Q9HDB5 (NRX3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neurexin-3-beta Alternative name(s): Neurexin III-beta Cleaved into the following 2 chains:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 637 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May play a role in angiogenesis By similarity. |
| Subunit structure | The cytoplasmic C-terminal region binds to CASK By similarity. Binds to neuroligins NLGN1, NLGN2 and NLGN3 By similarity. Weakly interacts with CBLN1 and CBLN2. Very weak binding, if any, with CBLN4 By similarity. |
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Expressed in the blood vessel walls (at protein level). Ref.8 |
| Post-translational modification | Proccessed by alpha-secretase leading to the formation of an extracellular soluble protein as well as a C-terminal membrane-embedded fragment (CTF). Proteolysis of these CTFs by gamma-secretase releases intracellular domains (ICDs) and extracellular peptides. |
| Sequence similarities | Belongs to the neurexin family. Contains 1 laminin G-like domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Angiogenesis Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative promoter usage Alternative splicing |
| Domain | Signal Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | angiogenesis Inferred from sequence or structural similarity. Source: UniProtKB cell adhesionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: A number of isoforms, alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. | ||||||
| Isoform 1b (identifier: Q9HDB5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2b (identifier: Q9HDB5-2) The sequence of this isoform differs from the canonical sequence as follows: 328-328: S → ST 329-537: TGGELVIPLL...TSPMFRNVPT → GRS | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 3b (identifier: Q9HDB5-3) The sequence of this isoform differs from the canonical sequence as follows: 200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK 329-367: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...PIIFISCVVH 368-637: Missing. | ||||||
| Note: Produced by alternative splicing. No experimental confirmation available. | ||||||
| Isoform 4b (identifier: Q9HDB5-4) The sequence of this isoform differs from the canonical sequence as follows: 200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK 329-536: Missing. | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 1a (identifier: Q9Y4C0-1) The sequence of this isoform can be found in the external entry Q9Y4C0. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 3a (identifier: Q9Y4C0-3) The sequence of this isoform can be found in the external entry Q9Y4C0. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 4a (identifier: Q9Y4C0-4) The sequence of this isoform can be found in the external entry Q9Y4C0. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative splicing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 35 | 35 | By similarity | ||||||
| Chain | 36 – 637 | 602 | Neurexin-3-beta | PRO_0000019502 | |||||
| Chain | 36 – 550 | 515 | Neurexin-3-beta, soluble form | PRO_0000412543 | |||||
| Chain | 551 – 637 | 87 | Neurexin-3-beta, C-terminal fragment | PRO_0000412544 | |||||
Regions | |||||||||
| Topological domain | 36 – 562 | 527 | Extracellular Potential | ||||||
| Transmembrane | 563 – 583 | 21 | Helical; Potential | ||||||
| Topological domain | 584 – 637 | 54 | Cytoplasmic Potential | ||||||
| Domain | 85 – 255 | 171 | Laminin G-like | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 184 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 252 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 296 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 200 | 1 | T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 3b and isoform 4b. | VSP_035644 | |||||
| Alternative sequence | 328 | 1 | S → ST in isoform 2b. | VSP_036465 | |||||
| Alternative sequence | 329 – 537 | 209 | TGGEL…RNVPT → GRS in isoform 2b. | VSP_036466 | |||||
| Alternative sequence | 329 – 536 | 208 | Missing in isoform 4b. | VSP_040988 | |||||
| Alternative sequence | 329 – 367 | 39 | TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVH in isoform 3b. | VSP_035646 | |||||
| Alternative sequence | 368 – 637 | 270 | Missing in isoform 3b. | VSP_035647 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ493127 mRNA. Translation: CAD37989.1. AF123462 Genomic DNA. Translation: AAD13621.1. AK056530 mRNA. Translation: BAG51739.1. AL833739 mRNA. Translation: CAH56254.1. AC008056 Genomic DNA. Translation: AAF09143.1. AC012099 Genomic DNA. Translation: AAF15058.1. AC018514 Genomic DNA. Translation: AAF99808.1. CH471061 Genomic DNA. Translation: EAW81313.1. CH471061 Genomic DNA. Translation: EAW81315.1. BC059368 mRNA. Translation: AAH59368.1. BC068469 mRNA. Translation: AAH68469.1. BC142649 mRNA. Translation: AAI42650.1. BC150194 mRNA. Translation: AAI50195.1. |
| IPI | IPI00034558. IPI00419705. IPI00853624. IPI00915413. |
| RefSeq | NP_001098720.1. NM_001105250.2. NP_001258949.1. NM_001272020.1. NP_004787.2. NM_004796.5. NP_620426.2. NM_138970.4. |
| UniGene | Hs.368307. |
3D structure databases | |
| ProteinModelPortal | Q9HDB5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000338349. |
Polymorphism databases | |
| DMDM | 218512141. |
Proteomic databases | |
| PRIDE | Q9HDB5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000281127; ENSP00000281127; ENSG00000021645. ENST00000428277; ENSP00000394426; ENSG00000021645. ENST00000555387; ENSP00000451393; ENSG00000021645. ENST00000557594; ENSP00000451672; ENSG00000021645. |
| GeneID | 9369. |
| KEGG | hsa:9369. |
| UCSC | uc001xuq.2. human. uc001xur.4. human. uc010asw.3. human. |
Organism-specific databases | |
| CTD | 9369. |
| GeneCards | GC14P078710. |
| HGNC | HGNC:8010. NRXN3. |
| HPA | HPA002727. |
| MIM | 600567. gene. |
| neXtProt | NX_Q9HDB5. |
| PharmGKB | PA31788. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HOG000230482. |
| HOVERGEN | HBG052670. |
| KO | K07377. |
Gene expression databases | |
| ArrayExpress | Q9HDB5. |
| Bgee | Q9HDB5. |
| CleanEx | HS_NRXN3. |
| Genevestigator | Q9HDB5. |
Family and domain databases | |
| Gene3D | 2.60.120.200. 1 hit. |
| InterPro | IPR008985. ConA-like_lec_gl_sf. IPR013320. ConA-like_subgrp. IPR001791. Laminin_G. IPR003585. Neurexin-like. [Graphical view] |
| Pfam | PF02210. Laminin_G_2. 1 hit. [Graphical view] |
| SMART | SM00294. 4.1m. 1 hit. SM00282. LamG. 1 hit. [Graphical view] |
| SUPFAM | SSF49899. ConA_like_lec_gl. 1 hit. |
| PROSITE | PS50025. LAM_G_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NRXN3. human. |
| GenomeRNAi | 9369. |
| NextBio | 35088. |
| SOURCE | Search... |
Entry information
| Entry name | NRX3B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HDB5 Secondary accession number(s): A5PKW8 Q8IUD8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
