172061F → C in CAB93524. (PubMed:10731132)Curated
Sequence conflicti18065 – 180651E → R in CAB96427. (PubMed:10934048)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 5756QRQNP…TTQRQ → NKVSSLYNDVMNIFQSFIKL KMDINVVQERLKQEQRQKEQ RERDARDQAEREKAIKEAEA KERLHREEQSRLENQRQQAA IEQAQRELAARELALREQAV REEEARLQAIREQATREQLA REQAAREEELRIQSLRDIAR REEEVRLQNIRDEETRIRRE EEERIRRENESRSKREEEAR IQREEITRLQTLRDQVDQQR IVTENIRKDIQVNSIFTELR YASPLFTRPLKDAVSREGDR FVFECEVTGTPEPAVEWFKD GISIQTNSDYKTTFDKGICR LVIEETFAADSARFSCRASN LVGTCDTNATLSVRENAAEV QLVPPRILRFLQSGKATEGS SFQFACVVAGVPLPTVQWFK NDKCIDDSPDYVISYNNGEA TLKFEEVFLEDDAVYTCSAS NPAGIEHCSASLIVEPLEPT ELPSFKVPLSNAMARVGQKI KLEAIVGGIPRPEVYWLHNG KPFQPRDSKYEYGRVTLIIP QAYPNDAGSYVLSAKNLAGE AYTSCNVIVKGRLPNETSDS EMASDIEPIKPAVHLPLKDV SIFEGKPVRLDCVIVGQPEP EVIWYHNERPVKESADVQLL FQGDRCSLIIQEVYQEDAGH YKVVAINSAGEASSSCELKV TPLNQAEPATRAQAERQSLP KDSQPKFERLLSDVLADEGE QVVLEVQASGDQPLTAQWFL TNKELQLDQRITTQSDSELG VFKLILNNVSGDDKGVYTVK VTNPAGDAKCFSHLIVKSVN APENRRSSQSSVEIIERHQC PEFKELFSDKQGEIDEVIKF ECIVKGKPTPKVHWFFNDQP VHGHNFLVSTSGERQVLTIQ KLTHDAVGKISCVAENEAGK ATCVAFLNIRGSGLPASSDV QTVSQEHNTESSRVTIKKQT FTTTSTSQVNSYEGNAPQTE VHHSSAHIDQSLKQLGQQRP EIVESHHYQELHKSKEMSSP TVQQKSFSFIQSSGANGQSA VAIPDSPTRLRREIAPRFTT PLSGKIVDQGADVSMEAIYD GFPSPEIKVEKNGGQLFEDA HTRISNKCNRVTIELKQVGV GDAGRYAVTASNTVGQSTST ADLVVKKTIFPPVFGRRLQA QVSKKGEKLTMEVEVTGLPE PTVTWLKDDKPLKDAGISEH RLLAQGNSYRLIIEKAQTTD SGKYMVRATNAGGEAKSIAD CAILEPSPERLQEVVKTIVY ETGPVAPASEFKTEVQKQIQ NSENQQSYQNSQTEVTSAND LHGLSESKVITEHRCTTEAT MRLEHKSNYLDLPELTTRPK TPTTNDTITITTNTATVSMD QPDLTQPTITNTTTTNTTKV PPPVPPKPCTPVVATTFGQQ QQQPPQTLTSTRYEQSEHKS TTSSSSFDYFKKIDEETIIQ RPNPLTFKPLDTVVRQPQAQ SLAEELRSLNLIPGDAPEFC YSPKTERSEPKIPLITEKIK ILSEVQPKEPPPQGGVPVFP PPLGLQTVQHESTTTKEVKV EYGQPIVRPAAVLATPAQQN PRSPSPKPSAEGVAMSRLWT PTGVTGYTSDVEQKSEKTVI SKLATPTPTKELNAPFLVNQ IAKSIPPTTAPVTHLVNVEL EPGTPPEICFAPKVEETRRR SLVETMEQKLEQNLIQGPSK VLPHSVPTLTPNTAAPVQPK PLGNTTYRPPPPVLPTRLGV YESDYESDRYKYSGSESDVE PGIRKQPQLTTMETSFKSSG YTADTEEHSSYRKSESSFYE TKSSSTMGGAPQLQTQFPKL QPEPPAPIYFTAKPQPQVPP QVPPSQSNVSSQEAKVRIRS SLCLSVCRYYCRSLSLLLAL G in isoform B. 1 PublicationVSP_052098Add
BLAST
Alternative sequencei586 – 66378EPIPG…PLAAS → G in isoform B. 1 PublicationVSP_052099Add
BLAST
Alternative sequencei1106 – 111813GEAQQ…MIVET → A in isoform B. 1 PublicationVSP_052100Add
BLAST
Alternative sequencei4751 – 47533MIF → QPG in isoform B. 1 PublicationVSP_052101
Alternative sequencei4754 – 483582Missing in isoform B. 1 PublicationVSP_052102Add
BLAST
Alternative sequencei4794 – 47963KRR → SKD in isoform A. 2 PublicationsVSP_052103
Alternative sequencei4797 – 1807413278Missing in isoform A. 2 PublicationsVSP_052104Add
BLAST
Alternative sequencei6626 – 66349EKEQGVPPQ → GK in isoform B. 1 PublicationVSP_052105
Alternative sequencei7030 – 7213184Missing in isoform B. 1 PublicationVSP_052106Add
BLAST
Alternative sequencei7214 – 72185GNPIP → NVKIQ in isoform B. 1 PublicationVSP_052107
Alternative sequencei7577 – 759216TSQII…THVKI → RSTLSLFNYITFT in isoform B. 1 PublicationVSP_052108Add
BLAST
Alternative sequencei9111 – 91144NVSE → NVSEVNVYEQTKAIQDQNKH GLFVKVSKNSDTSKAYLTTI QSTFLKEDILPKPNILQ in isoform B. 1 PublicationVSP_052109
Alternative sequencei9329 – 9525197VKGNK…ETVTE → GGIPYVQITVEEAKLVNTRA DVEENITSVTTEQPNMCIAA SIQLPAIEEKKLENALQTPQ FASESILKTSPQISRNAHFE TRTHEEEYSTTTESLVTTQA LRDDIDSTQKNVMQDVQMYK HFATKSLDKTVKVETDTNQA TDTTHIKQKTPTHKLASSTT QITESPEIIKTIETISEDGS PSKKMIRTRLIKKVKGN in isoform B. CuratedVSP_052110Add
BLAST
Alternative sequencei9335 – 111801846Missing in isoform D. CuratedVSP_052111Add
BLAST
Alternative sequencei9526 – 112491724Missing in isoform B. CuratedVSP_052112Add
BLAST
Alternative sequencei14333 – 14478146Missing in isoform B. CuratedVSP_052113Add
BLAST
Alternative sequencei14438 – 1445720STKVP…AKVNV → TICKGQC in isoform D. CuratedVSP_052114Add
BLAST
Alternative sequencei16100 – 161001K → KTKLYSSRKRRSRRSPVEEA ADELKLQQTVVE in isoform B. CuratedVSP_052115
Alternative sequencei16100 – 161001K → KVTEETSDQTVQLKKKKKPQ KPVEEAADELKLQQTVVE in isoform E. CuratedVSP_052116
Alternative sequencei16492 – 164987PGPEDKP → KLLPKQK in isoform B. CuratedVSP_052117
Alternative sequencei16499 – 1657375Missing in isoform B. CuratedVSP_052118Add
BLAST
Alternative sequencei17341 – 173444VVDD → DVVS in isoform B. CuratedVSP_052119
Alternative sequencei17345 – 17484140Missing in isoform B. CuratedVSP_052120Add
BLAST
Alternative sequencei17686 – 18141456GLDIE…KKSSK → DEDEVKRSAENAWGKLLPHQ KKYFEVSMSQLCFYATVFTT PVDQVRPKETPVKRMLPAAR KKPKNQKKKAVPKWRYRSRK RPMAKPTPNPNNPAMSTAFI GFLREYQRRNTIVDVKKRLQ RAAKMWSKLSKAQKNKFRTA VSIAAYSLPSADFPPAPATC HLRRRFAWQHIGHVHRSITQ NCQSRAAPSLGDFSTLLTTP HWAKFQVLKVCNWIFQVQGN PFRSPLLTAHFYLLSFKKHT KLPGHLRGKFLQTGRIGLYL GFYNVGYSEQLRQFVCDEQL YVQIMAVVNLLASWLYLCFS HRWIYDQFVILLYVPLYIYF LILRRHLTKLLNECAGLHKS MQMIMGDRLCAKIHRECIYT LLLIIMSILRLLWQIRIYSV YQSIFIFGVAFIYHFELLFF GNYLIWLSCIFRSLNVFLAK DMRSDRLQILKGVLRQQTII WRVHRTVSRYFALHIISFMI QPGIKICIILKCSGIQMNAQ IISLILHLLLLGLFMIIASN LQKQHRTFQKSYIGLKDDPN YFVLKSWRLLQNRTLPQAFG VTFLRKREKVQYKQDVITML LRFSDSQQVYQQRANCCRFL PAVFITMILFLHKLFSYELQ KESKLVNLLQIEKRTLKSEI ELWNENLTSIYIFLTLVCSL VNKNELWKLINEAQLTYKQL KSLLGKHLVLKCSYDVLIHG LLLILLLAVMVVDIIFFNWP KASGERNTVTLTELHQIFDY LMGIPRLLFVLIMAMRILYH LISAGWLQCLGMLRLQRNLK LYQFQLRSIFYNQKCENILA GHYFKVSYMYFLWMMPFRIA ELMQFLKYDYDELVQKQKSQ EDLEDEAIWEGEENSRQQNL QELLMKPLLILSWHFALWML LLAAAYTQQKEYSTLMAKSW NFKSDENGCEMKEFLDEICW TGHAFKQLDILDLLVCTENE QDCICL in isoform B. CuratedVSP_052121Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB026845 mRNA. Translation: BAA90301.2.
AJ238575 Genomic DNA. Translation: CAB43710.1.
AJ238577 Genomic DNA. Translation: CAB43739.2.
AJ271740 Genomic DNA. Translation: CAB93524.1.
AJ400900 mRNA. Translation: CAB96426.1.
AJ400901 mRNA. Translation: CAB96427.1.
AJ400902 mRNA. Translation: CAB96531.1.
AE014296 Genomic DNA. Translation: AAF47604.1.
AF045775 mRNA. Translation: AAC23966.1.
AF045776 mRNA. Translation: AAC23965.1.
AF045777 mRNA. Translation: AAC23964.1.
AF045778 Genomic DNA. Translation: AAC23963.1.
AJ245406 Genomic DNA. Translation: CAB76253.1.
AJ012279 mRNA. Translation: CAA09970.1.
AJ012280 mRNA. Translation: CAA09971.1.
AF135062 mRNA. Translation: AAF61414.1.
AF135167 Transcribed RNA. Translation: AAF62351.1.
AF241648 mRNA. Translation: AAG40155.1.
AF241649 Genomic DNA. Translation: AAF44704.1.
BK000146 mRNA. Translation: DAA00021.1.
AY094749 mRNA. Translation: AAM11102.1. Different initiation.
PIRiS35341.
RefSeqiNP_524676.2. NM_079937.4.
UniGeneiDm.2974.

Genome annotation databases

GeneIDi44013.
KEGGidme:Dmel_CG1915.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB026845 mRNA. Translation: BAA90301.2 .
AJ238575 Genomic DNA. Translation: CAB43710.1 .
AJ238577 Genomic DNA. Translation: CAB43739.2 .
AJ271740 Genomic DNA. Translation: CAB93524.1 .
AJ400900 mRNA. Translation: CAB96426.1 .
AJ400901 mRNA. Translation: CAB96427.1 .
AJ400902 mRNA. Translation: CAB96531.1 .
AE014296 Genomic DNA. Translation: AAF47604.1 .
AF045775 mRNA. Translation: AAC23966.1 .
AF045776 mRNA. Translation: AAC23965.1 .
AF045777 mRNA. Translation: AAC23964.1 .
AF045778 Genomic DNA. Translation: AAC23963.1 .
AJ245406 Genomic DNA. Translation: CAB76253.1 .
AJ012279 mRNA. Translation: CAA09970.1 .
AJ012280 mRNA. Translation: CAA09971.1 .
AF135062 mRNA. Translation: AAF61414.1 .
AF135167 Transcribed RNA. Translation: AAF62351.1 .
AF241648 mRNA. Translation: AAG40155.1 .
AF241649 Genomic DNA. Translation: AAF44704.1 .
BK000146 mRNA. Translation: DAA00021.1 .
AY094749 mRNA. Translation: AAM11102.1 . Different initiation.
PIRi S35341.
RefSeqi NP_524676.2. NM_079937.4.
UniGenei Dm.2974.

3D structure databases

ProteinModelPortali Q9I7U4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 68776. 3 interactions.
IntActi Q9I7U4. 1 interaction.
MINTi MINT-1723019.

Protein family/group databases

MEROPSi I43.001.

Proteomic databases

PaxDbi Q9I7U4.
PRIDEi Q9I7U4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 44013.
KEGGi dme:Dmel_CG1915.

Organism-specific databases

CTDi 44013.
FlyBasei FBgn0086906. sls.

Phylogenomic databases

eggNOGi NOG12793.
InParanoidi Q9I7U4.
OrthoDBi EOG7327MW.

Enzyme and pathway databases

SignaLinki Q9I7U4.

Miscellaneous databases

ChiTaRSi SLS. drosophila.
GenomeRNAii 44013.
NextBioi 836598.

Gene expression databases

Bgeei Q9I7U4.

Family and domain databases

Gene3Di 2.60.40.10. 58 hits.
InterProi IPR010939. DUF1136.
IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF06582. DUF1136. 13 hits.
PF00041. fn3. 5 hits.
PF07679. I-set. 53 hits.
PF00018. SH3_1. 1 hit.
[Graphical view ]
SMARTi SM00060. FN3. 5 hits.
SM00409. IG. 34 hits.
SM00408. IGc2. 15 hits.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 3 hits.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50853. FN3. 5 hits.
PS50835. IG_LIKE. 51 hits.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Requirements of Kettin, a giant muscle protein highly conserved in overall structure in evolution, for normal muscle function, viability, and flight activity of Drosophila."
    Hakeda S., Endo S., Saigo K.
    J. Cell Biol. 148:101-114(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, TISSUE SPECIFICITY.
  2. "Drosophila D-titin is required for myoblast fusion and skeletal muscle striation."
    Zhang Y., Featherstone D., Davis W., Rushton E., Broadie K.
    J. Cell Sci. 113:3103-3115(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM D), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-187, NUCLEOTIDE SEQUENCE [MRNA] OF 4789-4963 AND 13411-13939 (ISOFORMS B/C/D/E), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 15913-16691 (ISOFORM E), NUCLEOTIDE SEQUENCE [MRNA] OF 18064-18141 (ISOFORMS C/D/E), FUNCTION, TISSUE SPECIFICITY.
    Strain: Berkeley1 Publication and Oregon-R.
    Tissue: EmbryoImported, LarvaImported and Ovary1 Publication.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley1 Publication.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING (ISOFORMS A AND C).
    Strain: Berkeley.
  5. "Human autoantibodies reveal titin as a chromosomal protein."
    Machado C., Sunkel C.E., Andrew D.J.
    J. Cell Biol. 141:321-333(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-880 (ISOFORMS A/C/D/E), NUCLEOTIDE SEQUENCE [MRNA] OF 7219-7572 (ISOFORMS B/C/D/E), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10456-10723, NUCLEOTIDE SEQUENCE [MRNA] OF 11358-11461 (ISOFORMS B/C/D/E), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  6. "Sequence and expression of the kettin gene in Drosophila melanogaster and Caenorhabditis elegans."
    Kolmerer B., Clayton J., Benes V., Allen T., Ferguson C., Leonard K., Weber U., Knekt M., Ansorge W., Labeit S., Bullard B.
    J. Mol. Biol. 296:435-448(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3999, FUNCTION, TISSUE SPECIFICITY.
    Strain: Berkeley1 Publication.
  7. "Association of kettin with actin in the Z-disc of insect flight muscle."
    van Straaten M., Goulding D., Kolmerer B., Labeit S., Clayton J., Leonard K., Bullard B.
    J. Mol. Biol. 285:1549-1562(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 371-500 AND 3126-3354, ACTIN-BINDING, SUBCELLULAR LOCATION.
  8. "Kettin, a large modular protein in the Z-disc of insect muscles."
    Lakey A., Labeit S., Gautel M., Ferguson C., Barlow D., Leonard K., Bullard B.
    EMBO J. 12:2863-2871(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1691-2214, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  9. "D-Titin: a giant protein with dual roles in chromosomes and muscles."
    Machado C., Andrew D.J.
    J. Cell Biol. 151:639-652(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3091-3407, NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 6635-7000, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, IDENTIFICATION (ISOFORMS A AND B), DEVELOPMENTAL STAGE, DISRUPTION PHENOTYPE.
    Tissue: MuscleImported.
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 13581-14436 (ISOFORMS B/C/D/E).
    Strain: Berkeley1 Publication.
    Tissue: Ovary1 Publication.

Entry informationi

Entry nameiTITIN_DROME
AccessioniPrimary (citable) accession number: Q9I7U4
Secondary accession number(s): O76275
, O76276, O76277, O76278, O96767, O96768, Q7KA82, Q7KAJ1, Q7KPQ8, Q7RTL4, Q8T3N3, Q9N2P7, Q9N680, Q9N9Y5, Q9N9Y6, Q9N9Y7, Q9NFS3, Q9NJP4, Q9NL88, Q9UB79, Q9W055, Q9XZT9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 18, 2008
Last modified: October 29, 2014
This is version 112 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3