SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HD40

- SPCS_HUMAN

UniProt

Q9HD40 - SPCS_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
O-phosphoseryl-tRNA(Sec) selenium transferase
Gene
SEPSECS, TRNP48
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.1 Publication

Catalytic activityi

O-phospho-L-seryl-tRNA(Sec) + selenophosphate + H2O = L-selenocysteinyl-tRNA(Sec) + 2 phosphate.

Cofactori

Pyridoxal phosphate.2 Publications

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei74 – 741May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylate
Binding sitei75 – 751PLP By similarity
Binding sitei97 – 971Substrate
Binding sitei98 – 981Substrate
Binding sitei105 – 1051Substrate
Binding sitei271 – 2711tRNA variable arm
Binding sitei313 – 3131Substrate
Binding sitei398 – 3981tRNA discriminator base
Binding sitei463 – 4631tRNA acceptor arm

GO - Molecular functioni

  1. protein binding Source: IntAct
  2. pyridoxal phosphate binding Source: InterPro
  3. tRNA binding Source: HGNC
  4. transferase activity, transferring selenium-containing groups Source: InterPro

GO - Biological processi

  1. selenocysteine incorporation Source: HGNC
  2. selenocysteinyl-tRNA(Sec) biosynthetic process Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Protein biosynthesis

Keywords - Ligandi

Pyridoxal phosphate, RNA-binding, Selenium, tRNA-binding

Enzyme and pathway databases

UniPathwayiUPA00906; UER00898.

Names & Taxonomyi

Protein namesi
Recommended name:
O-phosphoseryl-tRNA(Sec) selenium transferase (EC:2.9.1.2)
Alternative name(s):
Liver-pancreas antigen
Short name:
LP
SLA-p35
SLA/LP autoantigen
Selenocysteine synthase
Short name:
Sec synthase
Selenocysteinyl-tRNA(Sec) synthase
Sep-tRNA:Sec-tRNA synthase
Short name:
SepSecS
Soluble liver antigen
Short name:
SLA
UGA suppressor tRNA-associated protein
tRNA(Ser/Sec)-associated antigenic protein
Gene namesi
Name:SEPSECS
Synonyms:TRNP48
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:30605. SEPSECS.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: HGNC
  2. nucleus Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Pontocerebellar hypoplasia 2D (PCH2D) [MIM:613811]: A disorder characterized by postnatal onset of progressive atrophy of the cerebrum and cerebellum, microcephaly, profound mental retardation, spasticity, and variable seizures.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti239 – 2391A → T in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065585
Natural varianti334 – 3341Y → C in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065586

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi75 – 751R → A: Inactive in vivo. 1 Publication
Mutagenesisi97 – 971R → A: Indistinguishable from wild-type. 1 Publication
Mutagenesisi97 – 971R → Q: Indistinguishable from wild-type. 1 Publication
Mutagenesisi105 – 1051Q → A: Inactive in vivo. 1 Publication
Mutagenesisi173 – 1731K → A: Indistinguishable from wild-type. 1 Publication
Mutagenesisi173 – 1731K → M: Indistinguishable from wild-type. 1 Publication
Mutagenesisi284 – 2841K → A: Loss of activity. 1 Publication
Mutagenesisi313 – 3131R → A: Inactive in vivo. 1 Publication

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

MIMi613811. phenotype.
Orphaneti2524. Pontocerebellar hypoplasia type 2.
247198. Progressive cerebello-cerebral atrophy.
PharmGKBiPA162402915.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 501501O-phosphoseryl-tRNA(Sec) selenium transferase
PRO_0000219875Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei284 – 2841N6-(pyridoxal phosphate)lysine

Proteomic databases

MaxQBiQ9HD40.
PaxDbiQ9HD40.
PRIDEiQ9HD40.

PTM databases

PhosphoSiteiQ9HD40.

Expressioni

Tissue specificityi

Primarily expressed in liver, pancreas, kidney and lung. Overexpressed in PHA-stimulated T-cells.

Gene expression databases

ArrayExpressiQ9HD40.
BgeeiQ9HD40.
CleanExiHS_SEPSECS.
GenevestigatoriQ9HD40.

Interactioni

Subunit structurei

Homotetramer formed by a catalytic dimer and a non-catalytic dimer serving as a binding platform that orients tRNASec for catalysis. Each tetramer binds the CCA ends of two tRNAs which point to the active sites of the catalytic dimer.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
gagP045913EBI-6163446,EBI-6163428From a different organism.

Protein-protein interaction databases

BioGridi119280. 3 interactions.
IntActiQ9HD40. 2 interactions.
STRINGi9606.ENSP00000305956.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi26 – 3813
Helixi48 – 5912
Helixi63 – 653
Helixi82 – 876
Turni88 – 903
Helixi109 – 12820
Beta strandi136 – 1427
Helixi144 – 15815
Beta strandi164 – 1685
Helixi173 – 1819
Beta strandi185 – 1895
Beta strandi191 – 1944
Beta strandi197 – 2004
Helixi202 – 21211
Helixi214 – 2163
Beta strandi217 – 2237
Helixi235 – 24511
Beta strandi249 – 2524
Helixi260 – 27213
Beta strandi277 – 2815
Helixi282 – 2865
Beta strandi293 – 2986
Helixi300 – 3089
Helixi317 – 35741
Turni358 – 3603
Beta strandi370 – 3767
Turni382 – 3843
Helixi387 – 39711
Beta strandi404 – 4063
Beta strandi412 – 4143
Beta strandi417 – 4215
Turni422 – 4254
Beta strandi433 – 4375
Helixi444 – 46219

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3HL2X-ray2.81A/B/C/D1-501[»]
ProteinModelPortaliQ9HD40.
SMRiQ9HD40. Positions 20-464.

Miscellaneous databases

EvolutionaryTraceiQ9HD40.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 4444Tetramerization
Add
BLAST
Regioni96 – 10611Phosphate loop (P-loop)
Add
BLAST
Regioni474 – 49320SLA/LP epitope
Add
BLAST

Sequence similaritiesi

Belongs to the SepSecS family.

Phylogenomic databases

eggNOGiCOG0076.
HOGENOMiHOG000254245.
HOVERGENiHBG061363.
InParanoidiQ9HD40.
KOiK03341.
OMAiNDYPCAY.
OrthoDBiEOG71G9TX.
PhylomeDBiQ9HD40.
TreeFamiTF314381.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
InterProiIPR019793. Peroxidases_heam-ligand_BS.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR019872. Sec-tRNA_Se_transferase.
IPR008829. SLA/LP_auto_ag.
[Graphical view]
PANTHERiPTHR12944. PTHR12944. 1 hit.
PfamiPF05889. SLA_LP_auto_ag. 1 hit.
[Graphical view]
PIRSFiPIRSF017689. SepSecS. 1 hit.
SUPFAMiSSF53383. SSF53383. 1 hit.
TIGRFAMsiTIGR03531. selenium_SpcS. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HD40-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNRESFAAGE RLVSPAYVRQ GCEARRSHEH LIRLLLEKGK CPENGWDEST    50
LELFLHELAI MDSNNFLGNC GVGEREGRVA SALVARRHYR FIHGIGRSGD 100
ISAVQPKAAG SSLLNKITNS LVLDIIKLAG VHTVANCFVV PMATGMSLTL 150
CFLTLRHKRP KAKYIIWPRI DQKSCFKSMI TAGFEPVVIE NVLEGDELRT 200
DLKAVEAKVQ ELGPDCILCI HSTTSCFAPR VPDRLEELAV ICANYDIPHI 250
VNNAYGVQSS KCMHLIQQGA RVGRIDAFVQ SLDKNFMVPV GGAIIAGFND 300
SFIQEISKMY PGRASASPSL DVLITLLSLG SNGYKKLLKE RKEMFSYLSN 350
QIKKLSEAYN ERLLHTPHNP ISLAMTLKTL DEHRDKAVTQ LGSMLFTRQV 400
SGARVVPLGS MQTVSGYTFR GFMSHTNNYP CAYLNAASAI GMKMQDVDLF 450
IKRLDRCLKA VRKERSKESD DNYDKTEDVD IEEMALKLDN VLLDTYQDAS 500
S 501
Length:501
Mass (Da):55,726
Last modified:March 29, 2005 - v2
Checksum:i7136FB390B18760B
GO
Isoform 2 (identifier: Q9HD40-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-47: GKCPENGWD → VHSWHWTIR
     48-501: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:47
Mass (Da):5,627
Checksum:i958F3F91D272149B
GO
Isoform 3 (identifier: Q9HD40-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEK → MQCDDLGSLQPPPPGFTPFACLSLPSSWDYRRPPPHP

Show »
Length:500
Mass (Da):55,411
Checksum:i82AE23050D9C2011
GO

Sequence cautioni

The sequence CAB89517.1 differs from that shown. Reason: Frameshift at position 39.
The sequence CAB62209.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti239 – 2391A → T in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065585
Natural varianti334 – 3341Y → C in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065586

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3838MNRES…LLLEK → MQCDDLGSLQPPPPGFTPFA CLSLPSSWDYRRPPPHP in isoform 3.
VSP_038080Add
BLAST
Alternative sequencei39 – 479GKCPENGWD → VHSWHWTIR in isoform 2.
VSP_038078
Alternative sequencei48 – 501454Missing in isoform 2.
VSP_038079Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti98 – 981S → P in AAG00491. 1 Publication
Sequence conflicti264 – 2641H → R in BAF85165. 1 Publication
Sequence conflicti398 – 3981R → K in AAD33963. 1 Publication
Sequence conflicti398 – 3981R → K in CAB89517. 1 Publication
Sequence conflicti452 – 4521K → N in AAD33963. 1 Publication
Sequence conflicti452 – 4521K → N in CAB89517. 1 Publication
Sequence conflicti467 – 4671K → R in AAG00491. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK292476 mRNA. Translation: BAF85165.1.
BX648976 mRNA. No translation available.
AC007073 Genomic DNA. No translation available.
AC104662 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92832.1.
BC023539 mRNA. Translation: AAH23539.1. Sequence problems.
BC117202 mRNA. Translation: AAI17203.1.
AF146396 mRNA. Translation: AAD33963.2. Sequence problems.
AJ277541 mRNA. Translation: CAB89517.1. Frameshift.
AJ238617 mRNA. Translation: CAB62209.1. Different initiation.
AF282065 mRNA. Translation: AAG00491.1.
CCDSiCCDS3432.2. [Q9HD40-1]
RefSeqiNP_058651.3. NM_016955.3. [Q9HD40-1]
XP_005248225.1. XM_005248168.1.
XP_006714028.1. XM_006713965.1.
UniGeneiHs.253305.

Genome annotation databases

EnsembliENST00000302922; ENSP00000305956; ENSG00000109618.
ENST00000382103; ENSP00000371535; ENSG00000109618. [Q9HD40-1]
ENST00000514585; ENSP00000421880; ENSG00000109618. [Q9HD40-2]
GeneIDi51091.
KEGGihsa:51091.
UCSCiuc003grg.3. human. [Q9HD40-1]
uc003gri.3. human. [Q9HD40-3]

Polymorphism databases

DMDMi62287911.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK292476 mRNA. Translation: BAF85165.1 .
BX648976 mRNA. No translation available.
AC007073 Genomic DNA. No translation available.
AC104662 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92832.1 .
BC023539 mRNA. Translation: AAH23539.1 . Sequence problems.
BC117202 mRNA. Translation: AAI17203.1 .
AF146396 mRNA. Translation: AAD33963.2 . Sequence problems.
AJ277541 mRNA. Translation: CAB89517.1 . Frameshift.
AJ238617 mRNA. Translation: CAB62209.1 . Different initiation.
AF282065 mRNA. Translation: AAG00491.1 .
CCDSi CCDS3432.2. [Q9HD40-1 ]
RefSeqi NP_058651.3. NM_016955.3. [Q9HD40-1 ]
XP_005248225.1. XM_005248168.1.
XP_006714028.1. XM_006713965.1.
UniGenei Hs.253305.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3HL2 X-ray 2.81 A/B/C/D 1-501 [» ]
ProteinModelPortali Q9HD40.
SMRi Q9HD40. Positions 20-464.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119280. 3 interactions.
IntActi Q9HD40. 2 interactions.
STRINGi 9606.ENSP00000305956.

Chemistry

DrugBanki DB00114. Pyridoxal Phosphate.

PTM databases

PhosphoSitei Q9HD40.

Polymorphism databases

DMDMi 62287911.

Proteomic databases

MaxQBi Q9HD40.
PaxDbi Q9HD40.
PRIDEi Q9HD40.

Protocols and materials databases

DNASUi 51091.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000302922 ; ENSP00000305956 ; ENSG00000109618 .
ENST00000382103 ; ENSP00000371535 ; ENSG00000109618 . [Q9HD40-1 ]
ENST00000514585 ; ENSP00000421880 ; ENSG00000109618 . [Q9HD40-2 ]
GeneIDi 51091.
KEGGi hsa:51091.
UCSCi uc003grg.3. human. [Q9HD40-1 ]
uc003gri.3. human. [Q9HD40-3 ]

Organism-specific databases

CTDi 51091.
GeneCardsi GC04M025121.
HGNCi HGNC:30605. SEPSECS.
MIMi 613009. gene.
613811. phenotype.
neXtProti NX_Q9HD40.
Orphaneti 2524. Pontocerebellar hypoplasia type 2.
247198. Progressive cerebello-cerebral atrophy.
PharmGKBi PA162402915.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0076.
HOGENOMi HOG000254245.
HOVERGENi HBG061363.
InParanoidi Q9HD40.
KOi K03341.
OMAi NDYPCAY.
OrthoDBi EOG71G9TX.
PhylomeDBi Q9HD40.
TreeFami TF314381.

Enzyme and pathway databases

UniPathwayi UPA00906 ; UER00898 .

Miscellaneous databases

EvolutionaryTracei Q9HD40.
GeneWikii SEPSECS.
GenomeRNAii 51091.
NextBioi 53771.
PROi Q9HD40.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9HD40.
Bgeei Q9HD40.
CleanExi HS_SEPSECS.
Genevestigatori Q9HD40.

Family and domain databases

Gene3Di 3.40.640.10. 1 hit.
InterProi IPR019793. Peroxidases_heam-ligand_BS.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR019872. Sec-tRNA_Se_transferase.
IPR008829. SLA/LP_auto_ag.
[Graphical view ]
PANTHERi PTHR12944. PTHR12944. 1 hit.
Pfami PF05889. SLA_LP_auto_ag. 1 hit.
[Graphical view ]
PIRSFi PIRSF017689. SepSecS. 1 hit.
SUPFAMi SSF53383. SSF53383. 1 hit.
TIGRFAMsi TIGR03531. selenium_SpcS. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Endometrium.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Muscle.
  6. "Identification of target antigen for SLA/LP autoantibodies in autoimmune hepatitis."
    Wies I., Brunner S., Henninger J., Herkel J., Kanzler S., Meyer zum Bueschenfelde K.-H., Lohse A.W.
    Lancet 355:1510-1515(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 2).
    Tissue: Liver and T-cell lymphoma.
  7. "Isolation and characterization of cDNA encoding the antigenic protein of the human tRNP(Ser)Sec complex recognized by autoantibodies from patients withtype-1 autoimmune hepatitis."
    Costa M., Rodriguez-Sanchez J.L., Czaja A.J., Gelpi C.
    Clin. Exp. Immunol. 121:364-374(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1).
    Tissue: Liver.
  8. "Coding sequence of the human SLA/LP autoantigen."
    Seelig H.-P., Wiemann C., Plaikner M., Schranz P., Seelig R., Renz M.
    Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1).
    Tissue: Liver.
  9. "Soluble liver antigen: isolation of a 35-kd recombinant protein (SLA-p35) specifically recognizing sera from patients with autoimmune hepatitis."
    Volkmann M., Martin L., Baeurle A., Heid H., Strassburg C.P., Trautwein C., Fiehn W., Manns M.P.
    Hepatology 33:591-596(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-501.
  10. "Fine specificity of autoantibodies to soluble liver antigen and liver/pancreas."
    Herkel J., Heidrich B., Nieraad N., Wies I., Rother M., Lohse A.W.
    Hepatology 35:403-408(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 434-493, SLA/LP EPITOPE MAPPING.
  11. "RNA-dependent conversion of phosphoserine forms selenocysteine in eukaryotes and archaea."
    Yuan J., Palioura S., Salazar J.C., Su D., O'Donoghue P., Hohn M.J., Cardoso A.M., Whitman W.B., Soell D.
    Proc. Natl. Acad. Sci. U.S.A. 103:18923-18927(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, COFACTOR, MUTAGENESIS OF LYS-284.
  12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "The human SepSecS-tRNASec complex reveals the mechanism of selenocysteine formation."
    Palioura S., Sherrer R.L., Steitz T.A., Soll D., Simonovic M.
    Science 325:321-325(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.81 ANGSTROMS) IN COMPLEX WITH TRNA AND PYRIDOXAL PHOSPHATE, SUBUNIT, SUBSTRATE-BINDING SITES, COFACTOR, MUTAGENESIS OF ARG-75; ARG-97; GLN-105; LYS-173 AND ARG-313.
  14. Cited for: VARIANTS PCH2D THR-239 AND CYS-334, CHARACTERIZATION OF VARIANTS PCH2D THR-239 AND CYS-334.

Entry informationi

Entry nameiSPCS_HUMAN
AccessioniPrimary (citable) accession number: Q9HD40
Secondary accession number(s): A8K8W1
, Q0D2P3, Q17RT1, Q9NXZ5, Q9UGM9, Q9Y353
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 29, 2005
Last modified: September 3, 2014
This is version 110 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Possible diagnostic marker for autoimmune hepatitis (AIH).

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi