SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9I7U4

- TITIN_DROME

UniProt

Q9I7U4 - TITIN_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Titin

Gene
sls, titin, CG1915
Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Key component in the assembly and functioning of adult and embryonic striated muscles and muscle tendons. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.7 Publications

GO - Molecular functioni

  1. actin binding Source: UniProtKB
  2. structural constituent of muscle Source: UniProtKB

GO - Biological processi

  1. locomotion Source: UniProtKB
  2. mesoderm development Source: FlyBase
  3. mitotic chromosome condensation Source: UniProtKB
  4. muscle attachment Source: UniProtKB
  5. muscle organ development Source: FlyBase
  6. myoblast fusion Source: UniProtKB
  7. regulation of hemocyte proliferation Source: FlyBase
  8. sarcomere organization Source: UniProtKB
  9. sister chromatid cohesion Source: UniProtKB
  10. skeletal muscle tissue development Source: UniProtKB
  11. somatic muscle development Source: BHF-UCL
  12. visceral muscle development Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Enzyme and pathway databases

SignaLinkiQ9I7U4.

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Titin
Alternative name(s):
D-Titin
Kettin
Gene namesi
Name:sls
Synonyms:titin
ORF Names:CG1915
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0086906. sls.

Subcellular locationi

Cytoplasm. Nucleus. Chromosome
Note: Uniformly distributed along condensed mitotic chromosomes.4 Publications

GO - Cellular componenti

  1. condensed nuclear chromosome Source: UniProtKB
  2. microtubule associated complex Source: FlyBase
  3. sarcomere Source: UniProtKB
  4. Z disc Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Flies exhibit chromosome undercondensation, chromosome breakage, loss of diploidy, and premature sister chromatid separation. They also exhibit defects in myoblast fusion, muscle organization and gut morphogenesis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 1814118141TitinPRO_0000247656Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi393 ↔ 445 By similarity
Disulfide bondi1312 ↔ 1365 By similarity
Disulfide bondi1446 ↔ 1499 By similarity
Disulfide bondi1579 ↔ 1632 By similarity
Disulfide bondi1846 ↔ 1899 By similarity
Disulfide bondi2111 ↔ 2164 By similarity
Disulfide bondi2775 ↔ 2828 By similarity
Disulfide bondi3152 ↔ 3205 By similarity
Disulfide bondi3560 ↔ 3613 By similarity
Disulfide bondi3698 ↔ 3751 By similarity
Disulfide bondi3832 ↔ 3885 By similarity
Disulfide bondi3976 ↔ 4029 By similarity
Disulfide bondi4625 ↔ 4676 By similarity
Disulfide bondi6557 ↔ 6608 By similarity
Disulfide bondi6964 ↔ 7016 By similarity
Disulfide bondi16940 ↔ 16989 By similarity
Disulfide bondi17494 ↔ 17542 By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ9I7U4.
PRIDEiQ9I7U4.

Expressioni

Tissue specificityi

Expressed in the mesoderm at stage 11, several hours before myoblast fusion, and persists in most muscle cells, somatic, visceral and pharyngeal muscles and their precursors, until the third instar. Also expressed in adult flight muscle Z-disks.6 Publications

Developmental stagei

Expressed both maternally and zygotically.1 Publication

Gene expression databases

BgeeiQ9I7U4.

Interactioni

Protein-protein interaction databases

BioGridi68776. 3 interactions.
IntActiQ9I7U4. 1 interaction.
MINTiMINT-1723019.

Structurei

3D structure databases

ProteinModelPortaliQ9I7U4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 17792Ig-like 1Add
BLAST
Domaini255 – 34389Ig-like 2Add
BLAST
Domaini372 – 46190Ig-like 3Add
BLAST
Domaini471 – 55989Ig-like 4Add
BLAST
Domaini618 – 70891Ig-like 5Add
BLAST
Domaini751 – 84292Ig-like 6Add
BLAST
Domaini890 – 98192Ig-like 7Add
BLAST
Domaini1024 – 111592Ig-like 8Add
BLAST
Domaini1158 – 124992Ig-like 9Add
BLAST
Domaini1291 – 138191Ig-like 10Add
BLAST
Domaini1424 – 151592Ig-like 11Add
BLAST
Domaini1558 – 164386Ig-like 12Add
BLAST
Domaini1691 – 178191Ig-like 13Add
BLAST
Domaini1824 – 191794Ig-like 14Add
BLAST
Domaini1958 – 205093Ig-like 15Add
BLAST
Domaini2089 – 218092Ig-like 16Add
BLAST
Domaini2222 – 231392Ig-like 17Add
BLAST
Domaini2356 – 244994Ig-like 18Add
BLAST
Domaini2488 – 258194Ig-like 19Add
BLAST
Domaini2622 – 271594Ig-like 20Add
BLAST
Domaini2754 – 284491Ig-like 21Add
BLAST
Domaini2891 – 298393Ig-like 22Add
BLAST
Domaini3029 – 311688Ig-like 23Add
BLAST
Domaini3130 – 322192Ig-like 24Add
BLAST
Domaini3263 – 335492Ig-like 25Add
BLAST
Domaini3401 – 349494Ig-like 26Add
BLAST
Domaini3539 – 362587Ig-like 27Add
BLAST
Domaini3676 – 376792Ig-like 28Add
BLAST
Domaini3811 – 390191Ig-like 29Add
BLAST
Repeati3910 – 394435TPR 1Add
BLAST
Domaini3954 – 404794Ig-like 30Add
BLAST
Domaini4092 – 418190Ig-like 31Add
BLAST
Domaini4394 – 448289Ig-like 32Add
BLAST
Repeati4403 – 443836TPR 2Add
BLAST
Domaini4497 – 458589Ig-like 33Add
BLAST
Domaini4604 – 469289Ig-like 34Add
BLAST
Domaini4703 – 479189Ig-like 35Add
BLAST
Repeati5575 – 561339TPR 3Add
BLAST
Domaini6536 – 662489Ig-like 36Add
BLAST
Domaini6633 – 672896Ig-like 37Add
BLAST
Domaini6741 – 683090Ig-like 38Add
BLAST
Domaini6841 – 692989Ig-like 39Add
BLAST
Domaini6942 – 703493Ig-like 40Add
BLAST
Domaini7066 – 715186Ig-like 41Add
BLAST
Domaini7189 – 727991Ig-like 42Add
BLAST
Repeati11872 – 1190534TPR 4Add
BLAST
Repeati13566 – 1359934TPR 5Add
BLAST
Repeati14904 – 1493633TPR 6Add
BLAST
Domaini16396 – 1647075SH3Add
BLAST
Domaini16501 – 1659090Ig-like 43Add
BLAST
Domaini16625 – 1671995Ig-like 44Add
BLAST
Domaini16728 – 1681184Ig-like 45Add
BLAST
Domaini16822 – 1691695Ig-like 46Add
BLAST
Domaini16919 – 1700183Ig-like 47Add
BLAST
Domaini17007 – 1709185Ig-like 48Add
BLAST
Domaini17097 – 1718084Ig-like 49Add
BLAST
Domaini17184 – 1727087Ig-like 50Add
BLAST
Domaini17277 – 1736387Ig-like 51Add
BLAST
Domaini17374 – 1746794Fibronectin type-III 1Add
BLAST
Domaini17473 – 1755886Ig-like 52Add
BLAST
Domaini17563 – 1765391Ig-like 53Add
BLAST
Domaini17660 – 1775596Fibronectin type-III 2Add
BLAST
Repeati17694 – 1772835TPR 7Add
BLAST
Domaini17760 – 17861102Fibronectin type-III 3Add
BLAST
Domaini17862 – 1795897Fibronectin type-III 4Add
BLAST
Domaini17982 – 1807897Fibronectin type-III 5Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili4204 – 422926 Reviewed predictionAdd
BLAST
Coiled coili7621 – 766343 Reviewed predictionAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi2 – 6059Gln-richAdd
BLAST
Compositional biasi4979 – 5300322Gln-richAdd
BLAST
Compositional biasi5299 – 64161118Glu-richAdd
BLAST
Compositional biasi6294 – 631825Lys-richAdd
BLAST
Compositional biasi7346 – 7451106Glu-richAdd
BLAST
Compositional biasi9327 – 163567030Glu-richAdd
BLAST
Compositional biasi9386 – 113261941Lys-richAdd
BLAST
Compositional biasi11740 – 12109370Lys-richAdd
BLAST
Compositional biasi14784 – 15234451Lys-richAdd
BLAST
Compositional biasi17528 – 17651124Thr-richAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.
Contains 7 TPR repeats.

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Repeat, SH3 domain, TPR repeat

Phylogenomic databases

eggNOGiNOG12793.
InParanoidiQ9I7U4.
OrthoDBiEOG7327MW.

Family and domain databases

Gene3Di2.60.40.10. 58 hits.
InterProiIPR010939. DUF1136.
IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF06582. DUF1136. 13 hits.
PF00041. fn3. 5 hits.
PF07679. I-set. 53 hits.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 5 hits.
SM00409. IG. 34 hits.
SM00408. IGc2. 15 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 3 hits.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50853. FN3. 5 hits.
PS50835. IG_LIKE. 51 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform C1 Publication (identifier: Q9I7U4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQRQNPNPYQ QQNQQHQQVQ QFSSQEYSHS SQEQHQEQRI SRTEQHVQRS      50
QVTTQRQVQQ HHGGSIGGAY VPPSLTHVYA QGDISPPVFE QIFKNARFAQ 100
GGNALFEGRL RGNPKPFVTW TRKGAPLLES QKFRMSYNEA TGDVSLLINQ 150
IGPGDEGEYT CTARNQYGEA ICSVYIQPEG APMPALQPIQ NLEKNIYSNG 200
YSYTSIEEEF RVDTFEYRLL REVSFREAIT RRSGYEQDSQ LSQELDRNQG 250
PAQAPQISQK PRSSKLIEGS DAVFTARVGS NPKPRLTWFH NGQRLVASQK 300
YEISYSSGVA TLRVKNATAR DGGHYTLLAE NLQGCVVSSA VLAVEPAAET 350
AYEPKPVDVM AEQLEAGKAL PPAFVKAFGD REITEGRMTR FDCRVTGNPY 400
PEVFWLINGR QVRDDASHKI LVNESGSHSL MITNVTRLDA GAVQCLARNK 450
AGEVAIEAQL NVLEKEQVVA PQFVQRFSTM TVREGEPITM SANAIGTPQP 500
RITWQKDGVQ ISSTAERFVG IDGGATCLEI PRVTANDAGW YQCTAQNIAG 550
STANRARLYV EVPREQPNYE QRRLNLPRPT KVIEPEPIPG PEIIYLRHVE 600
RAKPHLRPGE EDRVYPPPQF IIPLQNVQQT EGGRVHMEAR IEPVGDPTMV 650
VEWYLNGRPL AASARATSVF KFGFIALDLL SIMGHDSGEY MCRVTNASGV 700
AESRAILSVV QRPSIEQSSQ NPNSLQYINQ LEDYSRYQRT ESIDEQLNQA 750
PQFIRPLRDL GEFEEGKNVH FEAQVTPVND PSMRVEWYKD GLPITASSRI 800
TAIFNFGYVS LNILHLRAED AGTYTVRAVN RIGEAISQSS IRVHSRSQVT 850
ADLGIPEQQR YIEKVEELED YRKSQQRRHV QEAAEAIAPP QFKTPIQNQL 900
DLREHAHAHF EARLEPVGDS TMRVEWLKDG QPLEASSRIT TYHNFGYVAL 950
TIKQLTIYDA GTYTCRAYNA MGQDTTVAQL TVISKNEIVS ESQHPGGLQK 1000
IQHLEDSSRY GRREEEETYI TQAPRFLGPL KGTTKILEGQ RAHFEARVEP 1050
QSDLGLVIEW YHNGRSITAA NRIQTYYDFG YVALDISQVR AEDAGVYLVV 1100
ARNKLGEAQQ QATMIVETRS SIDTSSMHRG LYEKTQNLEN KPFVEPQYDI 1150
EEISKSKPVF VTPLSDPKPI HDGKNIHLEC RLEPMGDPTM RVEWFHNGRP 1200
VTVGSRFRTY YDFGFVALDI IKATAADSGE YTVRATNHLG TAHTSACVRV 1250
IDHTDVVTET QNEQSLEQIQ LLEDSRRRHH QEEDITIMQA PQFTRGLHNI 1300
ETIEGTNVHL ECRLQPVGDP SMRIEWFVNG KPVKTGHRFR PAYEFDYVAL 1350
DLLGCYAIDS GVYTCQARNQ LGEAVTSCSV RIIAKNDLIL ETQNESGLQK 1400
IQYLEDSTRH RRSEFVDEVV NIRPRFLTHP KSLTNTREGG HAHFECKIEP 1450
VTDPNLKVEW FKNGRPITVG HRFRPIHDFG YVALDIVHLI AEDSGVYTCR 1500
AVNLIGSDET QVELQCRSGE QIVTVTQNEA GLEQIHYLED RSRYTRREEI 1550
DESTKQAPVF TTSLKNVEIK ENQRAHFECR LIPVSDPSMR VEWYHNNLPL 1600
KSGSRFTETN NFGFVALDIM STLPEDAGTY TCRAYNAVGE AITSAVAVVH 1650
TKKSIYLESQ HETALPRLQH LEDGSKRQRI SVQDEFVSQA PVFTMPVRDV 1700
RVAENQAVHF EARLIPVGDP KLTVEWLRNG QPIEASNRTT TMHDFGYVAL 1750
NMKYVNPEDS GTYTCRAVNE LGQAVTSASL IVQSKTSIQL ETQHEAAMHK 1800
IHQLEDHSRY QRREEEEYTV TTAPVFVTKL IGPSNLVEGQ SAHYECRIEP 1850
YPDPNLKVEW FHNGKPLSTG HRFRTTYDFG FAALDILTVY AEDSGEYTCR 1900
VTNNLGEAIN SIVLNVTSRS SIIHETQHEE ALTKIQHLED TSRFQRKTDE 1950
EQFHAERPQF GRPLRNAKVN EGAPVHLEAT LIPVNDPTMK VEWYCNGRPI 2000
QTGHRFKTTY DFGFVALDIL YAHAEDTGTY MCKAKNAIGE AVTTCAVNVT 2050
ANKTLDLDTL DAQRLEKIRQ LETYAPPPKP VVEEKGQKPI FLTPLSNLEH 2100
LKEGEHAHLE CRVEPINDPN LKIEWFCNGK QLPTGHRYRT THDFGYVALD 2150
ILYVYGEDTG TYICKATNQL GEAVNTCNVR VLNRRSMILD TQHPDALEKI 2200
QKLESKVPNA RTEVGDAPIS PPHFTAELRG STEIYEGQTA HFEAQVAPVH 2250
DPNLRIEFYH NGKPLPSASR FHITFDFGYV SLDITHAVAE DAGEYSVRAV 2300
NALGQAVSST NLRVIPRGTI ISDTQHPEGL EKIRKLESTA PHQRQEPETP 2350
GTRQRPVFTQ PLQNIDRINE HQTAHFEARL IPVGDPNLKV EWYRNEKIIE 2400
DSSRITKQHD FGFVSLDISH IRKEDEGVYM CRAVNPLGEA VTTASMRVVS 2450
EASIQMDTQH PDSISRIHQL EKPLAPRPTE PERLFEKPIF TQLLTGPSEL 2500
WEGTHAHFEA RVVPVGDPSL KFEWFINGVE LQMGSRLRTT HDFGFVTLDI 2550
TAVVPEDAGV YMCRAYNAAG EAVSSTAMKV KTKSNIDGQP LIPESWEAIR 2600
LKEAAMNRVP EMFVDSTPQQ APVFTTHLQS YDKLHEGQHV LLEAQVEPRA 2650
DPNLRIEWFK NGISLTTGSR IRSTFDFGLV TLSINGLRAD DSAIYTCKAT 2700
NQVGEAVSTS SLKIEDRHWL QAESLHPDSL PRIGELEAPK EGRPEAPEPT 2750
YETPVFITHL NNIECKESDN VRFECNVEPA RDPTMSIEWF YNGQPLQAAA 2800
KFKSIYDFGY CALDLTNSYA ENSGVYTCKA TNSKGSATTS GTLKCTGGKT 2850
MFLDTQHPQG EAGLEAVQET EEELANRYTS KTTKPETQYP PPVWTKPLQA 2900
EFHLSEAQPI HLEANVEPKE DPNLFIEWYF NGKMLNHGSR FKMTSEFGFV 2950
TMDMIEVYAR DQGIYTCKAY NKAGEAFTST TIFCSSKENI IESTQHPKGA 3000
EGLEQIQDLE DSLRKDGSKP EQPDLGIPPR FTTEFVNIAD IGEGELAHFE 3050
ANLIPVGDQS MVIEWFYNGK VLEASHRVRT IYAFGTVALE VLGTKIEDTG 3100
TYTCRATNKH GTAEISCNLE CVDKPRGQKP RFTSHIQPLE GLKDGQSAHF 3150
ECTLIPVNDP DLKVEWYHNG KLMRHSNRIK TVSDFGYVVL DISYLQDHDS 3200
GEYVCRAWNK YGEDFTRTTL NCGGRGGVFY DSLQPDSLQR IRELECPQGQ 3250
QADTSAPLVA EPPKFITQIV DVTKLVEGQS AHFEARLTPI TDPDLVVEWY 3300
FNGKKLPHGH RFRTFHDFGI VILDILYCYE ENSGVYEARA RNKYGEDVTR 3350
ASLKCASKSS LILDSQLPRG MEGGLEKIAN LEYSMVRTRE ETTEETKGKA 3400
PVFTVPLENI ENLREGENAH FEARITPADD PKLKVEWYWN GRPLKAGSRF 3450
RTFCDFGFVI LEISPVYPED SGEYSCRAIN EYGEAVTTAT MKIQGKRSII 3500
MESQLPKGME GTIDRIAELE GLGSRSTEFV PDDDTGKPPE FITSPFDMVI 3550
GENALAHFEC RLQPINDPSM RVDWFHNGKA LWAGSRIKTI NDFGFVILEI 3600
AGCYQRDSGL YTCKATNKHG EATVSCKLQV KGRQGIVMEP QLPSNFRTGT 3650
ESLQKLEETM HKREELVTED EQPNPPKFTE EIKDNLDVPE GGPIHFDCRV 3700
EPVGDPTMRI EWFYNGHVMA TGSRVHQLND FGFIALDVDY IYARDSGEYT 3750
CRATNKWGTA TTSAKVTCKG KHNIVYESQL PEGMTSEKLK ELERGRIPEA 3800
PKVVEEVFGP PKFTTQITSV TVDEAEAVRF ECQVEPKTDP SLRVEWYRNG 3850
KPLPSGHRYR NIFDMGFVSL DILYVYGEDS GEYVCRAINN YGEDRTRATV 3900
SCKKLPTILL QNQVPRGMKR SDALTQMEAT IKKYTSEVHL TEDDLFDPDR 3950
KQPPRFVTQI KEQLTLTEMA VTKFECQLAP VGDPNMKVEW FFNGKPLLHK 4000
NRFQPIYDFG YVAMNFGWVY PEDSGEYVCR ATNLYGKDET RAIIKVSGKP 4050
GIVYDSQLPA HMQSIDRIRE MEASWQVVPD EVDPDAKPRT KPVFVSKLEP 4100
QTVEEGDPAR FCVRVTGHPR PRVMWLINGH TVVHGSRYKL TNDGMFHLDV 4150
PKTRQYDTGK VEVIARNSVG ESIATTELKV VARSDDYRNV LKNSPRPWYD 4200
YELAAYQKER QENELEKVFD ERKQVLSEQS SHTLKGVEHL KPKQYKPPTP 4250
DWQQNVKAKK SEDYYNKLQT LETEQLLKET NLRRDTHQYA IPGEKVVSSS 4300
QAKGMAQSYE ENLQEKTSTT EVQAAPPKGI AQPSESSVHG REVHMNKQQQ 4350
VQKEIQGDLE ITRKITATET TEVEHKGTIQ ERVVQGPVKP AKAPVFTKKI 4400
QPCRVFENEQ AKFEVEFEGE PNPTVKWYRE SFPIQNSPDL QIHTFSGKSI 4450
LIIRQVFVED SAVFSCVAEN RGGTAKCSAN LVVEERRRAG KGGIQPPSFV 4500
TTIQSTTVAT GQLARFDAKV TGTRPLDVYW LKNGMKIQPS IKFKMLEEDS 4550
VHTLLIIEPF AEDSGRYECV AVNAAGEARC DGDCIVQSPS KPEKPTTPGS 4600
EKAPHIVEQL KSQTVEEGSK VIFRCRVDGK PTPTARWMRG ENFVKPSRYF 4650
QMSRQGEYYQ LVISEAFPED EGTYKCVAEN KLGSIQTSAQ LKVRPIENLD 4700
APPTITALKD VSVTEGMPAQ FKTTVTGKVK ATSVQWFREG QLIPETPDFQ 4750
MIFDGNSAVL LIGTTYEEDS GIFTVRVTSS TGQVESSAKL TVKKRRISAF 4800
QLRTIDSAED ESSSSGREDS APESPHAFQP GQQPGQQFGQ FLGVNGQGQH 4850
QGRSRQKKPK VRSKSLQPAT KVIPWRKSSR PTRGRSLDKG VFLPGFKPEP 4900
VKSWTEETIN LKATPIEKKK PAPKLEAAKV VLKSIKTERD QGIMSLGATL 4950
EQIIAGKTEK EAIPWITMRE KLKAVESVQQ QLNKFDLDEV YLQPLEGQIE 5000
TEGQLPQQAQ VEQVQRTKEI QRLKSMESVE IMEMTDQIDK LITQQQNAKD 5050
LIPWKEMRQQ LKSVQRVTKQ IDKFKIEEVE LRHLQAQQAI TEEYQTGTAE 5100
ETVVMIDESS KGSISKVLRR DEQLQYEDQS NIYKQKFITT EDVNIMHVSE 5150
REKLEAQRLI REQQAVNWRQ QQQRPQLQPL TSVEDTVISQ TSERQKLVQQ 5200
QSFIEEAQRQ QFVQVEDSQM MSLEEYEHQK IINQRTQQEA FSWRQPREPQ 5250
KFIQVEDSTL LHLQERHDTQ EQQLLQQQPV MWDRGRKKPD QPQYVQPQEQ 5300
RVKEEFVEKP KTYEEMHDEL VEPTPIEQPQ PVPVMWERGK KKPQPQEKTF 5350
EEAHDELVEP TPVQQPEPVP VMWERGKKKV AQQETVLSQE VVQTSQVVEQ 5400
QIVEETKKTA VRRVIPPREP EQKVEQVTLK PTPRPRPKEA VKAEEIQLKP 5450
LRSTRPVPQP VEAEQKAYEE ATDELTEEPI PQPQPVMWER GKKKPQKPQE 5500
EVTEIPKTLE IAVDTLEEEV PKPTEPQPQP VLWARGQKKP QKPDEQKQEL 5550
PKSLEIAVDT IEEDLIKPVQ PEPQPVLWER KKKKPQPQDV IEEKLDVAPT 5600
KTYEKAVDVL PDEPKVEEKP EPVLWQRGKK KIPKSEPTEE VHPDEVDAQI 5650
ETVVKEDEMI VEEKRRIKKT KRPKSTKEVT EELFEEQPEE EISPEEEVPQ 5700
KEVIEEIEEI VEEKRRLKKT KKPKLTQQVT EEETPHEEII KESEEVVQEQ 5750
EEIVEEKKKV KKVKKPKTVA EKQLKEEEIP TEETVEEEET AEDQQLVVEE 5800
SKKVKKVKKP TGTVEKTDVE ELPGEEVPVE EVPVEEVPED VAPEEELIEE 5850
QEEIVDQDEI QEQKRKVKKA KKPKKTIEKT EIEIEEDQPE EEVLQEEIIG 5900
EQEEITERQR KVKSIKKPKK VVTEKTVDQT EQPEKPEESQ AEEVKETVTE 5950
EPKKPKPAPE EAKVEQVEKI SLKPAPRKQR LLPEKEQVEE VLLKPVKKIV 6000
AVSEAEQPET PETEFEVKEF AITTTEDILD VTKKRVKKKK PKTKVAAEES 6050
TEEPAEETEE FEEEATQPEE VQPVEEIPEE PQVKEVADER KTAPKPKPRK 6100
EEIIEKVEEV ALKRVTRPKK ELPQEATIEE VRLKPTQRTS IKPEEVKLEE 6150
VDLQHVEKKE DEIVQEEKRK TRKVKKPKHE DLPEIPDAEP TQLEEAEHIE 6200
LEKQPKPEED QPQVPWKRGE KKQPVEEVLE EKKWPSGKRR PLPEQQPEEV 6250
QLKPIPSKPI EEQQKPEKAI PGPQLVPEEK PESEEEELEL EPLKLPEDKK 6300
PKEPKAKKEK KKKPKLKKAT PSVDEVSEEV AEPFDEPIAE EDEVEEMPVD 6350
DVKVVAVSED VLPEEEVVPT EETPEAKQKA HKKRTKRLKE ASVEGQPQLL 6400
EAAIAEIEKV DEISQEISQK TITLLKKTED TRPQFITTEQ LIELDVEDVR 6450
RDLEMKVTSN IIKKEKRRVV LDDSQPLPEL ELITQKRIQE GIDKVADEEL 6500
IEDQQLIQNQ QETTTSEVIG QERKLVKKKK KEIKPPRITE KLRPRQCVPE 6550
EPTVLECKVE GVPFPEIKWY FNDILLFASE KYEITVMEQV AKLKIAKVTP 6600
SDVGVYTCEA KNEAGVATSR TNIILEKEQG VPPQFTKPLK IEFIEEKQPE 6650
RLKVTVTCQV TGKPNPEVKW YRGIEEVIPS ETVQMFYDEK TGDVALEVIN 6700
PTPNEAVVYS VQAQNQFGRA IGNANILSRV DEVPREILKA PTVTPLSAVV 6750
VPTGGTLFFE AKYDGLPRPE VKWMRNGREI IENEETIIET TETTTTIKVV 6800
NMTRKRTGKY EVWAKNKVGE AKSSGSVVVS DQKPDEQIKP PRFIQPLEPK 6850
YFGEHEVAII EAIVESEPLS SFQWFVHNEP IKSSNEVRIV SQANKSTLLI 6900
ENFQSKFVGP FTCRAENVGG SVTSTATVNL IPQEEAEEFE SPRFVEELVQ 6950
PVEVMDGEAL LLTCQVTGKP TPKVEWYHNA EKITENKETT ISQDLQGVCQ 7000
LQITEVFPEN EGQYECVATN KIGKSVSKTN VKIQAFEYIP DSEITGLTGS 7050
EEDLLDRTLS IDEQAPKIIK KLPEKIEPKE GEQAKLEVKV VGKPKPKVKW 7100
LRDDEQIFAS EEYQIENFED GTSVLVINHV YPDDLGTISF EAYNPLGVAV 7150
TTALFAVEGI VGSKDYRKPE WVSQMEEMQV ALKAAKCSPS LLNEMRDCRA 7200
ALGETAKFSI QFAGNPIPDI QWYFNNVQLR ASEKYRMVVQ EQEATLEIMK 7250
ITSEDCGYYN CKLINEIGMT MTRAKFDISS TSTIVEETKA KTTVKKKSGK 7300
KTMVKRSGAS ESQNVQKTEI RIIPTSAVET SMNVIKVKQP VSVLVEKSEI 7350
SEVLVVKDRE VADAEERSSQ LIEEIEEEEE IEEKVQHDEE DEVEVQVEQK 7400
ETYTSSKKIE ITKTVELIRT KISEKIITIE DVQVLSHHEE VQWLLESIEA 7450
ESFGQIGESA LRDLATIGLL LRYGCEHYEI TYMYEQNIFI SLKKPESQSA 7500
LVQLVEREGH EELISQILSE SSNEDETILA ATVGFKAFIR MIQTYEITIE 7550
IVIRKFVRED FISQDWKICG KERIVETSQI IESHEAITHV KIETATTKVE 7600
KLFKKQEQEH VQNLEQQEQV KIQVQTKQIA QMNTKIKKHK KHKQQEQEVS 7650
ETTIQCEQKE TLAHETSAEL PQSETLEQIE ESLSTYETLP IQNLSKDTLQ 7700
TVAVSVTTEL STPSPTASRV QEEILPQKVL AINEEVLPLD EFGLRKESPR 7750
PKENKLTENI EVRLKHALNV SHAKTAESSK ELPSKIPKSV KAQRKMKESR 7800
SLVVEAPNAE EAIEDLKPLK AVSQEVQSDI LFSHEITEEQ HQALETIEKL 7850
KPTSAIEDTV QQKLLSQEEL IIAEVLPSET VGRDVTDVRP PGETISPRLT 7900
PNMSLCITEC QPEDSIGEMQ QAAKERMETP SMSVTESKAV GGQELEVLEN 7950
VDHMPLITQP TKGLADYTIK AEEVPVQVQE IITFDSLERE TVAKTQTAKS 8000
NALELFELSE GLVSSTADSH SPIAEDLPIF EKDVKEATID MQMQHHVTTS 8050
ETVSNENAVK DLKAVDTPKM AEGTLGQSSA LTIGETQQMN LVETTVELIE 8100
PNVESTKPAK GALTEAYGTA ESNEETLLES LGLVPDDNRK IEQGKVNISE 8150
GEYVAKVQTT TVTDTEGEFV SVAPKLVNPK FDFVEQSALQ IKQDTTVEKE 8200
EILSSNIELA PQLATSNMFP AELKVTSIYE VQPGLTSSDI ITEQTKSVSA 8250
NQVFETMSIG VTSKPDMLES TSHIDAFQHP EFKTGDTILD ENQQPLEVTN 8300
VQITESSTDI IDVLPNQKLT KAETVTDGFK YAEGLVVLPM ESTIDKTEDT 8350
KPTAVNADIS MHQQFGTDVR EQEPLESTLT RTEDLKPQTQ TTESQFGLLQ 8400
SLETSSCVTL EGESVLSVKE RHPEQSAAIG TSSALQVANI TRPQHMESLD 8450
RLDEQKVPYY QANVNIGEIT LPNVEKIDSF DVLSDLNTPD YNKSSKGRVQ 8500
LIESTTSLKT TTAVVSESTE ELKDLNITQP VHIKPKPYES DQKISISEQT 8550
NVLEHVSSLN PVLPALETIQ SSIKSLHEIN VRETDILEKE ESLKDVDHIS 8600
GRLAKIILDC TTGIAQVRQE ETLEHEEDLK APLIPLEKAI PASSELHRLP 8650
LTEYVQEQQG TSDMTDFKVS NKCASPNIDH LYETKSSEMI VYDSSINSVD 8700
SEFPAGIVPQ KSLVPFRHTM VTENVAFNAS ENFEILSADQ QIATNVQDSL 8750
SQSIIAEDQI AFETEQNLGL ETTPTHKPKL LKDDQNLHAK LVDEATVYEA 8800
MGQEQKVDKY NIQQAEITHD LPQVYATDLQ QTFEAEKEIT TREQSYVAAT 8850
TDIIPSRLGL AMTTKTHPVE GIDVLLSSPP KPSLAQTNYE ETQHEVRVRE 8900
TQAIEESEEL TDGRLLPVSA VESIDSTFKV TSDSQQPPVF DKELSIPTVS 8950
PLEARAKPSL NLLQGTTTFD VIPLESSVLL KDTHVAVQKA QQEYVAQVES 9000
NKVHVQMDNL VMHKEDIFEN AEIENFCKPI TEGTQLETVV IEVVPIDNVG 9050
GIHLAPQPST LLATLTSTDI VNQSHVIDTQ VPLEMESEAQ APLDNIAQAR 9100
IKSAEDHVHT NVSEVNVYEQ TKAIQDQNKH GLFVKVSKNS DTSKAYLTTI 9150
QSTFLKEDIL PKPNILQDTA QAAADELQSL VTEEVVSVSS IQETYELKIP 9200
LQKTANLTQQ TPQNSVNVCQ QLAYEETPDI AFEPHALTRA TTSSVPTFLK 9250
PAENATVNIY ENIEGHGDFK PGTVNLTSNS NLNSELVVSV VQEVTSVPSL 9300
GSLATVEPQE LKAMPVTKSS TNLAYSEEVK GNKQEFTKIE TVEEDDKQPE 9350
TTVTVEELPY EEEKPEEIQE LPEEVCVVET VTEDGKPKKK KIRTRVIKKV 9400
KGDKQEVTKI ETVEEDDKQP ETTVTVEEVP YEEEKPEEIQ ELPEEVRVVE 9450
TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK IETVEEDDKQ PETTVTVEEV 9500
PYEEEKPEEI QELPEEVRVV ETVTEDGKPK KKKIRTRFIK KVKGDKQEVT 9550
KIETVEEDDK QPETTVTVEE VPYEEEKPEE IQELPEEVRV VETVTEDGKP 9600
KKKKIRTRVI KKVKGDKQEV TKIETVEEDD KQPETTVTVE EVPYEEEKPE 9650
EIQELPEEVR VVETVTEDGK PKKKKIRTRV IKKVKGDKQE VTKIETVEED 9700
DKQPETTVTV EEVPYEEEKP EEIQELPEEV RVVETVTEDG KPKKKKIRTR 9750
VIKKVKGDKQ EVTKIETVEE DDKQPETTVT VEEVPYEEEK PEEIQELPEE 9800
VRVVETVTED GKPKKKKIRT RVIKKVKGDK QEVTKIETAE EDDKQPETTV 9850
TVEEVPYEEE KPEEIQELPE EVRVVETVTE DGKPKKKKIR TRVIKKVKGD 9900
KQEVTKIETV EEDDKQPETT VTVEEVPYEE EKPEEIQELP EEVRVVETVT 9950
EDGKPKKKKI RTRVIKKVKG DKQEVTKIET VEEDDKQPET TVTVEEVPYE 10000
EEKPEEIQEL PEEVRVVETV TEDGKPKKKK IRTRVIKKVK GDKQEVTKIE 10050
TVEEDDKQPE TTVTVEEVPY EEEKPEEIQE LPEEVRVVET VTEDGKPKKK 10100
KIRTRVIKKV KGDKQEVTKI ETVEENDKQP ETTVTVEEVP YEEEKPEEIQ 10150
ELPEEVRVVE TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK IETVEEDDKQ 10200
PKTTVTVEEV PYEEEKPEEI QELPEEVRVV ETVTEDGKPK KKKIRTRVIK 10250
KVKGDNQEVT KIETVEEDDK QPETTVTVEE VPYEEEKPEE IQELPEEVRV 10300
VETVTEDGKP KKKKIRTRVI KKVKGDKQEV TKIETVEEDD KQPETTVTVE 10350
EVPYEEEKPE EIQELPEEVR VVETVTEDGK PKKKKIRTRV IKKVKGDMQE 10400
VTKIETVEED DKQPETTVTV EEVPYEEEKP EEIQELPEEV RVVETVTEDG 10450
KPKKKKIRTR VIKKVKGDKQ EVTKIETVEE DDKQPETTVT VEEVPYEEEK 10500
PEEIQELPEE VRVVETVTED GKPKKKKIRT RVIKKVKGDK QEVTKIETVE 10550
EDDKQPETTV TVEEVPYEEE KPEEIQELPE EVRVVETVTE DGKPKKKKIR 10600
TRVIKKVKGD KQEVTKIETV EEDDKQPETT VTVEEVPYEE EKPEEIQELP 10650
EEVRVVETVT EDGKPKKKKI RTRVIKKVKG DKQEVTKIET VEEDDKQPET 10700
TVTVEEVPYE EEKPEEIQEL PEEVRVVETV TEDGKPKKKK IRTRVIKKVK 10750
GDKQEVTKIE TVEEDDKQPE TTVTVEEVPY EEEKPEEIQE LPEEVRVVET 10800
VTEDGKPKKK KIRTRVIKKV KGDKQEVTKI ETVEEDDKQP ETTVTVEEVP 10850
YEEEKPEEIQ ELPEEVRVVE TVTEDGKPKK KKIRTRVIKK VKGDKQEVTK 10900
IETVEEDDKQ PETTVTVEEV PYEEEKPEEI QELPEEVRVV ETVTEDGKPK 10950
KKKIRTRVIK KVKGDKQEVT KIETVEEDDK QPETTVTVEE VPYEVEKPDE 11000
IQELPEEVRV VETVTEDGKP KKKKIRTRVI KKVKGDKQEV TKIETVEEDD 11050
KQPETTVTVE EVPYEEEKPE EIQELPEEVR VVETVTEDGK PKKKKIRTRV 11100
IKKVKGDKQE VTKIETVEED DKQPETTVTV EEVPYEEEKP EEIQELPEEV 11150
RVVETVTEDG KPKKKKIRTR VIKKVKGDKQ EVTKIETVEE DDKQPETTVT 11200
VEEVPYEEEK PEEIQELPEE VRVVETVTED GKPKKKKIRT RVIKKVKGDK 11250
QEVTKIETVE EDDKQPETTV TVEEVPYEEE KPEEIQELPE EVRVVETVTE 11300
DGKPKKKKIR TRVIKKVKGD KQEVTKIETV EEDDKQPETT VTVEEVPYEE 11350
EKLEEIQELP EEVRVVETVT EDGKPKKKKI RTRVIKKVKG DKQEVTTIET 11400
VEEDDKKAET TVTVEETELS APSVGKVQLK KRVIVQKPED AVTVFELPER 11450
KSVILSEKED GTPTKTVIKT RIIKKIQGPN MEVTKVQTVE EYEKAPQTIV 11500
SVEKFNTPFP ELPEERLSEV VMLPDEVFES EAVDEEGRLK MIKTKKRIIR 11550
KPALDNTEEV TEIGIIEQDN VEPIYSVKIQ ERPLTESKPE DSKLIELPEH 11600
VTELNVILPD GKKKRRTVKS RAFKKSLDDD LDEVTTIHII EEEDKEPLTK 11650
VNIEVVPSDE ISITPIPIEE LPEETVFTEE LDENKKPKKK TTKTRTFKKR 11700
GPDDDEYFQI QTIDEEGKEP ISLIRVVSDE NIADIIDISK LDDEKVLKHK 11750
QKPHKHKDQY YKEYTITEPE EASADALQKP TKDKTPKQKK TLETPIEEVD 11800
ETVIIDEGTG EQTDQIAIKR KPRKVQGNVQ VEAVDEKPIE KKEKAKKKKV 11850
VKTKRDEMDD YIQFLIHQEI PKTVLQPYQR TEMELPQRAR RDSSFKQPVK 11900
LTPMKIEKVE FKKPKMVEIS SVVEFPQMLK LKAPKQRPQE EKKKKNEASF 11950
KNKKLKSWIR FVPYAPYCFP YVVTELETNR EVGELSRNVD EAEEVLKLRP 12000
KKFKHSKPEK AELEEADLGA YESDHSDKSN KELLHPKYKR GKKEKIETPD 12050
ESRKLKFGKG KVPQNEEASE EVNLKPVKLD IAEIEDAEMP VRTQEEEVVK 12100
KKKPKKSSKP EEGLQFEPIE FEEMERTSDI REESDTSVSV DTSTQEKPIY 12150
KKKKKVTPSP QKNQYKILPG QPREFEETPE DDLNLRKRQG ERPDDDKADT 12200
KLKPFYKFEV LDLEPEGVQA ETVPLSETIA KEPKKKRKIK VKTEQEDNTI 12250
EIVPLSPEDN DEQIFEITVT SSEIPQGDAK AKTIGKKKVK RMNKQELDDF 12300
VTELQEEPNQ EVYETRMSDF YEVKLTELPS EMDSDKPTKR ILRHEKGDEV 12350
QVLEIVESVV APGEEPFYEI NVISSANTEG DSEEITTDKI KKKSRKIKKD 12400
DLDAYIQQLI NAEIPVTELE KYEKIDVDGK AKKPKKLKAK TKKPIIDEGE 12450
TLQVGVTEHE PTKKLKTKKP EEKKNVIEKE LAEHEAVPEY DEFLINKTES 12500
ERPQEKRVEE TEKDIVPIVD KVLADLNDCL PFVVVEEDLK DMPLATDVIA 12550
LEDEKIIRKR KVRAKKDSKQ YEIEIIETEK PGDIPDEARV IVITTEVSGD 12600
TIDGPAPSTT EAPKKSVRKV KKEKLKEFIV NIVEEAPLDH VSEIYEDVLR 12650
TPFRESSEKE DIPSFTTTVV EDEIVNPVLP EKIKTVDDVR VPKDKKKKID 12700
NQKKIKISEF EPTPTSEDST IEEYTPKLSE HDEDLQTDEY SVDVKDSLPK 12750
SKKKSTKKQK KESLPGPISL YTIRIEETTP EPITEKIYED GKEVVRVINK 12800
RRIKKKAGPK EYLIEVIETY EDNNPEADVV IRTIETTPSI DSKPQEDHKI 12850
QVVQEKKPKT ESLDNYIQKL IDQEIPQVDH KEFKATVLET SPESKKAKKI 12900
KKHHKKTTEV IDGIPITVIE VTIQETETDD EDFKPDEVTL KEIDHENAEE 12950
APKVLKSKVS EEKPKSKKEK SLEFKIAEED KPKPVLEDIS EDVQVVQIIE 13000
EDGTPKQVEI KKKKVSRKHG PKEQVFEITE TKAIDEPLSE VTVVEITDEQ 13050
PQEEVLPAQE KKPIKKQKKL KPEDVNTYVV KVLEELTEPT QFETIPEDAD 13100
DKPQPVIEDI SENVQVVQII EEDGTPKQVE IKKKKVSPKH GPKEQVFEIT 13150
ETRPSDEPLA EVTIVELTEE GLNKDIVIPQ EKKTVKKPKK LKPEDIQSYV 13200
IRVLEEFNEP QWPASTEKPI IEDIAESIEI VPVTEEDGIT KEVEVKKKKV 13250
SRKQGTKNQV FEIIETKTSD EPLAEVTILE LSGDKSQEVT ILPKEKKPIK 13300
KTIKLKPEDV ESYVVNVLEE FCEPQSFESP EPTEGEAHET KTKTKKPKKP 13350
IVKAPENVIL IEEMAPETVI ENIVNEIGEE VKQVKTTKKL KKKEGPKEYL 13400
IEIKETYEEN KPEGDIEITT TELVPEGSPD ASDDQPVIVV QKIKKKKPVK 13450
DDLDKYIQQL IEQEITKTPL EEYEPTEMDS KKKPKKKVKS HNKKTIEVID 13500
GLPVTIHEFN VEDIVSEPED METPKTLLDE IKEIPQLPDD SSKYLVNISD 13550
EFGEADKPIK QPTQDQPIKK EKPLKKKKDV EYPVSLEAFD HTVKVVSEPT 13600
LEGTVKEVTV KKRKVSRRKG SKDHIFEITE TTSEDRPTAE VTVVELSSDE 13650
VLDSEEKPKH ERKIVKKPKQ LKKDDVEEYI INIIEEFIQP IPVGLVEDEV 13700
EKVQKEETKK PKKSPITYIA TEQEDNDNNY DALVKEDLDQ PIERALEKPS 13750
SPLEYTISVE EDSVGEEQKQ PKPKKISKPK SIKQPSVDKS PDYLVNVISE 13800
ESIIDEPIPE DYVVTEAAEE KPSEEPTFKV EELETEAVEK EVTDDDKGET 13850
TKQSVTKRKI KKLVGPKEEI IEIVETKTGD TPEYEVIVTT EEVQEKSKEA 13900
PEEKKAKTVR KAKKIPKDDL QDYIQKLIEQ DIPKTELEKY EKIDLDEPVK 13950
MKRKPIKKVK QSEEQPKEET EEPIEDKPVE KISEYSEVDS DEPKLTVAVK 14000
EFIPEKPEEK PFEIVVLEET VESKREPDEE GKVREKVVKT KKIKQNRGSV 14050
EVVHDIVEEI DTDTNESVIT VTTTVPTETP DQDQPSVKQK RTKKIKKDEV 14100
EDFVKRVIEE EAPQPEGSVD LVVIEDFVPK PSSEKRKKKP IKDKHTSVEE 14150
ETPHEDEVLL IESVPEDSPL SDDLITVVDS VPIEEEPENK VNQIEDTKKP 14200
EKKKKPKPSA KILEENVPED TVEKPLEALH TDSDLEKPDV QEFSISIKEE 14250
EQKHTHPEKK KSSKISSEQP KQPSTEQYEI SVTEHDLKPE EEKPFTVQVI 14300
QSETNVEETK DDTGKVHKQV TTKRMLRRPA GEGEIEIIEV VRDDQPEAEI 14350
TIVEYEPEPV NQDEKPKEPK KKTRKVKKDD IHDYIQKLIE LETPKTELEK 14400
YEKIEFEPIV KDKPLDSPID VLDESPKEVQ KKDKKSRSTK VPNEETPVQE 14450
QYAKVNVVEE EAPEQPEIPV QILEVKPVEV DVKEVITEDG KPVQEKTTKR 14500
VLKKIGPEEQ TTFKITMIES EDNDSVTVIV DEEPEIASPQ SIEEHPEQSK 14550
EKLAPKPKKT VRKVKKDDLS DYVKKLIEEE IPKVDLEKYE KVEMPEKPVK 14600
LTVSDSIPEE PKPDKSQPIS VLPDTTKPKK TKTPKTPKTE DTDQQVPDEP 14650
TETTVDTTDI PELTPTQTAQ PEDTATAQIT PSAQEEKSTQ DDTKDTIQKT 14700
VKHKKTKPDT QKSVETSELP EVHKDYQISI IHEELVEEEQ PEKILEVRVI 14750
DEVAEVEESQ PIVEEVEDEE PQPATEETVE DVTKPKSKKK KVVKKKTDDH 14800
DELIKKMLEQ EIEKTELEKY EKIEFDVPKK LKPEFAALEP IKIERKEQKP 14850
TKVTILDATD VPKTVKLKPS KRKEKPAEEL TVQLPKFRLK ARMVLVEYPP 14900
APLIPKTTDI GAIKDNGELS RNIEEAEEIL KFKPHKTKKI KKIKDDLEKV 14950
ELEKYEKYIS SEEEPEEKTP YKKPEKAPKP EEKQEDVKLK LGKGKKKPKE 15000
EEAPENVTLK NIPQKPQEVE EEVELKQKPK EVEIVEEQTK KPKDGEFVVE 15050
PFEPSEFDRP EYVPDELEQI EHPEIPEKVK KPSKTKYKPK DKSKSEPETI 15100
VSEIVAGVPK EEEAIPEQDV KFRKPERDAP EETDSEIKLR PVPQASKDEN 15150
PDEQALVTPK AEEPIPQEIE DKAIDDEKKP KKSKPKKVQP KEQEIAKEEP 15200
EEFEVSVKEE EALVDKPIEI EKPKDVKVKE KKPKEAPVSE VVVIEEEPKP 15250
EEVPEEIPVE YKITTTVLEP EDAPKEHQVK VIDFDERQET TEEVIEEKVV 15300
TRKKKPKPQQ PEEFEVTLKE PKEEQIQPDV VSAEISLPIE EPEQKPEQYE 15350
VELKITQTTP EEPNDVQIAV KEKVKTKPVK KVKEDKIVVV EAEEEKQPVE 15400
ETIVEVEKQE EKKKSEKPKS YEFKISETQS IEEKPIEVAE EAPEETPKVV 15450
EKKVAEKFDS YEFTLKETDE EKVITVDDQP EEEAPVEVVF KKKPKEPEAV 15500
EAEFVMTEPK IVEETSVETA IKQKKTKKPK KDEEEAQLAI KVVESEAPVA 15550
EEVFSEAPES KIVEEEVIAE EKPKEFTIRV SESEPKPEEP SVEQFTVKKR 15600
KPSVTFADEP ATEIVIKESK PAEVVTEDAH IKTKKPKKKV TDVEAEELKI 15650
KITEEVPQEI PILEEVSEEE VITETKKTAP VVEEKTYKIG IKETEPEKPA 15700
EAIVEEEEPV VTEPIEEAPK PEVFEEHKVR VIEETPRELV EEVIEEEVKV 15750
IRRKKPKPEI KEEPEAEVTV STPKPVEEVE ATSSIAVIPE QPTEEEAADL 15800
KITIIEEETP PQELVQEIEE IEIVEEPKAP EEQPTDFTFA TKDSEKKPTV 15850
EELPEEQVTI QKKKKKAPVP EVVEEPEAEF LVKPKTPVQE VTEEAKITKS 15900
KKPVKEEEAA AELKVTITEE IPTEPEVQEI IEEIEEIEEE KPAEYVIEVK 15950
ESQPEAVEDK EVSLPKKKPK APIVEEPEAE ITLKPKVKSE EVQEEAKIVK 16000
KKPKKIDEVA VADELTVKVE EEVVPEPIVE EEVIEEFEIK KKPKEPEPED 16050
IVDAAIVKLK KPEPVDADEV VAEVTLKPKA KTEVTEEEFS VDVKLPKEKK 16100
ERPVEIEEEE IIEEAVVIRK KPKKPFEPTV EDLEETEFSL SFKKPHTINE 16150
GVEEAATVLK KRPVKPTTLD EAAAELSIKR QEEEYEEGED IEEFVVSQQR 16200
KPKPLQITEE DEEAYTVKKL KRRKQVDIPE YADVENVTFR ARSTKTKEDV 16250
DQEFNIALDS YAEEEISMSG KVKLKKPIKK TFSEAADEAK IKIIQDFDDG 16300
EEPIIEEIRD DEDTIDEVEE PEEYFVEELP PDEVDFKLKP KKHPKPAYSV 16350
QDEEEEQFLI GIRHPKRDSV TYDEDSLTFK KKRKVVQQLF NEDGASLNIT 16400
REMNVEESEN LNIMYSICNY IADNNEAINL VEGEKVTVVG RHSSEWWYVK 16450
KSTTEEEGWV PAQYLMEPEE YAQYVQNKLH EKIDKLPVFE RPGPEDKPIA 16500
PRFIEKLQPI HTPDGYTVQF ECKVEGNPRP QIAWFRETAI IKPSQDFQMF 16550
YDDDNVATLI IREVFPEDAG QFTVVAKNAA GFTSSTTELI VESPLSDHGS 16600
DATALSRRSM SRESSLADIL EGIPPTFSKK PKAQYVDENT NVILECRLVA 16650
VPEPDIVWTF NGEDIDEEEI KNVRIVTESD MHMYCSVVHI SKVKKSQEGT 16700
YEVIATNREG EARLPITLKV RTTDKEAPQI LEPLRNMVIR EGESVVLSTQ 16750
IVGNPPPKVT WYKDGKPVKN AKSDKDLHTL TLITPQKSEK GEYTVKAVNP 16800
LGSVETTANL TIEEPAGGNA EPPLFVERFE EQNVPQKGEI RLPAKVSGNP 16850
VPEVQWLFNN TPLFPSERIQ QVYDGENIEL IIKDANPETD SGDYKCIASN 16900
PIGKTSHGAR VIVEVDEVTF TKKLKKTITI EEVQSLTLEC ETSHVVTTKW 16950
FFNGKELSGM DHRVVVEDGK THKLVIRNTN LRDSGTYTCK VKKQETQSTV 17000
EVLQRKPDFI KVLEDYEVTE KDTAILDVEL TTEATEVTWY KDGEKITPEN 17050
KNVEFIKDGK ARRLVIRDVT IHDEGQYTCK IEGQECSCEL VVIELPPEIV 17100
EPLNDVAVTK GENAVFEVEL SKGDALVKWF KNGKEIVFNE RIQLAIDGKK 17150
QSLRIVKAKP EDVGEYSVQV GEQTSKAKLT VEEPLVDFVI RLPDITLATK 17200
TTDAEFTVQL SQPDVEVTWC KKGKPIKPNQ KHEVFVEGTV RRLVIHDASD 17250
EDAGEISCVA ENVTSSTKLC VEELKLPPVI TSDKDQTIKV KENDDVTFTV 17300
KYTGVPTPEA CWTTRKVVIP KSKRTIPTID EQSAKLTIKK VVDDDEGEYT 17350
VKLVNPVGEA EASLHLVIMR KPTAPGTPQP LEIMHDSITL YWKAPEDDGK 17400
SEIIEYILEY QDVKEEKWTE IRKIKDTTYT ISKLKIDTEY VFRSIAVNEV 17450
GPSPPSPLSP PIRLVPKVET KAPSVQEPLQ DVVSELDKEV TLSCVFGGIP 17500
EPKVTWKKNG QVFESRSIRY ENRVAKYTIE KTTIETEATY TCVATNEKGS 17550
AETSCRLKLQ QKPVLEVEDK YLTQKLRTGS ILTIPATVRG YPQPTVTWHK 17600
ETIEQKTTKS VTIETTETTS TYTVKKVTRE QSGKYKVTAT NESGTTYVEC 17650
TVQVIDKPSR PQSLEIKDIK KDSIVLEWTP PVDDGGLDIE KYTLEKCDVQ 17700
NNVWMKVSDF NKDIKSYAVQ KLSMNAQYMF RVVAANPIGE SEPTESDPVT 17750
ITKKFEKPSP PRGPTTVSGM NDTSFNLAWE PSETDGGSKI IEYIVEIREE 17800
TETTYRSVGV TLGTVTNIHV EKVVRNKGYF FRIYARNEVG TSEAFETTEK 17850
IVLGRKITPP SPPQNLRAPD VTSRSVTLDW EVPARNGGSE ITGYCVEKRS 17900
STSTNWTKVI TLDAHQLHYT IDNLKEKCEY WFRVSAENEV GLGAPAVTES 17950
ISLKTHASEF ILVVRNCGSY TEFGFLKAVP SPPTGPLEAR VLAANAHIFE 18000
WGLPESDGGA PLLGYHIAIR DMKKTMWIEV GRVPAGVLKF QIRDLQENHE 18050
YMIRIFAKNE IGLSEPLESE EPYKAMTAGH ESLPDEPRTE MSSCNTSSWL 18100
RDHHMDADIH SYARGRLLQR DEYFFRLWAE LPKSKKKKSS K 18141

Note: No experimental confirmation available.

Length:18,141
Mass (Da):2,065,766
Last modified:March 18, 2008 - v3
Checksum:i41CA5977EB611933
GO
Isoform A2 Publications (identifier: Q9I7U4-2) [UniParc]FASTAAdd to Basket

Also known as: Ket, Kettin

The sequence of this isoform differs from the canonical sequence as follows:
     4794-4796: KRR → SKD
     4797-18074: Missing.

Show »
Length:4,863
Mass (Da):548,598
Checksum:iF39A3B9B7230A7E5
GO
Isoform B1 Publication (identifier: Q9I7U4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-57: QRQNPNPYQQ...QRSQVTTQRQ → NKVSSLYNDV...RSLSLLLALG
     586-663: EPIPGPEIIY...YLNGRPLAAS → G
     1106-1118: GEAQQQATMIVET → A
     4751-4753: MIF → QPG
     4754-4835: Missing.
     6626-6634: EKEQGVPPQ → GK
     7030-7213: Missing.
     7214-7218: GNPIP → NVKIQ
     7577-7592: TSQIIESHEAITHVKI → RSTLSLFNYITFT
     9111-9114: NVSE → NVSEVNVYEQTKAIQDQNKHGLFVKVSKNSDTSKAYLTTIQSTFLKEDILPKPNILQ
     9329-9525: VKGNKQEFTK...EVRVVETVTE → GGIPYVQITV...TRLIKKVKGN
     9526-11249: Missing.
     14333-14478: Missing.
     16100-16100: K → KTKLYSSRKRRSRRSPVEEAADELKLQQTVVE
     16492-16498: PGPEDKP → KLLPKQK
     16499-16573: Missing.
     17341-17344: VVDD → DVVS
     17345-17484: Missing.
     17686-18141: GLDIEKYTLE...PKSKKKKSSK → DEDEVKRSAE...TENEQDCICL

Show »
Length:17,970
Mass (Da):2,041,306
Checksum:iC16FBFC3C09569CA
GO
Isoform D1 Publication (identifier: Q9I7U4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     9335-11180: Missing.
     14438-14457: STKVPNEETPVQEQYAKVNV → TICKGQC

Show »
Length:16,282
Mass (Da):1,849,153
Checksum:i8419A8664D293917
GO
Isoform E1 Publication (identifier: Q9I7U4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     16100-16100: K → KVTEETSDQTVQLKKKKKPQKPVEEAADELKLQQTVVE

Show »
Length:18,178
Mass (Da):2,069,971
Checksum:i737C3E6C5D524D9B
GO

Sequence cautioni

The sequence AAM11102.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 5756QRQNP…TTQRQ → NKVSSLYNDVMNIFQSFIKL KMDINVVQERLKQEQRQKEQ RERDARDQAEREKAIKEAEA KERLHREEQSRLENQRQQAA IEQAQRELAARELALREQAV REEEARLQAIREQATREQLA REQAAREEELRIQSLRDIAR REEEVRLQNIRDEETRIRRE EEERIRRENESRSKREEEAR IQREEITRLQTLRDQVDQQR IVTENIRKDIQVNSIFTELR YASPLFTRPLKDAVSREGDR FVFECEVTGTPEPAVEWFKD GISIQTNSDYKTTFDKGICR LVIEETFAADSARFSCRASN LVGTCDTNATLSVRENAAEV QLVPPRILRFLQSGKATEGS SFQFACVVAGVPLPTVQWFK NDKCIDDSPDYVISYNNGEA TLKFEEVFLEDDAVYTCSAS NPAGIEHCSASLIVEPLEPT ELPSFKVPLSNAMARVGQKI KLEAIVGGIPRPEVYWLHNG KPFQPRDSKYEYGRVTLIIP QAYPNDAGSYVLSAKNLAGE AYTSCNVIVKGRLPNETSDS EMASDIEPIKPAVHLPLKDV SIFEGKPVRLDCVIVGQPEP EVIWYHNERPVKESADVQLL FQGDRCSLIIQEVYQEDAGH YKVVAINSAGEASSSCELKV TPLNQAEPATRAQAERQSLP KDSQPKFERLLSDVLADEGE QVVLEVQASGDQPLTAQWFL TNKELQLDQRITTQSDSELG VFKLILNNVSGDDKGVYTVK VTNPAGDAKCFSHLIVKSVN APENRRSSQSSVEIIERHQC PEFKELFSDKQGEIDEVIKF ECIVKGKPTPKVHWFFNDQP VHGHNFLVSTSGERQVLTIQ KLTHDAVGKISCVAENEAGK ATCVAFLNIRGSGLPASSDV QTVSQEHNTESSRVTIKKQT FTTTSTSQVNSYEGNAPQTE VHHSSAHIDQSLKQLGQQRP EIVESHHYQELHKSKEMSSP TVQQKSFSFIQSSGANGQSA VAIPDSPTRLRREIAPRFTT PLSGKIVDQGADVSMEAIYD GFPSPEIKVEKNGGQLFEDA HTRISNKCNRVTIELKQVGV GDAGRYAVTASNTVGQSTST ADLVVKKTIFPPVFGRRLQA QVSKKGEKLTMEVEVTGLPE PTVTWLKDDKPLKDAGISEH RLLAQGNSYRLIIEKAQTTD SGKYMVRATNAGGEAKSIAD CAILEPSPERLQEVVKTIVY ETGPVAPASEFKTEVQKQIQ NSENQQSYQNSQTEVTSAND LHGLSESKVITEHRCTTEAT MRLEHKSNYLDLPELTTRPK TPTTNDTITITTNTATVSMD QPDLTQPTITNTTTTNTTKV PPPVPPKPCTPVVATTFGQQ QQQPPQTLTSTRYEQSEHKS TTSSSSFDYFKKIDEETIIQ RPNPLTFKPLDTVVRQPQAQ SLAEELRSLNLIPGDAPEFC YSPKTERSEPKIPLITEKIK ILSEVQPKEPPPQGGVPVFP PPLGLQTVQHESTTTKEVKV EYGQPIVRPAAVLATPAQQN PRSPSPKPSAEGVAMSRLWT PTGVTGYTSDVEQKSEKTVI SKLATPTPTKELNAPFLVNQ IAKSIPPTTAPVTHLVNVEL EPGTPPEICFAPKVEETRRR SLVETMEQKLEQNLIQGPSK VLPHSVPTLTPNTAAPVQPK PLGNTTYRPPPPVLPTRLGV YESDYESDRYKYSGSESDVE PGIRKQPQLTTMETSFKSSG YTADTEEHSSYRKSESSFYE TKSSSTMGGAPQLQTQFPKL QPEPPAPIYFTAKPQPQVPP QVPPSQSNVSSQEAKVRIRS SLCLSVCRYYCRSLSLLLAL G in isoform B. 1 PublicationVSP_052098Add
BLAST
Alternative sequencei586 – 66378EPIPG…PLAAS → G in isoform B. 1 PublicationVSP_052099Add
BLAST
Alternative sequencei1106 – 111813GEAQQ…MIVET → A in isoform B. 1 PublicationVSP_052100Add
BLAST
Alternative sequencei4751 – 47533MIF → QPG in isoform B. 1 PublicationVSP_052101
Alternative sequencei4754 – 483582Missing in isoform B. 1 PublicationVSP_052102Add
BLAST
Alternative sequencei4794 – 47963KRR → SKD in isoform A. 2 PublicationsVSP_052103
Alternative sequencei4797 – 1807413278Missing in isoform A. 2 PublicationsVSP_052104Add
BLAST
Alternative sequencei6626 – 66349EKEQGVPPQ → GK in isoform B. 1 PublicationVSP_052105
Alternative sequencei7030 – 7213184Missing in isoform B. 1 PublicationVSP_052106Add
BLAST
Alternative sequencei7214 – 72185GNPIP → NVKIQ in isoform B. 1 PublicationVSP_052107
Alternative sequencei7577 – 759216TSQII…THVKI → RSTLSLFNYITFT in isoform B. 1 PublicationVSP_052108Add
BLAST
Alternative sequencei9111 – 91144NVSE → NVSEVNVYEQTKAIQDQNKH GLFVKVSKNSDTSKAYLTTI QSTFLKEDILPKPNILQ in isoform B. 1 PublicationVSP_052109
Alternative sequencei9329 – 9525197VKGNK…ETVTE → GGIPYVQITVEEAKLVNTRA DVEENITSVTTEQPNMCIAA SIQLPAIEEKKLENALQTPQ FASESILKTSPQISRNAHFE TRTHEEEYSTTTESLVTTQA LRDDIDSTQKNVMQDVQMYK HFATKSLDKTVKVETDTNQA TDTTHIKQKTPTHKLASSTT QITESPEIIKTIETISEDGS PSKKMIRTRLIKKVKGN in isoform B. VSP_052110Add
BLAST
Alternative sequencei9335 – 111801846Missing in isoform D. VSP_052111Add
BLAST
Alternative sequencei9526 – 112491724Missing in isoform B. VSP_052112Add
BLAST
Alternative sequencei14333 – 14478146Missing in isoform B. VSP_052113Add
BLAST
Alternative sequencei14438 – 1445720STKVP…AKVNV → TICKGQC in isoform D. VSP_052114Add
BLAST
Alternative sequencei16100 – 161001K → KTKLYSSRKRRSRRSPVEEA ADELKLQQTVVE in isoform B. VSP_052115
Alternative sequencei16100 – 161001K → KVTEETSDQTVQLKKKKKPQ KPVEEAADELKLQQTVVE in isoform E. VSP_052116
Alternative sequencei16492 – 164987PGPEDKP → KLLPKQK in isoform B. VSP_052117
Alternative sequencei16499 – 1657375Missing in isoform B. VSP_052118Add
BLAST
Alternative sequencei17341 – 173444VVDD → DVVS in isoform B. VSP_052119
Alternative sequencei17345 – 17484140Missing in isoform B. VSP_052120Add
BLAST
Alternative sequencei17686 – 18141456GLDIE…KKSSK → DEDEVKRSAENAWGKLLPHQ KKYFEVSMSQLCFYATVFTT PVDQVRPKETPVKRMLPAAR KKPKNQKKKAVPKWRYRSRK RPMAKPTPNPNNPAMSTAFI GFLREYQRRNTIVDVKKRLQ RAAKMWSKLSKAQKNKFRTA VSIAAYSLPSADFPPAPATC HLRRRFAWQHIGHVHRSITQ NCQSRAAPSLGDFSTLLTTP HWAKFQVLKVCNWIFQVQGN PFRSPLLTAHFYLLSFKKHT KLPGHLRGKFLQTGRIGLYL GFYNVGYSEQLRQFVCDEQL YVQIMAVVNLLASWLYLCFS HRWIYDQFVILLYVPLYIYF LILRRHLTKLLNECAGLHKS MQMIMGDRLCAKIHRECIYT LLLIIMSILRLLWQIRIYSV YQSIFIFGVAFIYHFELLFF GNYLIWLSCIFRSLNVFLAK DMRSDRLQILKGVLRQQTII WRVHRTVSRYFALHIISFMI QPGIKICIILKCSGIQMNAQ IISLILHLLLLGLFMIIASN LQKQHRTFQKSYIGLKDDPN YFVLKSWRLLQNRTLPQAFG VTFLRKREKVQYKQDVITML LRFSDSQQVYQQRANCCRFL PAVFITMILFLHKLFSYELQ KESKLVNLLQIEKRTLKSEI ELWNENLTSIYIFLTLVCSL VNKNELWKLINEAQLTYKQL KSLLGKHLVLKCSYDVLIHG LLLILLLAVMVVDIIFFNWP KASGERNTVTLTELHQIFDY LMGIPRLLFVLIMAMRILYH LISAGWLQCLGMLRLQRNLK LYQFQLRSIFYNQKCENILA GHYFKVSYMYFLWMMPFRIA ELMQFLKYDYDELVQKQKSQ EDLEDEAIWEGEENSRQQNL QELLMKPLLILSWHFALWML LLAAAYTQQKEYSTLMAKSW NFKSDENGCEMKEFLDEICW TGHAFKQLDILDLLVCTENE QDCICL in isoform B. VSP_052121Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti7 – 71N → S in CAB76253. 1 Publication
Sequence conflicti382 – 3821E → G in AAC23966. 1 Publication
Sequence conflicti568 – 5681N → S in BAA90301. 1 Publication
Sequence conflicti568 – 5681N → S in AAC23966. 1 Publication
Sequence conflicti568 – 5681N → S1 Publication
Sequence conflicti722 – 7221P → S in CAB76253. 1 Publication
Sequence conflicti875 – 8806QQRRHV → PASVVM in AAC23966. 1 Publication
Sequence conflicti1059 – 10591E → G in CAB76253. 1 Publication
Sequence conflicti1345 – 13451F → L in CAB76253. 1 Publication
Sequence conflicti1405 – 14051E → G in BAA90301. 1 Publication
Sequence conflicti1691 – 16922PV → NS in CAB76253. 1 Publication
Sequence conflicti1779 – 17791S → P in CAB76253. 1 Publication
Sequence conflicti1905 – 19051L → H in BAA90301. 1 Publication
Sequence conflicti1905 – 19051L → H in CAB76253. 1 Publication
Sequence conflicti1952 – 19521Q → H in CAB76253. 1 Publication
Sequence conflicti2050 – 20501T → TVT in CAB76253. 1 Publication
Sequence conflicti2104 – 21041G → R in CAB76253. 1 Publication
Sequence conflicti2661 – 26611N → S in CAB76253. 1 Publication
Sequence conflicti2934 – 29341M → V in CAB76253. 1 Publication
Sequence conflicti3091 – 30944VLGT → EGVR in AAF61414. 1 Publication
Sequence conflicti3091 – 30944VLGT → EGVR in AAG40155. 1 Publication
Sequence conflicti3174 – 31741R → C in CAB76253. 1 Publication
Sequence conflicti3174 – 31741R → C in CAA09971. 1 Publication
Sequence conflicti3303 – 33031G → D in AAF61414. 1 Publication
Sequence conflicti3303 – 33031G → D in AAG40155. 1 Publication
Sequence conflicti3379 – 33813ANL → RGM in CAB76253. 1 Publication
Sequence conflicti3500 – 35023IME → FMD in BAA90301. 1 Publication
Sequence conflicti3526 – 35283STE → GTG in BAA90301. 1 Publication
Sequence conflicti3592 – 35921D → E in CAB76253. 1 Publication
Sequence conflicti3598 – 35992LE → PQ in CAB76253. 1 Publication
Sequence conflicti3701 – 37011E → D in BAA90301. 1 Publication
Sequence conflicti3857 – 38571H → N in BAA90301. 1 Publication
Sequence conflicti3891 – 38911Y → H in BAA90301. 1 Publication
Sequence conflicti3997 – 39971L → F in BAA90301. 1 Publication
Sequence conflicti4130 – 41301H → Q in BAA90301. 1 Publication
Sequence conflicti4229 – 42291Q → H in BAA90301. 1 Publication
Sequence conflicti4330 – 43301I → T in BAA90301. 1 Publication
Sequence conflicti4512 – 452918QLARF…PLDVY → SWLASMPRLQALAHWMCT in BAA90301. 1 PublicationAdd
BLAST
Sequence conflicti6650 – 66501E → K in AAF62351. 1 Publication
Sequence conflicti6650 – 66501E → K in AAF44704. 1 Publication
Sequence conflicti7412 – 74121T → S in AAC23965. 1 Publication
Sequence conflicti7450 – 74501A → T in AAC23965. 1 Publication
Sequence conflicti7454 – 74541G → A in AAC23965. 1 Publication
Sequence conflicti7525 – 75251D → G in AAC23965. 1 Publication
Sequence conflicti7532 – 75321T → P in AAC23965. 1 Publication
Sequence conflicti7537 – 75371A → P in CAB93524. 1 Publication
Sequence conflicti7552 – 75521V → A in AAC23965. 1 Publication
Sequence conflicti10456 – 104572KI → EF in AAC23963. 1 Publication
Sequence conflicti11204 – 112074VPYE → LPFQ in CAB93524. 1 Publication
Sequence conflicti11217 – 112171L → I in CAB93524. 1 Publication
Sequence conflicti11444 – 114441V → T in AAC23964. 1 Publication
Sequence conflicti11460 – 114612DG → KK in AAC23964. 1 Publication
Sequence conflicti11863 – 118631Q → H in CAB93524. 1 Publication
Sequence conflicti13709 – 137091K → T in CAB96531. 1 Publication
Sequence conflicti13713 – 137153KSP → ESR in CAB96531. 1 Publication
Sequence conflicti13723 – 137231Q → S in CAB96531. 1 Publication
Sequence conflicti14433 – 144331D → K in AAM11102. 1 Publication
Sequence conflicti14436 – 144361S → K in AAM11102. 1 Publication
Sequence conflicti15987 – 159871V → A in CAB43739. 1 Publication
Sequence conflicti17206 – 172061F → C in CAB93524. 1 Publication
Sequence conflicti18065 – 180651E → R in CAB96427. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB026845 mRNA. Translation: BAA90301.2.
AJ238575 Genomic DNA. Translation: CAB43710.1.
AJ238577 Genomic DNA. Translation: CAB43739.2.
AJ271740 Genomic DNA. Translation: CAB93524.1.
AJ400900 mRNA. Translation: CAB96426.1.
AJ400901 mRNA. Translation: CAB96427.1.
AJ400902 mRNA. Translation: CAB96531.1.
AE014296 Genomic DNA. Translation: AAF47604.1.
AF045775 mRNA. Translation: AAC23966.1.
AF045776 mRNA. Translation: AAC23965.1.
AF045777 mRNA. Translation: AAC23964.1.
AF045778 Genomic DNA. Translation: AAC23963.1.
AJ245406 Genomic DNA. Translation: CAB76253.1.
AJ012279 mRNA. Translation: CAA09970.1.
AJ012280 mRNA. Translation: CAA09971.1.
AF135062 mRNA. Translation: AAF61414.1.
AF135167 Transcribed RNA. Translation: AAF62351.1.
AF241648 mRNA. Translation: AAG40155.1.
AF241649 Genomic DNA. Translation: AAF44704.1.
BK000146 mRNA. Translation: DAA00021.1.
AY094749 mRNA. Translation: AAM11102.1. Different initiation.
PIRiS35341.
RefSeqiNP_524676.2. NM_079937.3.
UniGeneiDm.2974.

Genome annotation databases

GeneIDi44013.
KEGGidme:Dmel_CG1915.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB026845 mRNA. Translation: BAA90301.2 .
AJ238575 Genomic DNA. Translation: CAB43710.1 .
AJ238577 Genomic DNA. Translation: CAB43739.2 .
AJ271740 Genomic DNA. Translation: CAB93524.1 .
AJ400900 mRNA. Translation: CAB96426.1 .
AJ400901 mRNA. Translation: CAB96427.1 .
AJ400902 mRNA. Translation: CAB96531.1 .
AE014296 Genomic DNA. Translation: AAF47604.1 .
AF045775 mRNA. Translation: AAC23966.1 .
AF045776 mRNA. Translation: AAC23965.1 .
AF045777 mRNA. Translation: AAC23964.1 .
AF045778 Genomic DNA. Translation: AAC23963.1 .
AJ245406 Genomic DNA. Translation: CAB76253.1 .
AJ012279 mRNA. Translation: CAA09970.1 .
AJ012280 mRNA. Translation: CAA09971.1 .
AF135062 mRNA. Translation: AAF61414.1 .
AF135167 Transcribed RNA. Translation: AAF62351.1 .
AF241648 mRNA. Translation: AAG40155.1 .
AF241649 Genomic DNA. Translation: AAF44704.1 .
BK000146 mRNA. Translation: DAA00021.1 .
AY094749 mRNA. Translation: AAM11102.1 . Different initiation.
PIRi S35341.
RefSeqi NP_524676.2. NM_079937.3.
UniGenei Dm.2974.

3D structure databases

ProteinModelPortali Q9I7U4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 68776. 3 interactions.
IntActi Q9I7U4. 1 interaction.
MINTi MINT-1723019.

Protein family/group databases

MEROPSi I43.001.

Proteomic databases

PaxDbi Q9I7U4.
PRIDEi Q9I7U4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 44013.
KEGGi dme:Dmel_CG1915.

Organism-specific databases

CTDi 44013.
FlyBasei FBgn0086906. sls.

Phylogenomic databases

eggNOGi NOG12793.
InParanoidi Q9I7U4.
OrthoDBi EOG7327MW.

Enzyme and pathway databases

SignaLinki Q9I7U4.

Miscellaneous databases

ChiTaRSi SLS. drosophila.
GenomeRNAii 44013.
NextBioi 836598.

Gene expression databases

Bgeei Q9I7U4.

Family and domain databases

Gene3Di 2.60.40.10. 58 hits.
InterProi IPR010939. DUF1136.
IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF06582. DUF1136. 13 hits.
PF00041. fn3. 5 hits.
PF07679. I-set. 53 hits.
PF00018. SH3_1. 1 hit.
[Graphical view ]
SMARTi SM00060. FN3. 5 hits.
SM00409. IG. 34 hits.
SM00408. IGc2. 15 hits.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 3 hits.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50853. FN3. 5 hits.
PS50835. IG_LIKE. 51 hits.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Requirements of Kettin, a giant muscle protein highly conserved in overall structure in evolution, for normal muscle function, viability, and flight activity of Drosophila."
    Hakeda S., Endo S., Saigo K.
    J. Cell Biol. 148:101-114(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, TISSUE SPECIFICITY.
  2. "Drosophila D-titin is required for myoblast fusion and skeletal muscle striation."
    Zhang Y., Featherstone D., Davis W., Rushton E., Broadie K.
    J. Cell Sci. 113:3103-3115(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM D), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-187, NUCLEOTIDE SEQUENCE [MRNA] OF 4789-4963 AND 13411-13939 (ISOFORMS B/C/D/E), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 15913-16691 (ISOFORM E), NUCLEOTIDE SEQUENCE [MRNA] OF 18064-18141 (ISOFORMS C/D/E), FUNCTION, TISSUE SPECIFICITY.
    Strain: Berkeley and Oregon-R.
    Tissue: Embryo, Larva and Ovary.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING (ISOFORMS A AND C).
    Strain: Berkeley.
  5. "Human autoantibodies reveal titin as a chromosomal protein."
    Machado C., Sunkel C.E., Andrew D.J.
    J. Cell Biol. 141:321-333(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-880 (ISOFORMS A/C/D/E), NUCLEOTIDE SEQUENCE [MRNA] OF 7219-7572 (ISOFORMS B/C/D/E), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10456-10723, NUCLEOTIDE SEQUENCE [MRNA] OF 11358-11461 (ISOFORMS B/C/D/E), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  6. "Sequence and expression of the kettin gene in Drosophila melanogaster and Caenorhabditis elegans."
    Kolmerer B., Clayton J., Benes V., Allen T., Ferguson C., Leonard K., Weber U., Knekt M., Ansorge W., Labeit S., Bullard B.
    J. Mol. Biol. 296:435-448(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3999, FUNCTION, TISSUE SPECIFICITY.
    Strain: Berkeley.
  7. "Association of kettin with actin in the Z-disc of insect flight muscle."
    van Straaten M., Goulding D., Kolmerer B., Labeit S., Clayton J., Leonard K., Bullard B.
    J. Mol. Biol. 285:1549-1562(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 371-500 AND 3126-3354, ACTIN-BINDING, SUBCELLULAR LOCATION.
  8. "Kettin, a large modular protein in the Z-disc of insect muscles."
    Lakey A., Labeit S., Gautel M., Ferguson C., Barlow D., Leonard K., Bullard B.
    EMBO J. 12:2863-2871(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1691-2214, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  9. "D-Titin: a giant protein with dual roles in chromosomes and muscles."
    Machado C., Andrew D.J.
    J. Cell Biol. 151:639-652(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3091-3407, NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 6635-7000, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, IDENTIFICATION (ISOFORMS A AND B), DEVELOPMENTAL STAGE, DISRUPTION PHENOTYPE.
    Tissue: Muscle.
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 13581-14436 (ISOFORMS B/C/D/E).
    Strain: Berkeley.
    Tissue: Ovary.

Entry informationi

Entry nameiTITIN_DROME
AccessioniPrimary (citable) accession number: Q9I7U4
Secondary accession number(s): O76275
, O76276, O76277, O76278, O96767, O96768, Q7KA82, Q7KAJ1, Q7KPQ8, Q7RTL4, Q8T3N3, Q9N2P7, Q9N680, Q9N9Y5, Q9N9Y6, Q9N9Y7, Q9NFS3, Q9NJP4, Q9NL88, Q9UB79, Q9W055, Q9XZT9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 18, 2008
Last modified: July 9, 2014
This is version 110 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi