Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9HDB5 (NRX3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neurexin-3-beta
Alternative name(s):
Neurexin III-beta

Cleaved into the following 2 chains:

  1. Neurexin-3-beta, soluble form
  2. Neurexin-3-beta, C-terminal fragment
    Short name=NRXN3-CTF
Gene names
Name:NRXN3
Synonyms:KIAA0743
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length637 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May play a role in angiogenesis By similarity.

Subunit structure

The cytoplasmic C-terminal region binds to CASK By similarity. Binds to neuroligins NLGN1, NLGN2 and NLGN3 By similarity. Weakly interacts with CBLN1 and CBLN2. Very weak binding, if any, with CBLN4 By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein Potential.

Tissue specificity

Expressed in the blood vessel walls (at protein level). Ref.8

Post-translational modification

Proccessed by alpha-secretase leading to the formation of an extracellular soluble protein as well as a C-terminal membrane-embedded fragment (CTF). Proteolysis of these CTFs by gamma-secretase releases intracellular domains (ICDs) and extracellular peptides.

Sequence similarities

Belongs to the neurexin family.

Contains 1 laminin G-like domain.

Ontologies

Alternative products

This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select]

Note: A number of isoforms, alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus.
Isoform 1b (identifier: Q9HDB5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2b (identifier: Q9HDB5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     328-328: S → ST
     329-537: TGGELVIPLL...TSPMFRNVPT → GRS
Note: Produced by alternative splicing.
Isoform 3b (identifier: Q9HDB5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     329-367: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...PIIFISCVVH
     368-637: Missing.
Note: Produced by alternative splicing. No experimental confirmation available.
Isoform 4b (identifier: Q9HDB5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     329-536: Missing.
Note: Produced by alternative splicing.
Isoform 1a (identifier: Q9Y4C0-1)

The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Isoform 3a (identifier: Q9Y4C0-3)

The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing.
Isoform 4a (identifier: Q9Y4C0-4)

The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3535 By similarity
Chain36 – 637602Neurexin-3-beta
PRO_0000019502
Chain36 – 550515Neurexin-3-beta, soluble form
PRO_0000412543
Chain551 – 63787Neurexin-3-beta, C-terminal fragment
PRO_0000412544

Regions

Topological domain36 – 562527Extracellular Potential
Transmembrane563 – 58321Helical; Potential
Topological domain584 – 63754Cytoplasmic Potential
Domain85 – 255171Laminin G-like

Amino acid modifications

Glycosylation1841N-linked (GlcNAc...) Potential
Glycosylation2521N-linked (GlcNAc...) Potential
Glycosylation2961N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence2001T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 3b and isoform 4b.
VSP_035644
Alternative sequence3281S → ST in isoform 2b.
VSP_036465
Alternative sequence329 – 537209TGGEL…RNVPT → GRS in isoform 2b.
VSP_036466
Alternative sequence329 – 536208Missing in isoform 4b.
VSP_040988
Alternative sequence329 – 36739TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVH in isoform 3b.
VSP_035646
Alternative sequence368 – 637270Missing in isoform 3b.
VSP_035647

Sequences

Sequence LengthMass (Da)Tools
Isoform 1b [UniParc].

Last modified December 16, 2008. Version 4.
Checksum: A0F100DA9D72A149

FASTA63769,305
        10         20         30         40         50         60 
MHLRIHARRS PPRRPAWTLG IWFLFWGCIV SSVWSSSNVA SSSSTSSSPG SHSQHEHHFH 

        70         80         90        100        110        120 
GSKHHSVPIS IYRSPVSLRG GHAGATYIFG KSGGLILYTW PANDRPSTRS DRLAVGFSTT 

       130        140        150        160        170        180 
VKDGILVRID SAPGLGDFLQ LHIEQGKIGV VFNIGTVDIS IKEERTPVND GKYHVVRFTR 

       190        200        210        220        230        240 
NGGNATLQVD NWPVNEHYPT GRQLTIFNTQ AQIAIGGKDK GRLFQGQLSG LYYDGLKVLN 

       250        260        270        280        290        300 
MAAENNPNIK INGSVRLVGE VPSILGTTQT TSMPPEMSTT VMETTTTMAT TTTRKNRSTA 

       310        320        330        340        350        360 
SIQPTSDDLV SSAECSSDDE DFVECEPSTG GELVIPLLVE DPLATPPIAT RAPSITLPPT 

       370        380        390        400        410        420 
FRPLLTIIET TKDSLSMTSE AGLPCLSDQG SDGCDDDGLV ISGYGSGETF DSNLPPTDDE 

       430        440        450        460        470        480 
DFYTTFSLVT DKSLSTSIFE GGYKAHAPKW ESKDFRPNKV SETSRTTTTS LSPELIRFTA 

       490        500        510        520        530        540 
SSSSGMVPKL PAGKMNNRDL KPQPDIVLLP LPTAYELDST KLKSPLITSP MFRNVPTANP 

       550        560        570        580        590        600 
TEPGIRRVPG ASEVIRESSS TTGMVVGIVA AAALCILILL YAMYKYRNRD EGSYQVDETR 

       610        620        630 
NYISNSAQSN GTLMKEKQQS SKSGHKKQKN KDREYYV 

« Hide

Isoform 2b [UniParc].

Checksum: 75F3F114B012B232
Show »

FASTA43247,270
Isoform 3b [UniParc].

Checksum: 659003903B5F2950
Show »

FASTA39643,766
Isoform 4b [UniParc].

Checksum: 2717C48B9E990708
Show »

FASTA45950,705
Isoform 1a [UniParc].

See Q9Y4C0.

Isoform 3a [UniParc].

See Q9Y4C0.

Isoform 4a [UniParc].

See Q9Y4C0.

References

« Hide 'large scale' references
[1]"Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3)."
Occhi G., Rampazzo A., Beffagna G., Antonio Danieli G.
Biochem. Biophys. Res. Commun. 298:151-155(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3B).
Tissue: Heart.
[2]"Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1B).
Tissue: Teratocarcinoma.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2B).
Tissue: Stomach.
[5]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2B).
Tissue: Placenta.
[8]"The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions."
Bottos A., Destro E., Rissone A., Graziano S., Cordara G., Assenzio B., Cera M.R., Mascia L., Bussolino F., Arese M.
Proc. Natl. Acad. Sci. U.S.A. 106:20782-20787(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[9]"Processing of the synaptic cell adhesion molecule neurexin-3beta by Alzheimer disease alpha- and gamma-secretases."
Bot N., Schweizer C., Ben Halima S., Fraering P.C.
J. Biol. Chem. 286:2762-2773(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEOLYTIC PROCESSING.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ493127 mRNA. Translation: CAD37989.1.
AF123462 Genomic DNA. Translation: AAD13621.1.
AK056530 mRNA. Translation: BAG51739.1.
AL833739 mRNA. Translation: CAH56254.1.
AC008056 Genomic DNA. Translation: AAF09143.1.
AC012099 Genomic DNA. Translation: AAF15058.1.
AC018514 Genomic DNA. Translation: AAF99808.1.
CH471061 Genomic DNA. Translation: EAW81313.1.
CH471061 Genomic DNA. Translation: EAW81315.1.
BC059368 mRNA. Translation: AAH59368.1.
BC068469 mRNA. Translation: AAH68469.1.
BC142649 mRNA. Translation: AAI42650.1.
BC150194 mRNA. Translation: AAI50195.1.
RefSeqNP_001098720.1. NM_001105250.2.
NP_001258949.1. NM_001272020.1.
NP_004787.2. NM_004796.5.
NP_620426.2. NM_138970.4.
UniGeneHs.368307.

3D structure databases

ProteinModelPortalQ9HDB5.
SMRQ9HDB5. Positions 21-261.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114770. 5 interactions.
STRING9606.ENSP00000338349.

Polymorphism databases

DMDM218512141.

Proteomic databases

PRIDEQ9HDB5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000281127; ENSP00000281127; ENSG00000021645. [Q9HDB5-2]
ENST00000428277; ENSP00000394426; ENSG00000021645. [Q9HDB5-4]
ENST00000555387; ENSP00000451393; ENSG00000021645.
ENST00000557594; ENSP00000451672; ENSG00000021645. [Q9HDB5-1]
GeneID9369.
KEGGhsa:9369.
UCSCuc001xuq.3. human. [Q9HDB5-1]
uc001xur.5. human. [Q9HDB5-2]
uc010asw.4. human. [Q9HDB5-4]

Organism-specific databases

CTD9369.
GeneCardsGC14P078710.
HGNCHGNC:8010. NRXN3.
HPAHPA002727.
MIM600567. gene.
neXtProtNX_Q9HDB5.
PharmGKBPA31788.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

HOGENOMHOG000230482.
HOVERGENHBG052670.
KOK07377.

Gene expression databases

ArrayExpressQ9HDB5.
BgeeQ9HDB5.
CleanExHS_NRXN3.
GenevestigatorQ9HDB5.

Family and domain databases

Gene3D2.60.120.200. 1 hit.
InterProIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027158. NRXN1_fam.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PANTHERPTHR10127:SF405. PTHR10127:SF405. 1 hit.
PfamPF02210. Laminin_G_2. 1 hit.
PF01034. Syndecan. 1 hit.
[Graphical view]
SMARTSM00294. 4.1m. 1 hit.
SM00282. LamG. 1 hit.
[Graphical view]
SUPFAMSSF49899. SSF49899. 1 hit.
PROSITEPS50025. LAM_G_DOMAIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNRXN3. human.
GeneWikiNRXN3.
GenomeRNAi9369.
NextBio35088.
SOURCESearch...

Entry information

Entry nameNRX3B_HUMAN
AccessionPrimary (citable) accession number: Q9HDB5
Secondary accession number(s): A5PKW8 expand/collapse secondary AC list , A8MPU5, B3KPM7, Q6NUR0, Q8IUD8
Entry history
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: December 16, 2008
Last modified: April 16, 2014
This is version 111 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM