Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HDB5

- NRX3B_HUMAN

UniProt

Q9HDB5 - NRX3B_HUMAN

Protein

Neurexin-3-beta

Gene

NRXN3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 4 (16 Dec 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May play a role in angiogenesis By similarity.By similarity

    GO - Molecular functioni

    1. cell adhesion molecule binding Source: BHF-UCL
    2. neuroligin family protein binding Source: BHF-UCL

    GO - Biological processi

    1. adult behavior Source: BHF-UCL
    2. angiogenesis Source: UniProtKB
    3. learning Source: BHF-UCL
    4. neuron cell-cell adhesion Source: BHF-UCL
    5. neurotransmitter secretion Source: InterPro
    6. positive regulation of synapse assembly Source: InterPro
    7. positive regulation of synapse maturation Source: InterPro
    8. social behavior Source: BHF-UCL
    9. synapse assembly Source: InterPro
    10. vocalization behavior Source: BHF-UCL

    Keywords - Biological processi

    Angiogenesis, Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neurexin-3-beta
    Alternative name(s):
    Neurexin III-beta
    Cleaved into the following 2 chains:
    Gene namesi
    Name:NRXN3
    Synonyms:KIAA0743
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:8010. NRXN3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31788.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3535By similarityAdd
    BLAST
    Chaini36 – 637602Neurexin-3-betaPRO_0000019502Add
    BLAST
    Chaini36 – 550515Neurexin-3-beta, soluble formPRO_0000412543Add
    BLAST
    Chaini551 – 63787Neurexin-3-beta, C-terminal fragmentPRO_0000412544Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi184 – 1841N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi252 – 2521N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi296 – 2961N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Proccessed by alpha-secretase leading to the formation of an extracellular soluble protein as well as a C-terminal membrane-embedded fragment (CTF). Proteolysis of these CTFs by gamma-secretase releases intracellular domains (ICDs) and extracellular peptides.

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PRIDEiQ9HDB5.

    Expressioni

    Tissue specificityi

    Expressed in the blood vessel walls (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ9HDB5.
    BgeeiQ9HDB5.
    CleanExiHS_NRXN3.
    GenevestigatoriQ9HDB5.

    Organism-specific databases

    HPAiHPA002727.

    Interactioni

    Subunit structurei

    The cytoplasmic C-terminal region binds to CASK By similarity. Binds to neuroligins NLGN1, NLGN2 and NLGN3 By similarity. Weakly interacts with CBLN1 and CBLN2. Very weak binding, if any, with CBLN4 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi114770. 5 interactions.
    STRINGi9606.ENSP00000338349.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9HDB5.
    SMRiQ9HDB5. Positions 81-258.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini36 – 562527ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini584 – 63754CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei563 – 58321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini85 – 255171Laminin G-likePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the neurexin family.Curated
    Contains 1 laminin G-like domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    HOGENOMiHOG000230482.
    HOVERGENiHBG052670.
    KOiK07377.

    Family and domain databases

    Gene3Di2.60.120.200. 1 hit.
    InterProiIPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR001791. Laminin_G.
    IPR003585. Neurexin-like.
    IPR027158. NRXN3.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view]
    PANTHERiPTHR10127:SF405. PTHR10127:SF405. 1 hit.
    PfamiPF02210. Laminin_G_2. 1 hit.
    PF01034. Syndecan. 1 hit.
    [Graphical view]
    SMARTiSM00294. 4.1m. 1 hit.
    SM00282. LamG. 1 hit.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 1 hit.
    PROSITEiPS50025. LAM_G_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Note: A number of isoforms, alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus.

    Isoform 1b (identifier: Q9HDB5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHLRIHARRS PPRRPAWTLG IWFLFWGCIV SSVWSSSNVA SSSSTSSSPG    50
    SHSQHEHHFH GSKHHSVPIS IYRSPVSLRG GHAGATYIFG KSGGLILYTW 100
    PANDRPSTRS DRLAVGFSTT VKDGILVRID SAPGLGDFLQ LHIEQGKIGV 150
    VFNIGTVDIS IKEERTPVND GKYHVVRFTR NGGNATLQVD NWPVNEHYPT 200
    GRQLTIFNTQ AQIAIGGKDK GRLFQGQLSG LYYDGLKVLN MAAENNPNIK 250
    INGSVRLVGE VPSILGTTQT TSMPPEMSTT VMETTTTMAT TTTRKNRSTA 300
    SIQPTSDDLV SSAECSSDDE DFVECEPSTG GELVIPLLVE DPLATPPIAT 350
    RAPSITLPPT FRPLLTIIET TKDSLSMTSE AGLPCLSDQG SDGCDDDGLV 400
    ISGYGSGETF DSNLPPTDDE DFYTTFSLVT DKSLSTSIFE GGYKAHAPKW 450
    ESKDFRPNKV SETSRTTTTS LSPELIRFTA SSSSGMVPKL PAGKMNNRDL 500
    KPQPDIVLLP LPTAYELDST KLKSPLITSP MFRNVPTANP TEPGIRRVPG 550
    ASEVIRESSS TTGMVVGIVA AAALCILILL YAMYKYRNRD EGSYQVDETR 600
    NYISNSAQSN GTLMKEKQQS SKSGHKKQKN KDREYYV 637
    Length:637
    Mass (Da):69,305
    Last modified:December 16, 2008 - v4
    Checksum:iA0F100DA9D72A149
    GO
    Isoform 2b (identifier: Q9HDB5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         328-328: S → ST
         329-537: TGGELVIPLL...TSPMFRNVPT → GRS

    Note: Produced by alternative splicing.

    Show »
    Length:432
    Mass (Da):47,270
    Checksum:i75F3F114B012B232
    GO
    Isoform 3b (identifier: Q9HDB5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
         329-367: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...PIIFISCVVH
         368-637: Missing.

    Note: Produced by alternative splicing. No experimental confirmation available.

    Show »
    Length:396
    Mass (Da):43,766
    Checksum:i659003903B5F2950
    GO
    Isoform 4b (identifier: Q9HDB5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
         329-536: Missing.

    Note: Produced by alternative splicing.

    Show »
    Length:459
    Mass (Da):50,705
    Checksum:i2717C48B9E990708
    GO
    Isoform 1a (identifier: Q9Y4C0-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9Y4C0.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
    Length:1,643
    Mass (Da):180,599
    GO
    Isoform 3a (identifier: Q9Y4C0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9Y4C0.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative splicing.

    Length:1,061
    Mass (Da):117,317
    GO
    Isoform 4a (identifier: Q9Y4C0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9Y4C0.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative splicing.

    Length:1,392
    Mass (Da):153,885
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei200 – 2001T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 3b and isoform 4b. 1 PublicationVSP_035644
    Alternative sequencei328 – 3281S → ST in isoform 2b. 2 PublicationsVSP_036465
    Alternative sequencei329 – 537209TGGEL…RNVPT → GRS in isoform 2b. 2 PublicationsVSP_036466Add
    BLAST
    Alternative sequencei329 – 536208Missing in isoform 4b. CuratedVSP_040988Add
    BLAST
    Alternative sequencei329 – 36739TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVH in isoform 3b. 1 PublicationVSP_035646Add
    BLAST
    Alternative sequencei368 – 637270Missing in isoform 3b. 1 PublicationVSP_035647Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ493127 mRNA. Translation: CAD37989.1.
    AF123462 Genomic DNA. Translation: AAD13621.1.
    AK056530 mRNA. Translation: BAG51739.1.
    AL833739 mRNA. Translation: CAH56254.1.
    AC008056 Genomic DNA. Translation: AAF09143.1.
    AC012099 Genomic DNA. Translation: AAF15058.1.
    AC018514 Genomic DNA. Translation: AAF99808.1.
    CH471061 Genomic DNA. Translation: EAW81313.1.
    CH471061 Genomic DNA. Translation: EAW81315.1.
    BC059368 mRNA. Translation: AAH59368.1.
    BC068469 mRNA. Translation: AAH68469.1.
    BC142649 mRNA. Translation: AAI42650.1.
    BC150194 mRNA. Translation: AAI50195.1.
    CCDSiCCDS45145.1. [Q9HDB5-4]
    CCDS61515.1. [Q9HDB5-1]
    CCDS9871.1. [Q9HDB5-2]
    RefSeqiNP_001098720.1. NM_001105250.2. [Q9HDB5-4]
    NP_001258949.1. NM_001272020.1. [Q9HDB5-1]
    NP_004787.2. NM_004796.5.
    NP_620426.2. NM_138970.4. [Q9HDB5-2]
    UniGeneiHs.368307.

    Genome annotation databases

    EnsembliENST00000281127; ENSP00000281127; ENSG00000021645. [Q9HDB5-2]
    ENST00000428277; ENSP00000394426; ENSG00000021645. [Q9HDB5-4]
    ENST00000555387; ENSP00000451393; ENSG00000021645.
    ENST00000557594; ENSP00000451672; ENSG00000021645. [Q9HDB5-1]
    GeneIDi9369.
    KEGGihsa:9369.
    UCSCiuc001xuq.3. human. [Q9HDB5-1]
    uc001xur.5. human. [Q9HDB5-2]
    uc010asw.4. human. [Q9HDB5-4]

    Polymorphism databases

    DMDMi218512141.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ493127 mRNA. Translation: CAD37989.1 .
    AF123462 Genomic DNA. Translation: AAD13621.1 .
    AK056530 mRNA. Translation: BAG51739.1 .
    AL833739 mRNA. Translation: CAH56254.1 .
    AC008056 Genomic DNA. Translation: AAF09143.1 .
    AC012099 Genomic DNA. Translation: AAF15058.1 .
    AC018514 Genomic DNA. Translation: AAF99808.1 .
    CH471061 Genomic DNA. Translation: EAW81313.1 .
    CH471061 Genomic DNA. Translation: EAW81315.1 .
    BC059368 mRNA. Translation: AAH59368.1 .
    BC068469 mRNA. Translation: AAH68469.1 .
    BC142649 mRNA. Translation: AAI42650.1 .
    BC150194 mRNA. Translation: AAI50195.1 .
    CCDSi CCDS45145.1. [Q9HDB5-4 ]
    CCDS61515.1. [Q9HDB5-1 ]
    CCDS9871.1. [Q9HDB5-2 ]
    RefSeqi NP_001098720.1. NM_001105250.2. [Q9HDB5-4 ]
    NP_001258949.1. NM_001272020.1. [Q9HDB5-1 ]
    NP_004787.2. NM_004796.5.
    NP_620426.2. NM_138970.4. [Q9HDB5-2 ]
    UniGenei Hs.368307.

    3D structure databases

    ProteinModelPortali Q9HDB5.
    SMRi Q9HDB5. Positions 81-258.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114770. 5 interactions.
    STRINGi 9606.ENSP00000338349.

    Polymorphism databases

    DMDMi 218512141.

    Proteomic databases

    PRIDEi Q9HDB5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000281127 ; ENSP00000281127 ; ENSG00000021645 . [Q9HDB5-2 ]
    ENST00000428277 ; ENSP00000394426 ; ENSG00000021645 . [Q9HDB5-4 ]
    ENST00000555387 ; ENSP00000451393 ; ENSG00000021645 .
    ENST00000557594 ; ENSP00000451672 ; ENSG00000021645 . [Q9HDB5-1 ]
    GeneIDi 9369.
    KEGGi hsa:9369.
    UCSCi uc001xuq.3. human. [Q9HDB5-1 ]
    uc001xur.5. human. [Q9HDB5-2 ]
    uc010asw.4. human. [Q9HDB5-4 ]

    Organism-specific databases

    CTDi 9369.
    GeneCardsi GC14P078710.
    HGNCi HGNC:8010. NRXN3.
    HPAi HPA002727.
    MIMi 600567. gene.
    neXtProti NX_Q9HDB5.
    PharmGKBi PA31788.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    HOGENOMi HOG000230482.
    HOVERGENi HBG052670.
    KOi K07377.

    Miscellaneous databases

    ChiTaRSi NRXN3. human.
    GeneWikii NRXN3.
    GenomeRNAii 9369.
    NextBioi 35088.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HDB5.
    Bgeei Q9HDB5.
    CleanExi HS_NRXN3.
    Genevestigatori Q9HDB5.

    Family and domain databases

    Gene3Di 2.60.120.200. 1 hit.
    InterProi IPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR001791. Laminin_G.
    IPR003585. Neurexin-like.
    IPR027158. NRXN3.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view ]
    PANTHERi PTHR10127:SF405. PTHR10127:SF405. 1 hit.
    Pfami PF02210. Laminin_G_2. 1 hit.
    PF01034. Syndecan. 1 hit.
    [Graphical view ]
    SMARTi SM00294. 4.1m. 1 hit.
    SM00282. LamG. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 1 hit.
    PROSITEi PS50025. LAM_G_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3)."
      Occhi G., Rampazzo A., Beffagna G., Antonio Danieli G.
      Biochem. Biophys. Res. Commun. 298:151-155(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3B).
      Tissue: Heart.
    2. "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
      Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
      Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1B).
      Tissue: Teratocarcinoma.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2B).
      Tissue: Stomach.
    5. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2B).
      Tissue: Placenta.
    8. "The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions."
      Bottos A., Destro E., Rissone A., Graziano S., Cordara G., Assenzio B., Cera M.R., Mascia L., Bussolino F., Arese M.
      Proc. Natl. Acad. Sci. U.S.A. 106:20782-20787(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    9. "Processing of the synaptic cell adhesion molecule neurexin-3beta by Alzheimer disease alpha- and gamma-secretases."
      Bot N., Schweizer C., Ben Halima S., Fraering P.C.
      J. Biol. Chem. 286:2762-2773(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEOLYTIC PROCESSING.

    Entry informationi

    Entry nameiNRX3B_HUMAN
    AccessioniPrimary (citable) accession number: Q9HDB5
    Secondary accession number(s): A5PKW8
    , A8MPU5, B3KPM7, Q6NUR0, Q8IUD8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 16, 2001
    Last sequence update: December 16, 2008
    Last modified: October 1, 2014
    This is version 115 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3