Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9I7U4

- TITIN_DROME

UniProt

Q9I7U4 - TITIN_DROME

Protein

Titin

Gene

sls

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 3 (18 Mar 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Key component in the assembly and functioning of adult and embryonic striated muscles and muscle tendons. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.6 Publications

    GO - Molecular functioni

    1. actin binding Source: UniProtKB
    2. structural constituent of muscle Source: UniProtKB

    GO - Biological processi

    1. locomotion Source: UniProtKB
    2. mesoderm development Source: FlyBase
    3. mitotic chromosome condensation Source: UniProtKB
    4. muscle attachment Source: UniProtKB
    5. muscle organ development Source: FlyBase
    6. myoblast fusion Source: UniProtKB
    7. regulation of hemocyte proliferation Source: FlyBase
    8. sarcomere organization Source: UniProtKB
    9. sister chromatid cohesion Source: UniProtKB
    10. skeletal muscle tissue development Source: UniProtKB
    11. somatic muscle development Source: BHF-UCL
    12. visceral muscle development Source: BHF-UCL

    Keywords - Biological processi

    Cell cycle, Cell division, Mitosis

    Enzyme and pathway databases

    SignaLinkiQ9I7U4.

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Titin
    Alternative name(s):
    D-Titin
    Kettin
    Gene namesi
    Name:sls
    Synonyms:titinImported
    ORF Names:CG1915
    OrganismiDrosophila melanogaster (Fruit fly)
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome 3L

    Organism-specific databases

    FlyBaseiFBgn0086906. sls.

    Subcellular locationi

    Cytoplasm. Nucleus. Chromosome
    Note: Uniformly distributed along condensed mitotic chromosomes.

    GO - Cellular componenti

    1. condensed nuclear chromosome Source: UniProtKB
    2. microtubule associated complex Source: FlyBase
    3. sarcomere Source: UniProtKB
    4. Z disc Source: UniProtKB

    Keywords - Cellular componenti

    Chromosome, Cytoplasm, Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Flies exhibit chromosome undercondensation, chromosome breakage, loss of diploidy, and premature sister chromatid separation. They also exhibit defects in myoblast fusion, muscle organization and gut morphogenesis.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 1814118141TitinPRO_0000247656Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi393 ↔ 445PROSITE-ProRule annotation
    Disulfide bondi1312 ↔ 1365PROSITE-ProRule annotation
    Disulfide bondi1446 ↔ 1499PROSITE-ProRule annotation
    Disulfide bondi1579 ↔ 1632PROSITE-ProRule annotation
    Disulfide bondi1846 ↔ 1899PROSITE-ProRule annotation
    Disulfide bondi2111 ↔ 2164PROSITE-ProRule annotation
    Disulfide bondi2775 ↔ 2828PROSITE-ProRule annotation
    Disulfide bondi3152 ↔ 3205PROSITE-ProRule annotation
    Disulfide bondi3560 ↔ 3613PROSITE-ProRule annotation
    Disulfide bondi3698 ↔ 3751PROSITE-ProRule annotation
    Disulfide bondi3832 ↔ 3885PROSITE-ProRule annotation
    Disulfide bondi3976 ↔ 4029PROSITE-ProRule annotation
    Disulfide bondi4625 ↔ 4676PROSITE-ProRule annotation
    Disulfide bondi6557 ↔ 6608PROSITE-ProRule annotation
    Disulfide bondi6964 ↔ 7016PROSITE-ProRule annotation
    Disulfide bondi16940 ↔ 16989PROSITE-ProRule annotation
    Disulfide bondi17494 ↔ 17542PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiQ9I7U4.
    PRIDEiQ9I7U4.

    Expressioni

    Tissue specificityi

    Expressed in the mesoderm at stage 11, several hours before myoblast fusion, and persists in most muscle cells, somatic, visceral and pharyngeal muscles and their precursors, until the third instar. Also expressed in adult flight muscle Z-disks.6 Publications

    Developmental stagei

    Expressed both maternally and zygotically.1 Publication

    Gene expression databases

    BgeeiQ9I7U4.

    Interactioni

    Protein-protein interaction databases

    BioGridi68776. 3 interactions.
    IntActiQ9I7U4. 1 interaction.
    MINTiMINT-1723019.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9I7U4.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini86 – 17792Ig-like 1Sequence AnalysisAdd
    BLAST
    Domaini255 – 34389Ig-like 2Sequence AnalysisAdd
    BLAST
    Domaini372 – 46190Ig-like 3Sequence AnalysisAdd
    BLAST
    Domaini471 – 55989Ig-like 4Sequence AnalysisAdd
    BLAST
    Domaini618 – 70891Ig-like 5Sequence AnalysisAdd
    BLAST
    Domaini751 – 84292Ig-like 6Sequence AnalysisAdd
    BLAST
    Domaini890 – 98192Ig-like 7Sequence AnalysisAdd
    BLAST
    Domaini1024 – 111592Ig-like 8Sequence AnalysisAdd
    BLAST
    Domaini1158 – 124992Ig-like 9Sequence AnalysisAdd
    BLAST
    Domaini1291 – 138191Ig-like 10Sequence AnalysisAdd
    BLAST
    Domaini1424 – 151592Ig-like 11Sequence AnalysisAdd
    BLAST
    Domaini1558 – 164386Ig-like 12Sequence AnalysisAdd
    BLAST
    Domaini1691 – 178191Ig-like 13Sequence AnalysisAdd
    BLAST
    Domaini1824 – 191794Ig-like 14Sequence AnalysisAdd
    BLAST
    Domaini1958 – 205093Ig-like 15Sequence AnalysisAdd
    BLAST
    Domaini2089 – 218092Ig-like 16Sequence AnalysisAdd
    BLAST
    Domaini2222 – 231392Ig-like 17Sequence AnalysisAdd
    BLAST
    Domaini2356 – 244994Ig-like 18Sequence AnalysisAdd
    BLAST
    Domaini2488 – 258194Ig-like 19Sequence AnalysisAdd
    BLAST
    Domaini2622 – 271594Ig-like 20Sequence AnalysisAdd
    BLAST
    Domaini2754 – 284491Ig-like 21Sequence AnalysisAdd
    BLAST
    Domaini2891 – 298393Ig-like 22Sequence AnalysisAdd
    BLAST
    Domaini3029 – 311688Ig-like 23Sequence AnalysisAdd
    BLAST
    Domaini3130 – 322192Ig-like 24Sequence AnalysisAdd
    BLAST
    Domaini3263 – 335492Ig-like 25Sequence AnalysisAdd
    BLAST
    Domaini3401 – 349494Ig-like 26Sequence AnalysisAdd
    BLAST
    Domaini3539 – 362587Ig-like 27Sequence AnalysisAdd
    BLAST
    Domaini3676 – 376792Ig-like 28Sequence AnalysisAdd
    BLAST
    Domaini3811 – 390191Ig-like 29Sequence AnalysisAdd
    BLAST
    Repeati3910 – 394435TPR 1Sequence AnalysisAdd
    BLAST
    Domaini3954 – 404794Ig-like 30Sequence AnalysisAdd
    BLAST
    Domaini4092 – 418190Ig-like 31Sequence AnalysisAdd
    BLAST
    Domaini4394 – 448289Ig-like 32Sequence AnalysisAdd
    BLAST
    Repeati4403 – 443836TPR 2Sequence AnalysisAdd
    BLAST
    Domaini4497 – 458589Ig-like 33Sequence AnalysisAdd
    BLAST
    Domaini4604 – 469289Ig-like 34Sequence AnalysisAdd
    BLAST
    Domaini4703 – 479189Ig-like 35Sequence AnalysisAdd
    BLAST
    Repeati5575 – 561339TPR 3Sequence AnalysisAdd
    BLAST
    Domaini6536 – 662489Ig-like 36Sequence AnalysisAdd
    BLAST
    Domaini6633 – 672896Ig-like 37Sequence AnalysisAdd
    BLAST
    Domaini6741 – 683090Ig-like 38Sequence AnalysisAdd
    BLAST
    Domaini6841 – 692989Ig-like 39Sequence AnalysisAdd
    BLAST
    Domaini6942 – 703493Ig-like 40Sequence AnalysisAdd
    BLAST
    Domaini7066 – 715186Ig-like 41Sequence AnalysisAdd
    BLAST
    Domaini7189 – 727991Ig-like 42Sequence AnalysisAdd
    BLAST
    Repeati11872 – 1190534TPR 4Add
    BLAST
    Repeati13566 – 1359934TPR 5Add
    BLAST
    Repeati14904 – 1493633TPR 6Add
    BLAST
    Domaini16396 – 1647075SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini16501 – 1659090Ig-like 43Add
    BLAST
    Domaini16625 – 1671995Ig-like 44Add
    BLAST
    Domaini16728 – 1681184Ig-like 45Add
    BLAST
    Domaini16822 – 1691695Ig-like 46Add
    BLAST
    Domaini16919 – 1700183Ig-like 47Add
    BLAST
    Domaini17007 – 1709185Ig-like 48Add
    BLAST
    Domaini17097 – 1718084Ig-like 49Add
    BLAST
    Domaini17184 – 1727087Ig-like 50Add
    BLAST
    Domaini17277 – 1736387Ig-like 51Add
    BLAST
    Domaini17374 – 1746794Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini17473 – 1755886Ig-like 52Add
    BLAST
    Domaini17563 – 1765391Ig-like 53Add
    BLAST
    Domaini17660 – 1775596Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Repeati17694 – 1772835TPR 7Add
    BLAST
    Domaini17760 – 17861102Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini17862 – 1795897Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini17982 – 1807897Fibronectin type-III 5PROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili4204 – 422926Sequence AnalysisAdd
    BLAST
    Coiled coili7621 – 766343Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi2 – 6059Gln-richSequence AnalysisAdd
    BLAST
    Compositional biasi4979 – 5300322Gln-richSequence AnalysisAdd
    BLAST
    Compositional biasi5299 – 64161118Glu-richSequence AnalysisAdd
    BLAST
    Compositional biasi6294 – 631825Lys-richSequence AnalysisAdd
    BLAST
    Compositional biasi7346 – 7451106Glu-richSequence AnalysisAdd
    BLAST
    Compositional biasi9327 – 163567030Glu-richAdd
    BLAST
    Compositional biasi9386 – 113261941Lys-richAdd
    BLAST
    Compositional biasi11740 – 12109370Lys-richAdd
    BLAST
    Compositional biasi14784 – 15234451Lys-richAdd
    BLAST
    Compositional biasi17528 – 17651124Thr-richAdd
    BLAST

    Sequence similaritiesi

    Contains 5 fibronectin type-III domains.PROSITE-ProRule annotation
    Contains 53 Ig-like (immunoglobulin-like) domains.Sequence Analysis
    Contains 1 SH3 domain.PROSITE-ProRule annotation
    Contains 7 TPR repeats.Sequence Analysis

    Keywords - Domaini

    Coiled coil, Immunoglobulin domain, Repeat, SH3 domain, TPR repeat

    Phylogenomic databases

    eggNOGiNOG12793.
    InParanoidiQ9I7U4.
    OrthoDBiEOG7327MW.

    Family and domain databases

    Gene3Di2.60.40.10. 58 hits.
    InterProiIPR010939. DUF1136.
    IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF06582. DUF1136. 13 hits.
    PF00041. fn3. 5 hits.
    PF07679. I-set. 53 hits.
    PF00018. SH3_1. 1 hit.
    [Graphical view]
    SMARTiSM00060. FN3. 5 hits.
    SM00409. IG. 34 hits.
    SM00408. IGc2. 15 hits.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 3 hits.
    SSF50044. SSF50044. 1 hit.
    PROSITEiPS50853. FN3. 5 hits.
    PS50835. IG_LIKE. 51 hits.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform C1 Publication (identifier: Q9I7U4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQRQNPNPYQ QQNQQHQQVQ QFSSQEYSHS SQEQHQEQRI SRTEQHVQRS      50
    QVTTQRQVQQ HHGGSIGGAY VPPSLTHVYA QGDISPPVFE QIFKNARFAQ 100
    GGNALFEGRL RGNPKPFVTW TRKGAPLLES QKFRMSYNEA TGDVSLLINQ 150
    IGPGDEGEYT CTARNQYGEA ICSVYIQPEG APMPALQPIQ NLEKNIYSNG 200
    YSYTSIEEEF RVDTFEYRLL REVSFREAIT RRSGYEQDSQ LSQELDRNQG 250
    PAQAPQISQK PRSSKLIEGS DAVFTARVGS NPKPRLTWFH NGQRLVASQK 300
    YEISYSSGVA TLRVKNATAR DGGHYTLLAE NLQGCVVSSA VLAVEPAAET 350
    AYEPKPVDVM AEQLEAGKAL PPAFVKAFGD REITEGRMTR FDCRVTGNPY 400
    PEVFWLINGR QVRDDASHKI LVNESGSHSL MITNVTRLDA GAVQCLARNK 450
    AGEVAIEAQL NVLEKEQVVA PQFVQRFSTM TVREGEPITM SANAIGTPQP 500
    RITWQKDGVQ ISSTAERFVG IDGGATCLEI PRVTANDAGW YQCTAQNIAG 550
    STANRARLYV EVPREQPNYE QRRLNLPRPT KVIEPEPIPG PEIIYLRHVE 600
    RAKPHLRPGE EDRVYPPPQF IIPLQNVQQT EGGRVHMEAR IEPVGDPTMV 650
    VEWYLNGRPL AASARATSVF KFGFIALDLL SIMGHDSGEY MCRVTNASGV 700
    AESRAILSVV QRPSIEQSSQ NPNSLQYINQ LEDYSRYQRT ESIDEQLNQA 750
    PQFIRPLRDL GEFEEGKNVH FEAQVTPVND PSMRVEWYKD GLPITASSRI 800
    TAIFNFGYVS LNILHLRAED AGTYTVRAVN RIGEAISQSS IRVHSRSQVT 850
    ADLGIPEQQR YIEKVEELED YRKSQQRRHV QEAAEAIAPP QFKTPIQNQL 900
    DLREHAHAHF EARLEPVGDS TMRVEWLKDG QPLEASSRIT TYHNFGYVAL 950
    TIKQLTIYDA GTYTCRAYNA MGQDTTVAQL TVISKNEIVS ESQHPGGLQK 1000
    IQHLEDSSRY GRREEEETYI TQAPRFLGPL KGTTKILEGQ RAHFEARVEP 1050
    QSDLGLVIEW YHNGRSITAA NRIQTYYDFG YVALDISQVR AEDAGVYLVV 1100
    ARNKLGEAQQ QATMIVETRS SIDTSSMHRG LYEKTQNLEN KPFVEPQYDI 1150
    EEISKSKPVF VTPLSDPKPI HDGKNIHLEC RLEPMGDPTM RVEWFHNGRP 1200
    VTVGSRFRTY YDFGFVALDI IKATAADSGE YTVRATNHLG TAHTSACVRV 1250
    IDHTDVVTET QNEQSLEQIQ LLEDSRRRHH QEEDITIMQA PQFTRGLHNI 1300
    ETIEGTNVHL ECRLQPVGDP SMRIEWFVNG KPVKTGHRFR PAYEFDYVAL 1350
    DLLGCYAIDS GVYTCQARNQ LGEAVTSCSV RIIAKNDLIL ETQNESGLQK 1400
    IQYLEDSTRH RRSEFVDEVV NIRPRFLTHP KSLTNTREGG HAHFECKIEP 1450
    VTDPNLKVEW FKNGRPITVG HRFRPIHDFG YVALDIVHLI AEDSGVYTCR 1500
    AVNLIGSDET QVELQCRSGE QIVTVTQNEA GLEQIHYLED RSRYTRREEI 1550
    DESTKQAPVF TTSLKNVEIK ENQRAHFECR LIPVSDPSMR VEWYHNNLPL 1600
    KSGSRFTETN NFGFVALDIM STLPEDAGTY TCRAYNAVGE AITSAVAVVH 1650
    TKKSIYLESQ HETALPRLQH LEDGSKRQRI SVQDEFVSQA PVFTMPVRDV 1700
    RVAENQAVHF EARLIPVGDP KLTVEWLRNG QPIEASNRTT TMHDFGYVAL 1750
    NMKYVNPEDS GTYTCRAVNE LGQAVTSASL IVQSKTSIQL ETQHEAAMHK 1800
    IHQLEDHSRY QRREEEEYTV TTAPVFVTKL IGPSNLVEGQ SAHYECRIEP 1850
    YPDPNLKVEW FHNGKPLSTG HRFRTTYDFG FAALDILTVY AEDSGEYTCR 1900
    VTNNLGEAIN SIVLNVTSRS SIIHETQHEE ALTKIQHLED TSRFQRKTDE 1950
    EQFHAERPQF GRPLRNAKVN EGAPVHLEAT LIPVNDPTMK VEWYCNGRPI 2000
    QTGHRFKTTY DFGFVALDIL YAHAEDTGTY MCKAKNAIGE AVTTCAVNVT 2050
    ANKTLDLDTL DAQRLEKIRQ LETYAPPPKP VVEEKGQKPI FLTPLSNLEH 2100
    LKEGEHAHLE CRVEPINDPN LKIEWFCNGK QLPTGHRYRT THDFGYVALD 2150
    ILYVYGEDTG TYICKATNQL GEAVNTCNVR VLNRRSMILD TQHPDALEKI 2200
    QKLESKVPNA RTEVGDAPIS PPHFTAELRG STEIYEGQTA HFEAQVAPVH 2250
    DPNLRIEFYH NGKPLPSASR FHITFDFGYV SLDITHAVAE DAGEYSVRAV 2300
    NALGQAVSST NLRVIPRGTI ISDTQHPEGL EKIRKLESTA PHQRQEPETP 2350
    GTRQRPVFTQ PLQNIDRINE HQTAHFEARL IPVGDPNLKV EWYRNEKIIE 2400
    DSSRITKQHD FGFVSLDISH IRKEDEGVYM CRAVNPLGEA VTTASMRVVS 2450
    EASIQMDTQH PDSISRIHQL EKPLAPRPTE PERLFEKPIF TQLLTGPSEL 2500
    WEGTHAHFEA RVVPVGDPSL KFEWFINGVE LQMGSRLRTT HDFGFVTLDI 2550
    TAVVPEDAGV YMCRAYNAAG EAVSSTAMKV KTKSNIDGQP LIPESWEAIR 2600
    LKEAAMNRVP EMFVDSTPQQ APVFTTHLQS YDKLHEGQHV LLEAQVEPRA 2650
    DPNLRIEWFK NGISLTTGSR IRSTFDFGLV TLSINGLRAD DSAIYTCKAT 2700
    NQVGEAVSTS SLKIEDRHWL QAESLHPDSL PRIGELEAPK EGRPEAPEPT 2750
    YETPVFITHL NNIECKESDN VRFECNVEPA RDPTMSIEWF YNGQPLQAAA 2800
    KFKSIYDFGY CALDLTNSYA ENSGVYTCKA TNSKGSATTS GTLKCTGGKT 2850
    MFLDTQHPQG EAGLEAVQET EEELANRYTS KTTKPETQYP PPVWTKPLQA 2900
    EFHLSEAQPI HLEANVEPKE DPNLFIEWYF NGKMLNHGSR FKMTSEFGFV 2950
    TMDMIEVYAR DQGIYTCKAY NKAGEAFTST TIFCSSKENI IESTQHPKGA 3000
    EGLEQIQDLE DSLRKDGSKP EQPDLGIPPR FTTEFVNIAD IGEGELAHFE 3050
    ANLIPVGDQS MVIEWFYNGK VLEASHRVRT IYAFGTVALE VLGTKIEDTG 3100
    TYTCRATNKH GTAEISCNLE CVDKPRGQKP RFTSHIQPLE GLKDGQSAHF 3150
    ECTLIPVNDP DLKVEWYHNG KLMRHSNRIK TVSDFGYVVL DISYLQDHDS 3200
    GEYVCRAWNK YGEDFTRTTL NCGGRGGVFY DSLQPDSLQR IRELECPQGQ 3250
    QADTSAPLVA EPPKFITQIV DVTKLVEGQS AHFEARLTPI TDPDLVVEWY 3300
    FNGKKLPHGH RFRTFHDFGI VILDILYCYE ENSGVYEARA RNKYGEDVTR 3350
    ASLKCASKSS LILDSQLPRG MEGGLEKIAN LEYSMVRTRE ETTEETKGKA 3400
    PVFTVPLENI ENLREGENAH FEARITPADD PKLKVEWYWN GRPLKAGSRF 3450
    RTFCDFGFVI LEISPVYPED SGEYSCRAIN EYGEAVTTAT MKIQGKRSII 3500
    MESQLPKGME GTIDRIAELE GLGSRSTEFV PDDDTGKPPE FITSPFDMVI 3550
    GENALAHFEC RLQPINDPSM RVDWFHNGKA LWAGSRIKTI NDFGFVILEI 3600
    AGCYQRDSGL YTCKATNKHG EATVSCKLQV KGRQGIVMEP QLPSNFRTGT 3650
    ESLQKLEETM HKREELVTED EQPNPPKFTE EIKDNLDVPE GGPIHFDCRV 3700
    EPVGDPTMRI EWFYNGHVMA TGSRVHQLND FGFIALDVDY IYARDSGEYT 3750
    CRATNKWGTA TTSAKVTCKG KHNIVYESQL PEGMTSEKLK ELERGRIPEA 3800
    PKVVEEVFGP PKFTTQITSV TVDEAEAVRF ECQVEPKTDP SLRVEWYRNG 3850
    KPLPSGHRYR NIFDMGFVSL DILYVYGEDS GEYVCRAINN YGEDRTRATV 3900
    SCKKLPTILL QNQVPRGMKR SDALTQMEAT IKKYTSEVHL TEDDLFDPDR 3950
    KQPPRFVTQI KEQLTLTEMA VTKFECQLAP VGDPNMKVEW FFNGKPLLHK 4000
    NRFQPIYDFG YVAMNFGWVY PEDSGEYVCR ATNLYGKDET RAIIKVSGKP 4050
    GIVYDSQLPA HMQSIDRIRE MEASWQVVPD EVDPDAKPRT KPVFVSKLEP 4100
    QTVEEGDPAR FCVRVTGHPR PRVMWLINGH TVVHGSRYKL TNDGMFHLDV 4150
    PKTRQYDTGK VEVIARNSVG ESIATTELKV VARSDDYRNV LKNSPRPWYD 4200
    YELAAYQKER QENELEKVFD ERKQVLSEQS SHTLKGVEHL KPKQYKPPTP 4250
    DWQQNVKAKK SEDYYNKLQT LETEQLLKET NLRRDTHQYA IPGEKVVSSS 4300
    QAKGMAQSYE ENLQEKTSTT EVQAAPPKGI AQPSESSVHG REVHMNKQQQ 4350
    VQKEIQGDLE ITRKITATET TEVEHKGTIQ ERVVQGPVKP AKAPVFTKKI 4400
    QPCRVFENEQ AKFEVEFEGE PNPTVKWYRE SFPIQNSPDL QIHTFSGKSI 4450
    LIIRQVFVED SAVFSCVAEN RGGTAKCSAN LVVEERRRAG KGGIQPPSFV 4500
    TTIQSTTVAT GQLARFDAKV TGTRPLDVYW LKNGMKIQPS IKFKMLEEDS 4550
    VHTLLIIEPF AEDSGRYECV AVNAAGEARC DGDCIVQSPS KPEKPTTPGS 4600
    EKAPHIVEQL KSQTVEEGSK VIFRCRVDGK PTPTARWMRG ENFVKPSRYF 4650
    QMSRQGEYYQ LVISEAFPED EGTYKCVAEN KLGSIQTSAQ LKVRPIENLD 4700
    APPTITALKD VSVTEGMPAQ FKTTVTGKVK ATSVQWFREG QLIPETPDFQ 4750
    MIFDGNSAVL LIGTTYEEDS GIFTVRVTSS TGQVESSAKL TVKKRRISAF 4800
    QLRTIDSAED ESSSSGREDS APESPHAFQP GQQPGQQFGQ FLGVNGQGQH 4850
    QGRSRQKKPK VRSKSLQPAT KVIPWRKSSR PTRGRSLDKG VFLPGFKPEP 4900
    VKSWTEETIN LKATPIEKKK PAPKLEAAKV VLKSIKTERD QGIMSLGATL 4950
    EQIIAGKTEK EAIPWITMRE KLKAVESVQQ QLNKFDLDEV YLQPLEGQIE 5000
    TEGQLPQQAQ VEQVQRTKEI QRLKSMESVE IMEMTDQIDK LITQQQNAKD 5050
    LIPWKEMRQQ LKSVQRVTKQ IDKFKIEEVE LRHLQAQQAI TEEYQTGTAE 5100
    ETVVMIDESS KGSISKVLRR DEQLQYEDQS NIYKQKFITT EDVNIMHVSE 5150
    REKLEAQRLI REQQAVNWRQ QQQRPQLQPL TSVEDTVISQ TSERQKLVQQ 5200
    QSFIEEAQRQ QFVQVEDSQM MSLEEYEHQK IINQRTQQEA FSWRQPREPQ 5250
    KFIQVEDSTL LHLQERHDTQ EQQLLQQQPV MWDRGRKKPD QPQYVQPQEQ 5300
    RVKEEFVEKP KTYEEMHDEL VEPTPIEQPQ PVPVMWERGK KKPQPQEKTF 5350
    EEAHDELVEP TPVQQPEPVP VMWERGKKKV AQQETVLSQE VVQTSQVVEQ 5400
    QIVEETKKTA VRRVIPPREP EQKVEQVTLK PTPRPRPKEA VKAEEIQLKP 5450
    LRSTRPVPQP VEAEQKAYEE ATDELTEEPI PQPQPVMWER GKKKPQKPQE 5500
    EVTEIPKTLE IAVDTLEEEV PKPTEPQPQP VLWARGQKKP QKPDEQKQEL 5550
    PKSLEIAVDT IEEDLIKPVQ PEPQPVLWER KKKKPQPQDV IEEKLDVAPT 5600
    KTYEKAVDVL PDEPKVEEKP EPVLWQRGKK KIPKSEPTEE VHPDEVDAQI 5650
    ETVVKEDEMI VEEKRRIKKT KRPKSTKEVT EELFEEQPEE EISPEEEVPQ 5700
    KEVIEEIEEI VEEKRRLKKT KKPKLTQQVT EEETPHEEII KESEEVVQEQ 5750
    EEIVEEKKKV KKVKKPKTVA EKQLKEEEIP TEETVEEEET AEDQQLVVEE 5800
    SKKVKKVKKP TGTVEKTDVE ELPGEEVPVE EVPVEEVPED VAPEEELIEE 5850
    QEEIVDQDEI QEQKRKVKKA KKPKKTIEKT EIEIEEDQPE EEVLQEEIIG 5900
    EQEEITERQR KVKSIKKPKK VVTEKTVDQT EQPEKPEESQ AEEVKETVTE 5950
    EPKKPKPAPE EAKVEQVEKI SLKPAPRKQR LLPEKEQVEE VLLKPVKKIV 6000
    AVSEAEQPET PETEFEVKEF AITTTEDILD VTKKRVKKKK PKTKVAAEES 6050
    TEEPAEETEE FEEEATQPEE VQPVEEIPEE PQVKEVADER KTAPKPKPRK 6100
    EEIIEKVEEV ALKRVTRPKK ELPQEATIEE VRLKPTQRTS IKPEEVKLEE 6150
    VDLQHVEKKE DEIVQEEKRK TRKVKKPKHE DLPEIPDAEP TQLEEAEHIE 6200
    LEKQPKPEED QPQVPWKRGE KKQPVEEVLE EKKWPSGKRR PLPEQQPEEV 6250
    QLKPIPSKPI EEQQKPEKAI PGPQLVPEEK PESEEEELEL EPLKLPEDKK 6300
    PKEPKAKKEK KKKPKLKKAT PSVDEVSEEV AEPFDEPIAE EDEVEEMPVD 6350
    DVKVVAVSED VLPEEEVVPT EETPEAKQKA HKKRTKRLKE ASVEGQPQLL 6400
    EAAIAEIEKV DEISQEISQK TITLLKKTED TRPQFITTEQ LIELDVEDVR 6450
    RDLEMKVTSN IIKKEKRRVV LDDSQPLPEL ELITQKRIQE GIDKVADEEL 6500
    IEDQQLIQNQ QETTTSEVIG QERKLVKKKK KEIKPPRITE KLRPRQCVPE 6550
    EPTVLECKVE GVPFPEIKWY FNDILLFASE KYEITVMEQV AKLKIAKVTP 6600
    SDVGVYTCEA KNEAGVATSR TNIILEKEQG VPPQFTKPLK IEFIEEKQPE 6650
    RLKVTVTCQV TGKPNPEVKW YRGIEEVIPS ETVQMFYDEK TGDVALEVIN 6700
    PTPNEAVVYS VQAQNQFGRA IGNANILSRV DEVPREILKA PTVTPLSAVV 6750
    VPTGGTLFFE AKYDGLPRPE VKWMRNGREI IENEETIIET TETTTTIKVV 6800
    NMTRKRTGKY EVWAKNKVGE AKSSGSVVVS DQKPDEQIKP PRFIQPLEPK 6850
    YFGEHEVAII EAIVESEPLS SFQWFVHNEP IKSSNEVRIV SQANKSTLLI 6900
    ENFQSKFVGP FTCRAENVGG SVTSTATVNL IPQEEAEEFE SPRFVEELVQ 6950
    PVEVMDGEAL LLTCQVTGKP TPKVEWYHNA EKITENKETT ISQDLQGVCQ 7000
    LQITEVFPEN EGQYECVATN KIGKSVSKTN VKIQAFEYIP DSEITGLTGS 7050
    EEDLLDRTLS IDEQAPKIIK KLPEKIEPKE GEQAKLEVKV VGKPKPKVKW 7100
    LRDDEQIFAS EEYQIENFED GTSVLVINHV YPDDLGTISF EAYNPLGVAV 7150
    TTALFAVEGI VGSKDYRKPE WVSQMEEMQV ALKAAKCSPS LLNEMRDCRA 7200
    ALGETAKFSI QFAGNPIPDI QWYFNNVQLR ASEKYRMVVQ EQEATLEIMK 7250
    ITSEDCGYYN CKLINEIGMT MTRAKFDISS TSTIVEETKA KTTVKKKSGK 7300
    KTMVKRSGAS ESQNVQKTEI RIIPTSAVET SMNVIKVKQP VSVLVEKSEI 7350
    SEVLVVKDRE VADAEERSSQ LIEEIEEEEE IEEKVQHDEE DEVEVQVEQK 7400
    ETYTSSKKIE ITKTVELIRT KISEKIITIE DVQVLSHHEE VQWLLESIEA 7450
    ESFGQIGESA LRDLATIGLL LRYGCEHYEI TYMYEQNIFI SLKKPESQSA 7500
    LVQLVEREGH EELISQILSE SSNEDETILA ATVGFKAFIR MIQTYEITIE 7550
    IVIRKFVRED FISQDWKICG KERIVETSQI IESHEAITHV KIETATTKVE 7600
    KLFKKQEQEH VQNLEQQEQV KIQVQTKQIA QMNTKIKKHK KHKQQEQEVS 7650
    ETTIQCEQKE TLAHETSAEL PQSETLEQIE ESLSTYETLP IQNLSKDTLQ 7700
    TVAVSVTTEL STPSPTASRV QEEILPQKVL AINEEVLPLD EFGLRKESPR 7750
    PKENKLTENI EVRLKHALNV SHAKTAESSK ELPSKIPKSV KAQRKMKESR 7800
    SLVVEAPNAE EAIEDLKPLK AVSQEVQSDI LFSHEITEEQ HQALETIEKL 7850
    KPTSAIEDTV QQKLLSQEEL IIAEVLPSET VGRDVTDVRP PGETISPRLT 7900
    PNMSLCITEC QPEDSIGEMQ QAAKERMETP SMSVTESKAV GGQELEVLEN 7950
    VDHMPLITQP TKGLADYTIK AEEVPVQVQE IITFDSLERE TVAKTQTAKS 8000
    NALELFELSE GLVSSTADSH SPIAEDLPIF EKDVKEATID MQMQHHVTTS 8050
    ETVSNENAVK DLKAVDTPKM AEGTLGQSSA LTIGETQQMN LVETTVELIE 8100
    PNVESTKPAK GALTEAYGTA ESNEETLLES LGLVPDDNRK IEQGKVNISE 8150
    GEYVAKVQTT TVTDTEGEFV SVAPKLVNPK FDFVEQSALQ IKQDTTVEKE 8200
    EILSSNIELA PQLATSNMFP AELKVTSIYE VQPGLTSSDI ITEQTKSVSA 8250
    NQVFETMSIG VTSKPDMLES TSHIDAFQHP EFKTGDTILD ENQQPLEVTN 8300
    VQITESSTDI IDVLPNQKLT KAETVTDGFK YAEGLVVLPM ESTIDKTEDT 8350
    KPTAVNADIS MHQQFGTDVR EQEPLESTLT RTEDLKPQTQ TTESQFGLLQ 8400
    SLETSSCVTL EGESVLSVKE RHPEQSAAIG TSSALQVANI TRPQHMESLD 8450
    RLDEQKVPYY QANVNIGEIT LPNVEKIDSF DVLSDLNTPD YNKSSKGRVQ 8500
    LIESTTSLKT TTAVVSESTE ELKDLNITQP VHIKPKPYES DQKISISEQT 8550
    NVLEHVSSLN PVLPALETIQ SSIKSLHEIN VRETDILEKE ESLKDVDHIS 8600
    GRLAKIILDC TTGIAQVRQE ETLEHEEDLK APLIPLEKAI PASSELHRLP 8650
    LTEYVQEQQG TSDMTDFKVS NKCASPNIDH LYETKSSEMI VYDSSINSVD 8700
    SEFPAGIVPQ KSLVPFRHTM VTENVAFNAS ENFEILSADQ QIATNVQDSL 8750
    SQSIIAEDQI AFETEQNLGL ETTPTHKPKL LKDDQNLHAK LVDEATVYEA 8800
    MGQEQKVDKY NIQQAEITHD LPQVYATDLQ QTFEAEKEIT TREQSYVAAT 8850
    TDIIPSRLGL AMTTKTHPVE GIDVLLSSPP KPSLAQTNYE ETQHEVRVRE 8900
    TQAIEESEEL TDGRLLPVSA VESIDSTFKV TSDSQQPPVF DKELSIPTVS 8950
    PLEARAKPSL NLLQGTTTFD VIPLESSVLL KDTHVAVQKA QQEYVAQVES 9000
    NKVHVQMDNL VMHKEDIFEN AEIENFCKPI TEGTQLETVV IEVVPIDNVG 9050
    GIHLAPQPST LLATLTSTDI VNQSHVIDTQ VPLEMESEAQ APLDNIAQAR 9100
    IKSAEDHVHT NVSEVNVYEQ TKAIQDQNKH GLFVKVSKNS DTSKAYLTTI 9150
    QSTFLKEDIL PKPNILQDTA QAAADELQSL VTEEVVSVSS IQETYELKIP 9200
    LQKTANLTQQ TPQNSVNVCQ QLAYEETPDI AFEPHALTRA TTSSVPTFLK 9250
    PAENATVNIY ENIEGHGDFK PGTVNLTSNS NLNSELVVSV VQEVTSVPSL 9300
    GSLATVEPQE LKAMPVTKSS TNLAYSEEVK GNKQEFTKIE TVEEDDKQPE 9350
    TTVTVEELPY EEEKPEEIQE LPEEVCVVET VTEDGKPKKK KIRTRVIKKV 9400
    KGDKQEVTKI ETVEEDDKQP ETTVTVEEVP YEEEKPEEIQ ELPEEVRVVE 9450
    TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK IETVEEDDKQ PETTVTVEEV 9500
    PYEEEKPEEI QELPEEVRVV ETVTEDGKPK KKKIRTRFIK KVKGDKQEVT 9550
    KIETVEEDDK QPETTVTVEE VPYEEEKPEE IQELPEEVRV VETVTEDGKP 9600
    KKKKIRTRVI KKVKGDKQEV TKIETVEEDD KQPETTVTVE EVPYEEEKPE 9650
    EIQELPEEVR VVETVTEDGK PKKKKIRTRV IKKVKGDKQE VTKIETVEED 9700
    DKQPETTVTV EEVPYEEEKP EEIQELPEEV RVVETVTEDG KPKKKKIRTR 9750
    VIKKVKGDKQ EVTKIETVEE DDKQPETTVT VEEVPYEEEK PEEIQELPEE 9800
    VRVVETVTED GKPKKKKIRT RVIKKVKGDK QEVTKIETAE EDDKQPETTV 9850
    TVEEVPYEEE KPEEIQELPE EVRVVETVTE DGKPKKKKIR TRVIKKVKGD 9900
    KQEVTKIETV EEDDKQPETT VTVEEVPYEE EKPEEIQELP EEVRVVETVT 9950
    EDGKPKKKKI RTRVIKKVKG DKQEVTKIET VEEDDKQPET TVTVEEVPYE 10000
    EEKPEEIQEL PEEVRVVETV TEDGKPKKKK IRTRVIKKVK GDKQEVTKIE 10050
    TVEEDDKQPE TTVTVEEVPY EEEKPEEIQE LPEEVRVVET VTEDGKPKKK 10100
    KIRTRVIKKV KGDKQEVTKI ETVEENDKQP ETTVTVEEVP YEEEKPEEIQ 10150
    ELPEEVRVVE TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK IETVEEDDKQ 10200
    PKTTVTVEEV PYEEEKPEEI QELPEEVRVV ETVTEDGKPK KKKIRTRVIK 10250
    KVKGDNQEVT KIETVEEDDK QPETTVTVEE VPYEEEKPEE IQELPEEVRV 10300
    VETVTEDGKP KKKKIRTRVI KKVKGDKQEV TKIETVEEDD KQPETTVTVE 10350
    EVPYEEEKPE EIQELPEEVR VVETVTEDGK PKKKKIRTRV IKKVKGDMQE 10400
    VTKIETVEED DKQPETTVTV EEVPYEEEKP EEIQELPEEV RVVETVTEDG 10450
    KPKKKKIRTR VIKKVKGDKQ EVTKIETVEE DDKQPETTVT VEEVPYEEEK 10500
    PEEIQELPEE VRVVETVTED GKPKKKKIRT RVIKKVKGDK QEVTKIETVE 10550
    EDDKQPETTV TVEEVPYEEE KPEEIQELPE EVRVVETVTE DGKPKKKKIR 10600
    TRVIKKVKGD KQEVTKIETV EEDDKQPETT VTVEEVPYEE EKPEEIQELP 10650
    EEVRVVETVT EDGKPKKKKI RTRVIKKVKG DKQEVTKIET VEEDDKQPET 10700
    TVTVEEVPYE EEKPEEIQEL PEEVRVVETV TEDGKPKKKK IRTRVIKKVK 10750
    GDKQEVTKIE TVEEDDKQPE TTVTVEEVPY EEEKPEEIQE LPEEVRVVET 10800
    VTEDGKPKKK KIRTRVIKKV KGDKQEVTKI ETVEEDDKQP ETTVTVEEVP 10850
    YEEEKPEEIQ ELPEEVRVVE TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK 10900
    IETVEEDDKQ PETTVTVEEV PYEEEKPEEI QELPEEVRVV ETVTEDGKPK 10950
    KKKIRTRVIK KVKGDKQEVT KIETVEEDDK QPETTVTVEE VPYEVEKPDE 11000
    IQELPEEVRV VETVTEDGKP KKKKIRTRVI KKVKGDKQEV TKIETVEEDD 11050
    KQPETTVTVE EVPYEEEKPE EIQELPEEVR VVETVTEDGK PKKKKIRTRV 11100
    IKKVKGDKQE VTKIETVEED DKQPETTVTV EEVPYEEEKP EEIQELPEEV 11150
    RVVETVTEDG KPKKKKIRTR VIKKVKGDKQ EVTKIETVEE DDKQPETTVT 11200
    VEEVPYEEEK PEEIQELPEE VRVVETVTED GKPKKKKIRT RVIKKVKGDK 11250
    QEVTKIETVE EDDKQPETTV TVEEVPYEEE KPEEIQELPE EVRVVETVTE 11300
    DGKPKKKKIR TRVIKKVKGD KQEVTKIETV EEDDKQPETT VTVEEVPYEE 11350
    EKLEEIQELP EEVRVVETVT EDGKPKKKKI RTRVIKKVKG DKQEVTTIET 11400
    VEEDDKKAET TVTVEETELS APSVGKVQLK KRVIVQKPED AVTVFELPER 11450
    KSVILSEKED GTPTKTVIKT RIIKKIQGPN MEVTKVQTVE EYEKAPQTIV 11500
    SVEKFNTPFP ELPEERLSEV VMLPDEVFES EAVDEEGRLK MIKTKKRIIR 11550
    KPALDNTEEV TEIGIIEQDN VEPIYSVKIQ ERPLTESKPE DSKLIELPEH 11600
    VTELNVILPD GKKKRRTVKS RAFKKSLDDD LDEVTTIHII EEEDKEPLTK 11650
    VNIEVVPSDE ISITPIPIEE LPEETVFTEE LDENKKPKKK TTKTRTFKKR 11700
    GPDDDEYFQI QTIDEEGKEP ISLIRVVSDE NIADIIDISK LDDEKVLKHK 11750
    QKPHKHKDQY YKEYTITEPE EASADALQKP TKDKTPKQKK TLETPIEEVD 11800
    ETVIIDEGTG EQTDQIAIKR KPRKVQGNVQ VEAVDEKPIE KKEKAKKKKV 11850
    VKTKRDEMDD YIQFLIHQEI PKTVLQPYQR TEMELPQRAR RDSSFKQPVK 11900
    LTPMKIEKVE FKKPKMVEIS SVVEFPQMLK LKAPKQRPQE EKKKKNEASF 11950
    KNKKLKSWIR FVPYAPYCFP YVVTELETNR EVGELSRNVD EAEEVLKLRP 12000
    KKFKHSKPEK AELEEADLGA YESDHSDKSN KELLHPKYKR GKKEKIETPD 12050
    ESRKLKFGKG KVPQNEEASE EVNLKPVKLD IAEIEDAEMP VRTQEEEVVK 12100
    KKKPKKSSKP EEGLQFEPIE FEEMERTSDI REESDTSVSV DTSTQEKPIY 12150
    KKKKKVTPSP QKNQYKILPG QPREFEETPE DDLNLRKRQG ERPDDDKADT 12200
    KLKPFYKFEV LDLEPEGVQA ETVPLSETIA KEPKKKRKIK VKTEQEDNTI 12250
    EIVPLSPEDN DEQIFEITVT SSEIPQGDAK AKTIGKKKVK RMNKQELDDF 12300
    VTELQEEPNQ EVYETRMSDF YEVKLTELPS EMDSDKPTKR ILRHEKGDEV 12350
    QVLEIVESVV APGEEPFYEI NVISSANTEG DSEEITTDKI KKKSRKIKKD 12400
    DLDAYIQQLI NAEIPVTELE KYEKIDVDGK AKKPKKLKAK TKKPIIDEGE 12450
    TLQVGVTEHE PTKKLKTKKP EEKKNVIEKE LAEHEAVPEY DEFLINKTES 12500
    ERPQEKRVEE TEKDIVPIVD KVLADLNDCL PFVVVEEDLK DMPLATDVIA 12550
    LEDEKIIRKR KVRAKKDSKQ YEIEIIETEK PGDIPDEARV IVITTEVSGD 12600
    TIDGPAPSTT EAPKKSVRKV KKEKLKEFIV NIVEEAPLDH VSEIYEDVLR 12650
    TPFRESSEKE DIPSFTTTVV EDEIVNPVLP EKIKTVDDVR VPKDKKKKID 12700
    NQKKIKISEF EPTPTSEDST IEEYTPKLSE HDEDLQTDEY SVDVKDSLPK 12750
    SKKKSTKKQK KESLPGPISL YTIRIEETTP EPITEKIYED GKEVVRVINK 12800
    RRIKKKAGPK EYLIEVIETY EDNNPEADVV IRTIETTPSI DSKPQEDHKI 12850
    QVVQEKKPKT ESLDNYIQKL IDQEIPQVDH KEFKATVLET SPESKKAKKI 12900
    KKHHKKTTEV IDGIPITVIE VTIQETETDD EDFKPDEVTL KEIDHENAEE 12950
    APKVLKSKVS EEKPKSKKEK SLEFKIAEED KPKPVLEDIS EDVQVVQIIE 13000
    EDGTPKQVEI KKKKVSRKHG PKEQVFEITE TKAIDEPLSE VTVVEITDEQ 13050
    PQEEVLPAQE KKPIKKQKKL KPEDVNTYVV KVLEELTEPT QFETIPEDAD 13100
    DKPQPVIEDI SENVQVVQII EEDGTPKQVE IKKKKVSPKH GPKEQVFEIT 13150
    ETRPSDEPLA EVTIVELTEE GLNKDIVIPQ EKKTVKKPKK LKPEDIQSYV 13200
    IRVLEEFNEP QWPASTEKPI IEDIAESIEI VPVTEEDGIT KEVEVKKKKV 13250
    SRKQGTKNQV FEIIETKTSD EPLAEVTILE LSGDKSQEVT ILPKEKKPIK 13300
    KTIKLKPEDV ESYVVNVLEE FCEPQSFESP EPTEGEAHET KTKTKKPKKP 13350
    IVKAPENVIL IEEMAPETVI ENIVNEIGEE VKQVKTTKKL KKKEGPKEYL 13400
    IEIKETYEEN KPEGDIEITT TELVPEGSPD ASDDQPVIVV QKIKKKKPVK 13450
    DDLDKYIQQL IEQEITKTPL EEYEPTEMDS KKKPKKKVKS HNKKTIEVID 13500
    GLPVTIHEFN VEDIVSEPED METPKTLLDE IKEIPQLPDD SSKYLVNISD 13550
    EFGEADKPIK QPTQDQPIKK EKPLKKKKDV EYPVSLEAFD HTVKVVSEPT 13600
    LEGTVKEVTV KKRKVSRRKG SKDHIFEITE TTSEDRPTAE VTVVELSSDE 13650
    VLDSEEKPKH ERKIVKKPKQ LKKDDVEEYI INIIEEFIQP IPVGLVEDEV 13700
    EKVQKEETKK PKKSPITYIA TEQEDNDNNY DALVKEDLDQ PIERALEKPS 13750
    SPLEYTISVE EDSVGEEQKQ PKPKKISKPK SIKQPSVDKS PDYLVNVISE 13800
    ESIIDEPIPE DYVVTEAAEE KPSEEPTFKV EELETEAVEK EVTDDDKGET 13850
    TKQSVTKRKI KKLVGPKEEI IEIVETKTGD TPEYEVIVTT EEVQEKSKEA 13900
    PEEKKAKTVR KAKKIPKDDL QDYIQKLIEQ DIPKTELEKY EKIDLDEPVK 13950
    MKRKPIKKVK QSEEQPKEET EEPIEDKPVE KISEYSEVDS DEPKLTVAVK 14000
    EFIPEKPEEK PFEIVVLEET VESKREPDEE GKVREKVVKT KKIKQNRGSV 14050
    EVVHDIVEEI DTDTNESVIT VTTTVPTETP DQDQPSVKQK RTKKIKKDEV 14100
    EDFVKRVIEE EAPQPEGSVD LVVIEDFVPK PSSEKRKKKP IKDKHTSVEE 14150
    ETPHEDEVLL IESVPEDSPL SDDLITVVDS VPIEEEPENK VNQIEDTKKP 14200
    EKKKKPKPSA KILEENVPED TVEKPLEALH TDSDLEKPDV QEFSISIKEE 14250
    EQKHTHPEKK KSSKISSEQP KQPSTEQYEI SVTEHDLKPE EEKPFTVQVI 14300
    QSETNVEETK DDTGKVHKQV TTKRMLRRPA GEGEIEIIEV VRDDQPEAEI 14350
    TIVEYEPEPV NQDEKPKEPK KKTRKVKKDD IHDYIQKLIE LETPKTELEK 14400
    YEKIEFEPIV KDKPLDSPID VLDESPKEVQ KKDKKSRSTK VPNEETPVQE 14450
    QYAKVNVVEE EAPEQPEIPV QILEVKPVEV DVKEVITEDG KPVQEKTTKR 14500
    VLKKIGPEEQ TTFKITMIES EDNDSVTVIV DEEPEIASPQ SIEEHPEQSK 14550
    EKLAPKPKKT VRKVKKDDLS DYVKKLIEEE IPKVDLEKYE KVEMPEKPVK 14600
    LTVSDSIPEE PKPDKSQPIS VLPDTTKPKK TKTPKTPKTE DTDQQVPDEP 14650
    TETTVDTTDI PELTPTQTAQ PEDTATAQIT PSAQEEKSTQ DDTKDTIQKT 14700
    VKHKKTKPDT QKSVETSELP EVHKDYQISI IHEELVEEEQ PEKILEVRVI 14750
    DEVAEVEESQ PIVEEVEDEE PQPATEETVE DVTKPKSKKK KVVKKKTDDH 14800
    DELIKKMLEQ EIEKTELEKY EKIEFDVPKK LKPEFAALEP IKIERKEQKP 14850
    TKVTILDATD VPKTVKLKPS KRKEKPAEEL TVQLPKFRLK ARMVLVEYPP 14900
    APLIPKTTDI GAIKDNGELS RNIEEAEEIL KFKPHKTKKI KKIKDDLEKV 14950
    ELEKYEKYIS SEEEPEEKTP YKKPEKAPKP EEKQEDVKLK LGKGKKKPKE 15000
    EEAPENVTLK NIPQKPQEVE EEVELKQKPK EVEIVEEQTK KPKDGEFVVE 15050
    PFEPSEFDRP EYVPDELEQI EHPEIPEKVK KPSKTKYKPK DKSKSEPETI 15100
    VSEIVAGVPK EEEAIPEQDV KFRKPERDAP EETDSEIKLR PVPQASKDEN 15150
    PDEQALVTPK AEEPIPQEIE DKAIDDEKKP KKSKPKKVQP KEQEIAKEEP 15200
    EEFEVSVKEE EALVDKPIEI EKPKDVKVKE KKPKEAPVSE VVVIEEEPKP 15250
    EEVPEEIPVE YKITTTVLEP EDAPKEHQVK VIDFDERQET TEEVIEEKVV 15300
    TRKKKPKPQQ PEEFEVTLKE PKEEQIQPDV VSAEISLPIE EPEQKPEQYE 15350
    VELKITQTTP EEPNDVQIAV KEKVKTKPVK KVKEDKIVVV EAEEEKQPVE 15400
    ETIVEVEKQE EKKKSEKPKS YEFKISETQS IEEKPIEVAE EAPEETPKVV 15450
    EKKVAEKFDS YEFTLKETDE EKVITVDDQP EEEAPVEVVF KKKPKEPEAV 15500
    EAEFVMTEPK IVEETSVETA IKQKKTKKPK KDEEEAQLAI KVVESEAPVA 15550
    EEVFSEAPES KIVEEEVIAE EKPKEFTIRV SESEPKPEEP SVEQFTVKKR 15600
    KPSVTFADEP ATEIVIKESK PAEVVTEDAH IKTKKPKKKV TDVEAEELKI 15650
    KITEEVPQEI PILEEVSEEE VITETKKTAP VVEEKTYKIG IKETEPEKPA 15700
    EAIVEEEEPV VTEPIEEAPK PEVFEEHKVR VIEETPRELV EEVIEEEVKV 15750
    IRRKKPKPEI KEEPEAEVTV STPKPVEEVE ATSSIAVIPE QPTEEEAADL 15800
    KITIIEEETP PQELVQEIEE IEIVEEPKAP EEQPTDFTFA TKDSEKKPTV 15850
    EELPEEQVTI QKKKKKAPVP EVVEEPEAEF LVKPKTPVQE VTEEAKITKS 15900
    KKPVKEEEAA AELKVTITEE IPTEPEVQEI IEEIEEIEEE KPAEYVIEVK 15950
    ESQPEAVEDK EVSLPKKKPK APIVEEPEAE ITLKPKVKSE EVQEEAKIVK 16000
    KKPKKIDEVA VADELTVKVE EEVVPEPIVE EEVIEEFEIK KKPKEPEPED 16050
    IVDAAIVKLK KPEPVDADEV VAEVTLKPKA KTEVTEEEFS VDVKLPKEKK 16100
    ERPVEIEEEE IIEEAVVIRK KPKKPFEPTV EDLEETEFSL SFKKPHTINE 16150
    GVEEAATVLK KRPVKPTTLD EAAAELSIKR QEEEYEEGED IEEFVVSQQR 16200
    KPKPLQITEE DEEAYTVKKL KRRKQVDIPE YADVENVTFR ARSTKTKEDV 16250
    DQEFNIALDS YAEEEISMSG KVKLKKPIKK TFSEAADEAK IKIIQDFDDG 16300
    EEPIIEEIRD DEDTIDEVEE PEEYFVEELP PDEVDFKLKP KKHPKPAYSV 16350
    QDEEEEQFLI GIRHPKRDSV TYDEDSLTFK KKRKVVQQLF NEDGASLNIT 16400
    REMNVEESEN LNIMYSICNY IADNNEAINL VEGEKVTVVG RHSSEWWYVK 16450
    KSTTEEEGWV PAQYLMEPEE YAQYVQNKLH EKIDKLPVFE RPGPEDKPIA 16500
    PRFIEKLQPI HTPDGYTVQF ECKVEGNPRP QIAWFRETAI IKPSQDFQMF 16550
    YDDDNVATLI IREVFPEDAG QFTVVAKNAA GFTSSTTELI VESPLSDHGS 16600
    DATALSRRSM SRESSLADIL EGIPPTFSKK PKAQYVDENT NVILECRLVA 16650
    VPEPDIVWTF NGEDIDEEEI KNVRIVTESD MHMYCSVVHI SKVKKSQEGT 16700
    YEVIATNREG EARLPITLKV RTTDKEAPQI LEPLRNMVIR EGESVVLSTQ 16750
    IVGNPPPKVT WYKDGKPVKN AKSDKDLHTL TLITPQKSEK GEYTVKAVNP 16800
    LGSVETTANL TIEEPAGGNA EPPLFVERFE EQNVPQKGEI RLPAKVSGNP 16850
    VPEVQWLFNN TPLFPSERIQ QVYDGENIEL IIKDANPETD SGDYKCIASN 16900
    PIGKTSHGAR VIVEVDEVTF TKKLKKTITI EEVQSLTLEC ETSHVVTTKW 16950
    FFNGKELSGM DHRVVVEDGK THKLVIRNTN LRDSGTYTCK VKKQETQSTV 17000
    EVLQRKPDFI KVLEDYEVTE KDTAILDVEL TTEATEVTWY KDGEKITPEN 17050
    KNVEFIKDGK ARRLVIRDVT IHDEGQYTCK IEGQECSCEL VVIELPPEIV 17100
    EPLNDVAVTK GENAVFEVEL SKGDALVKWF KNGKEIVFNE RIQLAIDGKK 17150
    QSLRIVKAKP EDVGEYSVQV GEQTSKAKLT VEEPLVDFVI RLPDITLATK 17200
    TTDAEFTVQL SQPDVEVTWC KKGKPIKPNQ KHEVFVEGTV RRLVIHDASD 17250
    EDAGEISCVA ENVTSSTKLC VEELKLPPVI TSDKDQTIKV KENDDVTFTV 17300
    KYTGVPTPEA CWTTRKVVIP KSKRTIPTID EQSAKLTIKK VVDDDEGEYT 17350
    VKLVNPVGEA EASLHLVIMR KPTAPGTPQP LEIMHDSITL YWKAPEDDGK 17400
    SEIIEYILEY QDVKEEKWTE IRKIKDTTYT ISKLKIDTEY VFRSIAVNEV 17450
    GPSPPSPLSP PIRLVPKVET KAPSVQEPLQ DVVSELDKEV TLSCVFGGIP 17500
    EPKVTWKKNG QVFESRSIRY ENRVAKYTIE KTTIETEATY TCVATNEKGS 17550
    AETSCRLKLQ QKPVLEVEDK YLTQKLRTGS ILTIPATVRG YPQPTVTWHK 17600
    ETIEQKTTKS VTIETTETTS TYTVKKVTRE QSGKYKVTAT NESGTTYVEC 17650
    TVQVIDKPSR PQSLEIKDIK KDSIVLEWTP PVDDGGLDIE KYTLEKCDVQ 17700
    NNVWMKVSDF NKDIKSYAVQ KLSMNAQYMF RVVAANPIGE SEPTESDPVT 17750
    ITKKFEKPSP PRGPTTVSGM NDTSFNLAWE PSETDGGSKI IEYIVEIREE 17800
    TETTYRSVGV TLGTVTNIHV EKVVRNKGYF FRIYARNEVG TSEAFETTEK 17850
    IVLGRKITPP SPPQNLRAPD VTSRSVTLDW EVPARNGGSE ITGYCVEKRS 17900
    STSTNWTKVI TLDAHQLHYT IDNLKEKCEY WFRVSAENEV GLGAPAVTES 17950
    ISLKTHASEF ILVVRNCGSY TEFGFLKAVP SPPTGPLEAR VLAANAHIFE 18000
    WGLPESDGGA PLLGYHIAIR DMKKTMWIEV GRVPAGVLKF QIRDLQENHE 18050
    YMIRIFAKNE IGLSEPLESE EPYKAMTAGH ESLPDEPRTE MSSCNTSSWL 18100
    RDHHMDADIH SYARGRLLQR DEYFFRLWAE LPKSKKKKSS K 18141

    Note: No experimental confirmation available.Curated

    Length:18,141
    Mass (Da):2,065,766
    Last modified:March 18, 2008 - v3
    Checksum:i41CA5977EB611933
    GO
    Isoform A2 Publications (identifier: Q9I7U4-2) [UniParc]FASTAAdd to Basket

    Also known as: KetImported

    , KettinImported

    The sequence of this isoform differs from the canonical sequence as follows:
         4794-4796: KRR → SKD
         4797-18074: Missing.

    Show »
    Length:4,863
    Mass (Da):548,598
    Checksum:iF39A3B9B7230A7E5
    GO
    Isoform B1 Publication (identifier: Q9I7U4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2-57: QRQNPNPYQQ...QRSQVTTQRQ → NKVSSLYNDV...RSLSLLLALG
         586-663: EPIPGPEIIY...YLNGRPLAAS → G
         1106-1118: GEAQQQATMIVET → A
         4751-4753: MIF → QPG
         4754-4835: Missing.
         6626-6634: EKEQGVPPQ → GK
         7030-7213: Missing.
         7214-7218: GNPIP → NVKIQ
         7577-7592: TSQIIESHEAITHVKI → RSTLSLFNYITFT
         9111-9114: NVSE → NVSEVNVYEQTKAIQDQNKHGLFVKVSKNSDTSKAYLTTIQSTFLKEDILPKPNILQ
         9329-9525: VKGNKQEFTK...EVRVVETVTE → GGIPYVQITV...TRLIKKVKGN
         9526-11249: Missing.
         14333-14478: Missing.
         16100-16100: K → KTKLYSSRKRRSRRSPVEEAADELKLQQTVVE
         16492-16498: PGPEDKP → KLLPKQK
         16499-16573: Missing.
         17341-17344: VVDD → DVVS
         17345-17484: Missing.
         17686-18141: GLDIEKYTLE...PKSKKKKSSK → DEDEVKRSAE...TENEQDCICL

    Show »
    Length:17,970
    Mass (Da):2,041,306
    Checksum:iC16FBFC3C09569CA
    GO
    Isoform D1 Publication (identifier: Q9I7U4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         9335-11180: Missing.
         14438-14457: STKVPNEETPVQEQYAKVNV → TICKGQC

    Show »
    Length:16,282
    Mass (Da):1,849,153
    Checksum:i8419A8664D293917
    GO
    Isoform E1 Publication (identifier: Q9I7U4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         16100-16100: K → KVTEETSDQTVQLKKKKKPQKPVEEAADELKLQQTVVE

    Show »
    Length:18,178
    Mass (Da):2,069,971
    Checksum:i737C3E6C5D524D9B
    GO

    Sequence cautioni

    The sequence AAM11102.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti7 – 71N → S in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti382 – 3821E → G in AAC23966. (PubMed:9548712)Curated
    Sequence conflicti568 – 5681N → S in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti568 – 5681N → S in AAC23966. (PubMed:9548712)Curated
    Sequence conflicti568 – 5681N → S(PubMed:10669599)Curated
    Sequence conflicti722 – 7221P → S in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti875 – 8806QQRRHV → PASVVM in AAC23966. (PubMed:9548712)Curated
    Sequence conflicti1059 – 10591E → G in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti1345 – 13451F → L in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti1405 – 14051E → G in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti1691 – 16922PV → NS in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti1779 – 17791S → P in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti1905 – 19051L → H in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti1905 – 19051L → H in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti1952 – 19521Q → H in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti2050 – 20501T → TVT in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti2104 – 21041G → R in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti2661 – 26611N → S in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti2934 – 29341M → V in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti3091 – 30944VLGT → EGVR in AAF61414. (PubMed:11062264)Curated
    Sequence conflicti3091 – 30944VLGT → EGVR in AAG40155. (PubMed:11062264)Curated
    Sequence conflicti3174 – 31741R → C in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti3174 – 31741R → C in CAA09971. (PubMed:9917396)Curated
    Sequence conflicti3303 – 33031G → D in AAF61414. (PubMed:11062264)Curated
    Sequence conflicti3303 – 33031G → D in AAG40155. (PubMed:11062264)Curated
    Sequence conflicti3379 – 33813ANL → RGM in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti3500 – 35023IME → FMD in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti3526 – 35283STE → GTG in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti3592 – 35921D → E in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti3598 – 35992LE → PQ in CAB76253. (PubMed:10669599)Curated
    Sequence conflicti3701 – 37011E → D in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti3857 – 38571H → N in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti3891 – 38911Y → H in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti3997 – 39971L → F in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti4130 – 41301H → Q in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti4229 – 42291Q → H in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti4330 – 43301I → T in BAA90301. (PubMed:10629221)Curated
    Sequence conflicti4512 – 452918QLARF…PLDVY → SWLASMPRLQALAHWMCT in BAA90301. (PubMed:10629221)CuratedAdd
    BLAST
    Sequence conflicti6650 – 66501E → K in AAF62351. (PubMed:11062264)Curated
    Sequence conflicti6650 – 66501E → K in AAF44704. (PubMed:11062264)Curated
    Sequence conflicti7412 – 74121T → S in AAC23965. (PubMed:9548712)Curated
    Sequence conflicti7450 – 74501A → T in AAC23965. (PubMed:9548712)Curated
    Sequence conflicti7454 – 74541G → A in AAC23965. (PubMed:9548712)Curated
    Sequence conflicti7525 – 75251D → G in AAC23965. (PubMed:9548712)Curated
    Sequence conflicti7532 – 75321T → P in AAC23965. (PubMed:9548712)Curated
    Sequence conflicti7537 – 75371A → P in CAB93524. (PubMed:10731132)Curated
    Sequence conflicti7552 – 75521V → A in AAC23965. (PubMed:9548712)Curated
    Sequence conflicti10456 – 104572KI → EF in AAC23963. (PubMed:9548712)Curated
    Sequence conflicti11204 – 112074VPYE → LPFQ in CAB93524. (PubMed:10731132)Curated
    Sequence conflicti11217 – 112171L → I in CAB93524. (PubMed:10731132)Curated
    Sequence conflicti11444 – 114441V → T in AAC23964. (PubMed:9548712)Curated
    Sequence conflicti11460 – 114612DG → KK in AAC23964. (PubMed:9548712)Curated
    Sequence conflicti11863 – 118631Q → H in CAB93524. (PubMed:10731132)Curated
    Sequence conflicti13709 – 137091K → T in CAB96531. (PubMed:10934048)Curated
    Sequence conflicti13713 – 137153KSP → ESR in CAB96531. (PubMed:10934048)Curated
    Sequence conflicti13723 – 137231Q → S in CAB96531. (PubMed:10934048)Curated
    Sequence conflicti14433 – 144331D → K in AAM11102. (PubMed:12537569)Curated
    Sequence conflicti14436 – 144361S → K in AAM11102. (PubMed:12537569)Curated
    Sequence conflicti15987 – 159871V → A in CAB43739. (PubMed:10934048)Curated
    Sequence conflicti17206 – 172061F → C in CAB93524. (PubMed:10731132)Curated
    Sequence conflicti18065 – 180651E → R in CAB96427. (PubMed:10934048)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 5756QRQNP…TTQRQ → NKVSSLYNDVMNIFQSFIKL KMDINVVQERLKQEQRQKEQ RERDARDQAEREKAIKEAEA KERLHREEQSRLENQRQQAA IEQAQRELAARELALREQAV REEEARLQAIREQATREQLA REQAAREEELRIQSLRDIAR REEEVRLQNIRDEETRIRRE EEERIRRENESRSKREEEAR IQREEITRLQTLRDQVDQQR IVTENIRKDIQVNSIFTELR YASPLFTRPLKDAVSREGDR FVFECEVTGTPEPAVEWFKD GISIQTNSDYKTTFDKGICR LVIEETFAADSARFSCRASN LVGTCDTNATLSVRENAAEV QLVPPRILRFLQSGKATEGS SFQFACVVAGVPLPTVQWFK NDKCIDDSPDYVISYNNGEA TLKFEEVFLEDDAVYTCSAS NPAGIEHCSASLIVEPLEPT ELPSFKVPLSNAMARVGQKI KLEAIVGGIPRPEVYWLHNG KPFQPRDSKYEYGRVTLIIP QAYPNDAGSYVLSAKNLAGE AYTSCNVIVKGRLPNETSDS EMASDIEPIKPAVHLPLKDV SIFEGKPVRLDCVIVGQPEP EVIWYHNERPVKESADVQLL FQGDRCSLIIQEVYQEDAGH YKVVAINSAGEASSSCELKV TPLNQAEPATRAQAERQSLP KDSQPKFERLLSDVLADEGE QVVLEVQASGDQPLTAQWFL TNKELQLDQRITTQSDSELG VFKLILNNVSGDDKGVYTVK VTNPAGDAKCFSHLIVKSVN APENRRSSQSSVEIIERHQC PEFKELFSDKQGEIDEVIKF ECIVKGKPTPKVHWFFNDQP VHGHNFLVSTSGERQVLTIQ KLTHDAVGKISCVAENEAGK ATCVAFLNIRGSGLPASSDV QTVSQEHNTESSRVTIKKQT FTTTSTSQVNSYEGNAPQTE VHHSSAHIDQSLKQLGQQRP EIVESHHYQELHKSKEMSSP TVQQKSFSFIQSSGANGQSA VAIPDSPTRLRREIAPRFTT PLSGKIVDQGADVSMEAIYD GFPSPEIKVEKNGGQLFEDA HTRISNKCNRVTIELKQVGV GDAGRYAVTASNTVGQSTST ADLVVKKTIFPPVFGRRLQA QVSKKGEKLTMEVEVTGLPE PTVTWLKDDKPLKDAGISEH RLLAQGNSYRLIIEKAQTTD SGKYMVRATNAGGEAKSIAD CAILEPSPERLQEVVKTIVY ETGPVAPASEFKTEVQKQIQ NSENQQSYQNSQTEVTSAND LHGLSESKVITEHRCTTEAT MRLEHKSNYLDLPELTTRPK TPTTNDTITITTNTATVSMD QPDLTQPTITNTTTTNTTKV PPPVPPKPCTPVVATTFGQQ QQQPPQTLTSTRYEQSEHKS TTSSSSFDYFKKIDEETIIQ RPNPLTFKPLDTVVRQPQAQ SLAEELRSLNLIPGDAPEFC YSPKTERSEPKIPLITEKIK ILSEVQPKEPPPQGGVPVFP PPLGLQTVQHESTTTKEVKV EYGQPIVRPAAVLATPAQQN PRSPSPKPSAEGVAMSRLWT PTGVTGYTSDVEQKSEKTVI SKLATPTPTKELNAPFLVNQ IAKSIPPTTAPVTHLVNVEL EPGTPPEICFAPKVEETRRR SLVETMEQKLEQNLIQGPSK VLPHSVPTLTPNTAAPVQPK PLGNTTYRPPPPVLPTRLGV YESDYESDRYKYSGSESDVE PGIRKQPQLTTMETSFKSSG YTADTEEHSSYRKSESSFYE TKSSSTMGGAPQLQTQFPKL QPEPPAPIYFTAKPQPQVPP QVPPSQSNVSSQEAKVRIRS SLCLSVCRYYCRSLSLLLAL G in isoform B. 1 PublicationVSP_052098Add
    BLAST
    Alternative sequencei586 – 66378EPIPG…PLAAS → G in isoform B. 1 PublicationVSP_052099Add
    BLAST
    Alternative sequencei1106 – 111813GEAQQ…MIVET → A in isoform B. 1 PublicationVSP_052100Add
    BLAST
    Alternative sequencei4751 – 47533MIF → QPG in isoform B. 1 PublicationVSP_052101
    Alternative sequencei4754 – 483582Missing in isoform B. 1 PublicationVSP_052102Add
    BLAST
    Alternative sequencei4794 – 47963KRR → SKD in isoform A. 2 PublicationsVSP_052103
    Alternative sequencei4797 – 1807413278Missing in isoform A. 2 PublicationsVSP_052104Add
    BLAST
    Alternative sequencei6626 – 66349EKEQGVPPQ → GK in isoform B. 1 PublicationVSP_052105
    Alternative sequencei7030 – 7213184Missing in isoform B. 1 PublicationVSP_052106Add
    BLAST
    Alternative sequencei7214 – 72185GNPIP → NVKIQ in isoform B. 1 PublicationVSP_052107
    Alternative sequencei7577 – 759216TSQII…THVKI → RSTLSLFNYITFT in isoform B. 1 PublicationVSP_052108Add
    BLAST
    Alternative sequencei9111 – 91144NVSE → NVSEVNVYEQTKAIQDQNKH GLFVKVSKNSDTSKAYLTTI QSTFLKEDILPKPNILQ in isoform B. 1 PublicationVSP_052109
    Alternative sequencei9329 – 9525197VKGNK…ETVTE → GGIPYVQITVEEAKLVNTRA DVEENITSVTTEQPNMCIAA SIQLPAIEEKKLENALQTPQ FASESILKTSPQISRNAHFE TRTHEEEYSTTTESLVTTQA LRDDIDSTQKNVMQDVQMYK HFATKSLDKTVKVETDTNQA TDTTHIKQKTPTHKLASSTT QITESPEIIKTIETISEDGS PSKKMIRTRLIKKVKGN in isoform B. CuratedVSP_052110Add
    BLAST
    Alternative sequencei9335 – 111801846Missing in isoform D. CuratedVSP_052111Add
    BLAST
    Alternative sequencei9526 – 112491724Missing in isoform B. CuratedVSP_052112Add
    BLAST
    Alternative sequencei14333 – 14478146Missing in isoform B. CuratedVSP_052113Add
    BLAST
    Alternative sequencei14438 – 1445720STKVP…AKVNV → TICKGQC in isoform D. CuratedVSP_052114Add
    BLAST
    Alternative sequencei16100 – 161001K → KTKLYSSRKRRSRRSPVEEA ADELKLQQTVVE in isoform B. CuratedVSP_052115
    Alternative sequencei16100 – 161001K → KVTEETSDQTVQLKKKKKPQ KPVEEAADELKLQQTVVE in isoform E. CuratedVSP_052116
    Alternative sequencei16492 – 164987PGPEDKP → KLLPKQK in isoform B. CuratedVSP_052117
    Alternative sequencei16499 – 1657375Missing in isoform B. CuratedVSP_052118Add
    BLAST
    Alternative sequencei17341 – 173444VVDD → DVVS in isoform B. CuratedVSP_052119
    Alternative sequencei17345 – 17484140Missing in isoform B. CuratedVSP_052120Add
    BLAST
    Alternative sequencei17686 – 18141456GLDIE…KKSSK → DEDEVKRSAENAWGKLLPHQ KKYFEVSMSQLCFYATVFTT PVDQVRPKETPVKRMLPAAR KKPKNQKKKAVPKWRYRSRK RPMAKPTPNPNNPAMSTAFI GFLREYQRRNTIVDVKKRLQ RAAKMWSKLSKAQKNKFRTA VSIAAYSLPSADFPPAPATC HLRRRFAWQHIGHVHRSITQ NCQSRAAPSLGDFSTLLTTP HWAKFQVLKVCNWIFQVQGN PFRSPLLTAHFYLLSFKKHT KLPGHLRGKFLQTGRIGLYL GFYNVGYSEQLRQFVCDEQL YVQIMAVVNLLASWLYLCFS HRWIYDQFVILLYVPLYIYF LILRRHLTKLLNECAGLHKS MQMIMGDRLCAKIHRECIYT LLLIIMSILRLLWQIRIYSV YQSIFIFGVAFIYHFELLFF GNYLIWLSCIFRSLNVFLAK DMRSDRLQILKGVLRQQTII WRVHRTVSRYFALHIISFMI QPGIKICIILKCSGIQMNAQ IISLILHLLLLGLFMIIASN LQKQHRTFQKSYIGLKDDPN YFVLKSWRLLQNRTLPQAFG VTFLRKREKVQYKQDVITML LRFSDSQQVYQQRANCCRFL PAVFITMILFLHKLFSYELQ KESKLVNLLQIEKRTLKSEI ELWNENLTSIYIFLTLVCSL VNKNELWKLINEAQLTYKQL KSLLGKHLVLKCSYDVLIHG LLLILLLAVMVVDIIFFNWP KASGERNTVTLTELHQIFDY LMGIPRLLFVLIMAMRILYH LISAGWLQCLGMLRLQRNLK LYQFQLRSIFYNQKCENILA GHYFKVSYMYFLWMMPFRIA ELMQFLKYDYDELVQKQKSQ EDLEDEAIWEGEENSRQQNL QELLMKPLLILSWHFALWML LLAAAYTQQKEYSTLMAKSW NFKSDENGCEMKEFLDEICW TGHAFKQLDILDLLVCTENE QDCICL in isoform B. CuratedVSP_052121Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB026845 mRNA. Translation: BAA90301.2.
    AJ238575 Genomic DNA. Translation: CAB43710.1.
    AJ238577 Genomic DNA. Translation: CAB43739.2.
    AJ271740 Genomic DNA. Translation: CAB93524.1.
    AJ400900 mRNA. Translation: CAB96426.1.
    AJ400901 mRNA. Translation: CAB96427.1.
    AJ400902 mRNA. Translation: CAB96531.1.
    AE014296 Genomic DNA. Translation: AAF47604.1.
    AF045775 mRNA. Translation: AAC23966.1.
    AF045776 mRNA. Translation: AAC23965.1.
    AF045777 mRNA. Translation: AAC23964.1.
    AF045778 Genomic DNA. Translation: AAC23963.1.
    AJ245406 Genomic DNA. Translation: CAB76253.1.
    AJ012279 mRNA. Translation: CAA09970.1.
    AJ012280 mRNA. Translation: CAA09971.1.
    AF135062 mRNA. Translation: AAF61414.1.
    AF135167 Transcribed RNA. Translation: AAF62351.1.
    AF241648 mRNA. Translation: AAG40155.1.
    AF241649 Genomic DNA. Translation: AAF44704.1.
    BK000146 mRNA. Translation: DAA00021.1.
    AY094749 mRNA. Translation: AAM11102.1. Different initiation.
    PIRiS35341.
    RefSeqiNP_524676.2. NM_079937.3.
    UniGeneiDm.2974.

    Genome annotation databases

    GeneIDi44013.
    KEGGidme:Dmel_CG1915.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB026845 mRNA. Translation: BAA90301.2 .
    AJ238575 Genomic DNA. Translation: CAB43710.1 .
    AJ238577 Genomic DNA. Translation: CAB43739.2 .
    AJ271740 Genomic DNA. Translation: CAB93524.1 .
    AJ400900 mRNA. Translation: CAB96426.1 .
    AJ400901 mRNA. Translation: CAB96427.1 .
    AJ400902 mRNA. Translation: CAB96531.1 .
    AE014296 Genomic DNA. Translation: AAF47604.1 .
    AF045775 mRNA. Translation: AAC23966.1 .
    AF045776 mRNA. Translation: AAC23965.1 .
    AF045777 mRNA. Translation: AAC23964.1 .
    AF045778 Genomic DNA. Translation: AAC23963.1 .
    AJ245406 Genomic DNA. Translation: CAB76253.1 .
    AJ012279 mRNA. Translation: CAA09970.1 .
    AJ012280 mRNA. Translation: CAA09971.1 .
    AF135062 mRNA. Translation: AAF61414.1 .
    AF135167 Transcribed RNA. Translation: AAF62351.1 .
    AF241648 mRNA. Translation: AAG40155.1 .
    AF241649 Genomic DNA. Translation: AAF44704.1 .
    BK000146 mRNA. Translation: DAA00021.1 .
    AY094749 mRNA. Translation: AAM11102.1 . Different initiation.
    PIRi S35341.
    RefSeqi NP_524676.2. NM_079937.3.
    UniGenei Dm.2974.

    3D structure databases

    ProteinModelPortali Q9I7U4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 68776. 3 interactions.
    IntActi Q9I7U4. 1 interaction.
    MINTi MINT-1723019.

    Protein family/group databases

    MEROPSi I43.001.

    Proteomic databases

    PaxDbi Q9I7U4.
    PRIDEi Q9I7U4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 44013.
    KEGGi dme:Dmel_CG1915.

    Organism-specific databases

    CTDi 44013.
    FlyBasei FBgn0086906. sls.

    Phylogenomic databases

    eggNOGi NOG12793.
    InParanoidi Q9I7U4.
    OrthoDBi EOG7327MW.

    Enzyme and pathway databases

    SignaLinki Q9I7U4.

    Miscellaneous databases

    ChiTaRSi SLS. drosophila.
    GenomeRNAii 44013.
    NextBioi 836598.

    Gene expression databases

    Bgeei Q9I7U4.

    Family and domain databases

    Gene3Di 2.60.40.10. 58 hits.
    InterProi IPR010939. DUF1136.
    IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF06582. DUF1136. 13 hits.
    PF00041. fn3. 5 hits.
    PF07679. I-set. 53 hits.
    PF00018. SH3_1. 1 hit.
    [Graphical view ]
    SMARTi SM00060. FN3. 5 hits.
    SM00409. IG. 34 hits.
    SM00408. IGc2. 15 hits.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 3 hits.
    SSF50044. SSF50044. 1 hit.
    PROSITEi PS50853. FN3. 5 hits.
    PS50835. IG_LIKE. 51 hits.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Requirements of Kettin, a giant muscle protein highly conserved in overall structure in evolution, for normal muscle function, viability, and flight activity of Drosophila."
      Hakeda S., Endo S., Saigo K.
      J. Cell Biol. 148:101-114(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, TISSUE SPECIFICITY.
    2. "Drosophila D-titin is required for myoblast fusion and skeletal muscle striation."
      Zhang Y., Featherstone D., Davis W., Rushton E., Broadie K.
      J. Cell Sci. 113:3103-3115(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM D), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-187, NUCLEOTIDE SEQUENCE [MRNA] OF 4789-4963 AND 13411-13939 (ISOFORMS B/C/D/E), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 15913-16691 (ISOFORM E), NUCLEOTIDE SEQUENCE [MRNA] OF 18064-18141 (ISOFORMS C/D/E), FUNCTION, TISSUE SPECIFICITY.
      Strain: Berkeley1 Publication and Oregon-R.
      Tissue: EmbryoImported, LarvaImported and Ovary1 Publication.
    3. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley1 Publication.
    4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING (ISOFORMS A AND C).
      Strain: Berkeley.
    5. "Human autoantibodies reveal titin as a chromosomal protein."
      Machado C., Sunkel C.E., Andrew D.J.
      J. Cell Biol. 141:321-333(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-880 (ISOFORMS A/C/D/E), NUCLEOTIDE SEQUENCE [MRNA] OF 7219-7572 (ISOFORMS B/C/D/E), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10456-10723, NUCLEOTIDE SEQUENCE [MRNA] OF 11358-11461 (ISOFORMS B/C/D/E), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    6. "Sequence and expression of the kettin gene in Drosophila melanogaster and Caenorhabditis elegans."
      Kolmerer B., Clayton J., Benes V., Allen T., Ferguson C., Leonard K., Weber U., Knekt M., Ansorge W., Labeit S., Bullard B.
      J. Mol. Biol. 296:435-448(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3999, FUNCTION, TISSUE SPECIFICITY.
      Strain: Berkeley1 Publication.
    7. "Association of kettin with actin in the Z-disc of insect flight muscle."
      van Straaten M., Goulding D., Kolmerer B., Labeit S., Clayton J., Leonard K., Bullard B.
      J. Mol. Biol. 285:1549-1562(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 371-500 AND 3126-3354, ACTIN-BINDING, SUBCELLULAR LOCATION.
    8. "Kettin, a large modular protein in the Z-disc of insect muscles."
      Lakey A., Labeit S., Gautel M., Ferguson C., Barlow D., Leonard K., Bullard B.
      EMBO J. 12:2863-2871(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1691-2214, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    9. "D-Titin: a giant protein with dual roles in chromosomes and muscles."
      Machado C., Andrew D.J.
      J. Cell Biol. 151:639-652(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3091-3407, NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 6635-7000, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, IDENTIFICATION (ISOFORMS A AND B), DEVELOPMENTAL STAGE, DISRUPTION PHENOTYPE.
      Tissue: MuscleImported.
    10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 13581-14436 (ISOFORMS B/C/D/E).
      Strain: Berkeley1 Publication.
      Tissue: Ovary1 Publication.

    Entry informationi

    Entry nameiTITIN_DROME
    AccessioniPrimary (citable) accession number: Q9I7U4
    Secondary accession number(s): O76275
    , O76276, O76277, O76278, O96767, O96768, Q7KA82, Q7KAJ1, Q7KPQ8, Q7RTL4, Q8T3N3, Q9N2P7, Q9N680, Q9N9Y5, Q9N9Y6, Q9N9Y7, Q9NFS3, Q9NJP4, Q9NL88, Q9UB79, Q9W055, Q9XZT9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2006
    Last sequence update: March 18, 2008
    Last modified: October 1, 2014
    This is version 111 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3