Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neurexin-3-beta

Gene

NRXN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May play a role in angiogenesis (By similarity).By similarity

GO - Molecular functioni

  1. cell adhesion molecule binding Source: BHF-UCL
  2. neuroligin family protein binding Source: BHF-UCL

GO - Biological processi

  1. adult behavior Source: BHF-UCL
  2. angiogenesis Source: UniProtKB
  3. learning Source: BHF-UCL
  4. neuron cell-cell adhesion Source: BHF-UCL
  5. neurotransmitter secretion Source: InterPro
  6. positive regulation of synapse assembly Source: InterPro
  7. positive regulation of synapse maturation Source: InterPro
  8. social behavior Source: BHF-UCL
  9. synapse assembly Source: InterPro
  10. vocalization behavior Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Angiogenesis, Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Neurexin-3-beta
Alternative name(s):
Neurexin III-beta
Cleaved into the following 2 chains:
Gene namesi
Name:NRXN3
Synonyms:KIAA0743
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:8010. NRXN3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini36 – 562527ExtracellularSequence AnalysisAdd
BLAST
Transmembranei563 – 58321HelicalSequence AnalysisAdd
BLAST
Topological domaini584 – 63754CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31788.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3535By similarityAdd
BLAST
Chaini36 – 637602Neurexin-3-betaPRO_0000019502Add
BLAST
Chaini36 – 550515Neurexin-3-beta, soluble formPRO_0000412543Add
BLAST
Chaini551 – 63787Neurexin-3-beta, C-terminal fragmentPRO_0000412544Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi184 – 1841N-linked (GlcNAc...)Sequence Analysis
Glycosylationi252 – 2521N-linked (GlcNAc...)Sequence Analysis
Glycosylationi296 – 2961N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Proccessed by alpha-secretase leading to the formation of an extracellular soluble protein as well as a C-terminal membrane-embedded fragment (CTF). Proteolysis of these CTFs by gamma-secretase releases intracellular domains (ICDs) and extracellular peptides.

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiQ9HDB5.

Expressioni

Tissue specificityi

Expressed in the blood vessel walls (at protein level).1 Publication

Gene expression databases

BgeeiQ9HDB5.
CleanExiHS_NRXN3.
ExpressionAtlasiQ9HDB5. baseline and differential.
GenevestigatoriQ9HDB5.

Organism-specific databases

HPAiHPA002727.

Interactioni

Subunit structurei

The cytoplasmic C-terminal region binds to CASK (By similarity). Binds to neuroligins NLGN1, NLGN2 and NLGN3 (By similarity). Weakly interacts with CBLN1 and CBLN2. Very weak binding, if any, with CBLN4 (By similarity).By similarity

Protein-protein interaction databases

BioGridi114770. 7 interactions.
STRINGi9606.ENSP00000338349.

Structurei

3D structure databases

ProteinModelPortaliQ9HDB5.
SMRiQ9HDB5. Positions 81-258.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini85 – 255171Laminin G-likePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the neurexin family.Curated
Contains 1 laminin G-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118991.
HOGENOMiHOG000230482.
HOVERGENiHBG052670.
KOiK07377.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027158. NRXN3.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PANTHERiPTHR10127:SF405. PTHR10127:SF405. 1 hit.
PfamiPF02210. Laminin_G_2. 1 hit.
PF01034. Syndecan. 1 hit.
[Graphical view]
SMARTiSM00294. 4.1m. 1 hit.
SM00282. LamG. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS50025. LAM_G_DOMAIN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. Align

Note: A number of isoforms, alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus.

Isoform 1b (identifier: Q9HDB5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHLRIHARRS PPRRPAWTLG IWFLFWGCIV SSVWSSSNVA SSSSTSSSPG
60 70 80 90 100
SHSQHEHHFH GSKHHSVPIS IYRSPVSLRG GHAGATYIFG KSGGLILYTW
110 120 130 140 150
PANDRPSTRS DRLAVGFSTT VKDGILVRID SAPGLGDFLQ LHIEQGKIGV
160 170 180 190 200
VFNIGTVDIS IKEERTPVND GKYHVVRFTR NGGNATLQVD NWPVNEHYPT
210 220 230 240 250
GRQLTIFNTQ AQIAIGGKDK GRLFQGQLSG LYYDGLKVLN MAAENNPNIK
260 270 280 290 300
INGSVRLVGE VPSILGTTQT TSMPPEMSTT VMETTTTMAT TTTRKNRSTA
310 320 330 340 350
SIQPTSDDLV SSAECSSDDE DFVECEPSTG GELVIPLLVE DPLATPPIAT
360 370 380 390 400
RAPSITLPPT FRPLLTIIET TKDSLSMTSE AGLPCLSDQG SDGCDDDGLV
410 420 430 440 450
ISGYGSGETF DSNLPPTDDE DFYTTFSLVT DKSLSTSIFE GGYKAHAPKW
460 470 480 490 500
ESKDFRPNKV SETSRTTTTS LSPELIRFTA SSSSGMVPKL PAGKMNNRDL
510 520 530 540 550
KPQPDIVLLP LPTAYELDST KLKSPLITSP MFRNVPTANP TEPGIRRVPG
560 570 580 590 600
ASEVIRESSS TTGMVVGIVA AAALCILILL YAMYKYRNRD EGSYQVDETR
610 620 630
NYISNSAQSN GTLMKEKQQS SKSGHKKQKN KDREYYV
Length:637
Mass (Da):69,305
Last modified:December 16, 2008 - v4
Checksum:iA0F100DA9D72A149
GO
Isoform 2b (identifier: Q9HDB5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-328: S → ST
     329-537: TGGELVIPLL...TSPMFRNVPT → GRS

Note: Produced by alternative splicing.

Show »
Length:432
Mass (Da):47,270
Checksum:i75F3F114B012B232
GO
Isoform 3b (identifier: Q9HDB5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     329-367: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...PIIFISCVVH
     368-637: Missing.

Note: Produced by alternative splicing. No experimental confirmation available.

Show »
Length:396
Mass (Da):43,766
Checksum:i659003903B5F2950
GO
Isoform 4b (identifier: Q9HDB5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     329-536: Missing.

Note: Produced by alternative splicing.

Show »
Length:459
Mass (Da):50,705
Checksum:i2717C48B9E990708
GO
Isoform 1a (identifier: Q9Y4C0-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,643
Mass (Da):180,599
GO
Isoform 3a (identifier: Q9Y4C0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative splicing.

Length:1,061
Mass (Da):117,317
GO
Isoform 4a (identifier: Q9Y4C0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative splicing.

Length:1,392
Mass (Da):153,885
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei200 – 2001T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 3b and isoform 4b. 1 PublicationVSP_035644
Alternative sequencei328 – 3281S → ST in isoform 2b. 2 PublicationsVSP_036465
Alternative sequencei329 – 537209TGGEL…RNVPT → GRS in isoform 2b. 2 PublicationsVSP_036466Add
BLAST
Alternative sequencei329 – 536208Missing in isoform 4b. CuratedVSP_040988Add
BLAST
Alternative sequencei329 – 36739TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVH in isoform 3b. 1 PublicationVSP_035646Add
BLAST
Alternative sequencei368 – 637270Missing in isoform 3b. 1 PublicationVSP_035647Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ493127 mRNA. Translation: CAD37989.1.
AF123462 Genomic DNA. Translation: AAD13621.1.
AK056530 mRNA. Translation: BAG51739.1.
AL833739 mRNA. Translation: CAH56254.1.
AC008056 Genomic DNA. Translation: AAF09143.1.
AC012099 Genomic DNA. Translation: AAF15058.1.
AC018514 Genomic DNA. Translation: AAF99808.1.
CH471061 Genomic DNA. Translation: EAW81313.1.
CH471061 Genomic DNA. Translation: EAW81315.1.
BC059368 mRNA. Translation: AAH59368.1.
BC068469 mRNA. Translation: AAH68469.1.
BC142649 mRNA. Translation: AAI42650.1.
BC150194 mRNA. Translation: AAI50195.1.
CCDSiCCDS45145.1. [Q9HDB5-4]
CCDS61515.1. [Q9HDB5-1]
CCDS9871.1. [Q9HDB5-2]
RefSeqiNP_001098720.1. NM_001105250.2. [Q9HDB5-4]
NP_001258949.1. NM_001272020.1. [Q9HDB5-1]
NP_004787.2. NM_004796.5.
NP_620426.2. NM_138970.4. [Q9HDB5-2]
UniGeneiHs.368307.

Genome annotation databases

EnsembliENST00000281127; ENSP00000281127; ENSG00000021645. [Q9HDB5-2]
ENST00000428277; ENSP00000394426; ENSG00000021645. [Q9HDB5-4]
ENST00000555387; ENSP00000451393; ENSG00000021645.
ENST00000557594; ENSP00000451672; ENSG00000021645. [Q9HDB5-1]
GeneIDi9369.
KEGGihsa:9369.
UCSCiuc001xuq.3. human. [Q9HDB5-1]
uc001xur.5. human. [Q9HDB5-2]
uc010asw.4. human. [Q9HDB5-4]

Polymorphism databases

DMDMi218512141.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ493127 mRNA. Translation: CAD37989.1.
AF123462 Genomic DNA. Translation: AAD13621.1.
AK056530 mRNA. Translation: BAG51739.1.
AL833739 mRNA. Translation: CAH56254.1.
AC008056 Genomic DNA. Translation: AAF09143.1.
AC012099 Genomic DNA. Translation: AAF15058.1.
AC018514 Genomic DNA. Translation: AAF99808.1.
CH471061 Genomic DNA. Translation: EAW81313.1.
CH471061 Genomic DNA. Translation: EAW81315.1.
BC059368 mRNA. Translation: AAH59368.1.
BC068469 mRNA. Translation: AAH68469.1.
BC142649 mRNA. Translation: AAI42650.1.
BC150194 mRNA. Translation: AAI50195.1.
CCDSiCCDS45145.1. [Q9HDB5-4]
CCDS61515.1. [Q9HDB5-1]
CCDS9871.1. [Q9HDB5-2]
RefSeqiNP_001098720.1. NM_001105250.2. [Q9HDB5-4]
NP_001258949.1. NM_001272020.1. [Q9HDB5-1]
NP_004787.2. NM_004796.5.
NP_620426.2. NM_138970.4. [Q9HDB5-2]
UniGeneiHs.368307.

3D structure databases

ProteinModelPortaliQ9HDB5.
SMRiQ9HDB5. Positions 81-258.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114770. 7 interactions.
STRINGi9606.ENSP00000338349.

Polymorphism databases

DMDMi218512141.

Proteomic databases

PRIDEiQ9HDB5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281127; ENSP00000281127; ENSG00000021645. [Q9HDB5-2]
ENST00000428277; ENSP00000394426; ENSG00000021645. [Q9HDB5-4]
ENST00000555387; ENSP00000451393; ENSG00000021645.
ENST00000557594; ENSP00000451672; ENSG00000021645. [Q9HDB5-1]
GeneIDi9369.
KEGGihsa:9369.
UCSCiuc001xuq.3. human. [Q9HDB5-1]
uc001xur.5. human. [Q9HDB5-2]
uc010asw.4. human. [Q9HDB5-4]

Organism-specific databases

CTDi9369.
GeneCardsiGC14P078710.
HGNCiHGNC:8010. NRXN3.
HPAiHPA002727.
MIMi600567. gene.
neXtProtiNX_Q9HDB5.
PharmGKBiPA31788.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118991.
HOGENOMiHOG000230482.
HOVERGENiHBG052670.
KOiK07377.

Miscellaneous databases

ChiTaRSiNRXN3. human.
GeneWikiiNRXN3.
GenomeRNAii9369.
NextBioi35088.
SOURCEiSearch...

Gene expression databases

BgeeiQ9HDB5.
CleanExiHS_NRXN3.
ExpressionAtlasiQ9HDB5. baseline and differential.
GenevestigatoriQ9HDB5.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027158. NRXN3.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PANTHERiPTHR10127:SF405. PTHR10127:SF405. 1 hit.
PfamiPF02210. Laminin_G_2. 1 hit.
PF01034. Syndecan. 1 hit.
[Graphical view]
SMARTiSM00294. 4.1m. 1 hit.
SM00282. LamG. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS50025. LAM_G_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3)."
    Occhi G., Rampazzo A., Beffagna G., Antonio Danieli G.
    Biochem. Biophys. Res. Commun. 298:151-155(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3B).
    Tissue: Heart.
  2. "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
    Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
    Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1B).
    Tissue: Teratocarcinoma.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2B).
    Tissue: Stomach.
  5. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2B).
    Tissue: Placenta.
  8. "The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions."
    Bottos A., Destro E., Rissone A., Graziano S., Cordara G., Assenzio B., Cera M.R., Mascia L., Bussolino F., Arese M.
    Proc. Natl. Acad. Sci. U.S.A. 106:20782-20787(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. "Processing of the synaptic cell adhesion molecule neurexin-3beta by Alzheimer disease alpha- and gamma-secretases."
    Bot N., Schweizer C., Ben Halima S., Fraering P.C.
    J. Biol. Chem. 286:2762-2773(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEOLYTIC PROCESSING.

Entry informationi

Entry nameiNRX3B_HUMAN
AccessioniPrimary (citable) accession number: Q9HDB5
Secondary accession number(s): A5PKW8
, A8MPU5, B3KPM7, Q6NUR0, Q8IUD8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: December 16, 2008
Last modified: January 7, 2015
This is version 117 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.