Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HD40

- SPCS_HUMAN

UniProt

Q9HD40 - SPCS_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

O-phosphoseryl-tRNA(Sec) selenium transferase

Gene

SEPSECS

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.1 Publication

Catalytic activityi

O-phospho-L-seryl-tRNA(Sec) + selenophosphate + H2O = L-selenocysteinyl-tRNA(Sec) + 2 phosphate.

Cofactori

pyridoxal 5'-phosphate2 Publications

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei74 – 741May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylate
Binding sitei75 – 751PLPBy similarity
Binding sitei97 – 971Substrate
Binding sitei98 – 981Substrate
Binding sitei105 – 1051Substrate
Binding sitei271 – 2711tRNA variable arm1 Publication
Binding sitei313 – 3131Substrate
Binding sitei398 – 3981tRNA discriminator base1 Publication
Binding sitei463 – 4631tRNA acceptor arm1 Publication

GO - Molecular functioni

  1. pyridoxal phosphate binding Source: InterPro
  2. transferase activity, transferring selenium-containing groups Source: InterPro
  3. tRNA binding Source: HGNC

GO - Biological processi

  1. selenocysteine incorporation Source: HGNC
  2. selenocysteinyl-tRNA(Sec) biosynthetic process Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Protein biosynthesis

Keywords - Ligandi

Pyridoxal phosphate, RNA-binding, Selenium, tRNA-binding

Enzyme and pathway databases

UniPathwayiUPA00906; UER00898.

Names & Taxonomyi

Protein namesi
Recommended name:
O-phosphoseryl-tRNA(Sec) selenium transferase (EC:2.9.1.2)
Alternative name(s):
Liver-pancreas antigen
Short name:
LP
SLA-p35
SLA/LP autoantigen
Selenocysteine synthase
Short name:
Sec synthase
Selenocysteinyl-tRNA(Sec) synthase
Sep-tRNA:Sec-tRNA synthase
Short name:
SepSecS
Soluble liver antigen
Short name:
SLA
UGA suppressor tRNA-associated protein
tRNA(Ser/Sec)-associated antigenic protein
Gene namesi
Name:SEPSECS
Synonyms:TRNP48
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:30605. SEPSECS.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: HGNC
  2. nucleus Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Pontocerebellar hypoplasia 2D (PCH2D) [MIM:613811]: A disorder characterized by postnatal onset of progressive atrophy of the cerebrum and cerebellum, microcephaly, profound mental retardation, spasticity, and variable seizures.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti239 – 2391A → T in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065585
Natural varianti334 – 3341Y → C in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065586

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi75 – 751R → A: Inactive in vivo. 1 Publication
Mutagenesisi97 – 971R → A: Indistinguishable from wild-type. 1 Publication
Mutagenesisi97 – 971R → Q: Indistinguishable from wild-type. 1 Publication
Mutagenesisi105 – 1051Q → A: Inactive in vivo. 1 Publication
Mutagenesisi173 – 1731K → A: Indistinguishable from wild-type. 1 Publication
Mutagenesisi173 – 1731K → M: Indistinguishable from wild-type. 1 Publication
Mutagenesisi284 – 2841K → A: Loss of activity. 1 Publication
Mutagenesisi313 – 3131R → A: Inactive in vivo. 1 Publication

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

MIMi613811. phenotype.
Orphaneti2524. Pontocerebellar hypoplasia type 2.
247198. Progressive cerebello-cerebral atrophy.
PharmGKBiPA162402915.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 501501O-phosphoseryl-tRNA(Sec) selenium transferasePRO_0000219875Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei284 – 2841N6-(pyridoxal phosphate)lysine

Proteomic databases

MaxQBiQ9HD40.
PaxDbiQ9HD40.
PRIDEiQ9HD40.

PTM databases

PhosphoSiteiQ9HD40.

Expressioni

Tissue specificityi

Primarily expressed in liver, pancreas, kidney and lung. Overexpressed in PHA-stimulated T-cells.

Gene expression databases

BgeeiQ9HD40.
CleanExiHS_SEPSECS.
ExpressionAtlasiQ9HD40. baseline and differential.
GenevestigatoriQ9HD40.

Interactioni

Subunit structurei

Homotetramer formed by a catalytic dimer and a non-catalytic dimer serving as a binding platform that orients tRNASec for catalysis. Each tetramer binds the CCA ends of two tRNAs which point to the active sites of the catalytic dimer.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
gagP045913EBI-6163446,EBI-6163428From a different organism.

Protein-protein interaction databases

BioGridi119280. 5 interactions.
IntActiQ9HD40. 2 interactions.
STRINGi9606.ENSP00000305956.

Structurei

Secondary structure

1
501
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi26 – 3813Combined sources
Helixi48 – 5912Combined sources
Helixi63 – 653Combined sources
Helixi82 – 876Combined sources
Turni88 – 903Combined sources
Helixi109 – 12820Combined sources
Beta strandi136 – 1427Combined sources
Helixi144 – 15815Combined sources
Beta strandi164 – 1685Combined sources
Helixi173 – 1819Combined sources
Beta strandi185 – 1895Combined sources
Beta strandi191 – 1944Combined sources
Beta strandi197 – 2004Combined sources
Helixi202 – 21211Combined sources
Helixi214 – 2163Combined sources
Beta strandi217 – 2237Combined sources
Helixi235 – 24511Combined sources
Beta strandi249 – 2524Combined sources
Helixi260 – 27213Combined sources
Beta strandi277 – 2815Combined sources
Helixi282 – 2865Combined sources
Beta strandi293 – 2986Combined sources
Helixi300 – 3089Combined sources
Helixi317 – 35741Combined sources
Turni358 – 3603Combined sources
Beta strandi370 – 3767Combined sources
Turni382 – 3843Combined sources
Helixi387 – 39711Combined sources
Beta strandi404 – 4063Combined sources
Beta strandi412 – 4143Combined sources
Beta strandi417 – 4215Combined sources
Turni422 – 4254Combined sources
Beta strandi433 – 4375Combined sources
Helixi444 – 46219Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3HL2X-ray2.81A/B/C/D1-501[»]
ProteinModelPortaliQ9HD40.
SMRiQ9HD40. Positions 20-464.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HD40.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 4444TetramerizationAdd
BLAST
Regioni96 – 10611Phosphate loop (P-loop)Add
BLAST
Regioni474 – 49320SLA/LP epitopeAdd
BLAST

Sequence similaritiesi

Belongs to the SepSecS family.Curated

Phylogenomic databases

eggNOGiCOG0076.
GeneTreeiENSGT00390000007332.
HOGENOMiHOG000254245.
HOVERGENiHBG061363.
InParanoidiQ9HD40.
KOiK03341.
OMAiNDYPCAY.
OrthoDBiEOG71G9TX.
PhylomeDBiQ9HD40.
TreeFamiTF314381.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
InterProiIPR019793. Peroxidases_heam-ligand_BS.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR019872. Sec-tRNA_Se_transferase.
IPR008829. SLA/LP_auto_ag.
[Graphical view]
PANTHERiPTHR12944. PTHR12944. 1 hit.
PfamiPF05889. SLA_LP_auto_ag. 1 hit.
[Graphical view]
PIRSFiPIRSF017689. SepSecS. 1 hit.
SUPFAMiSSF53383. SSF53383. 1 hit.
TIGRFAMsiTIGR03531. selenium_SpcS. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HD40-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRESFAAGE RLVSPAYVRQ GCEARRSHEH LIRLLLEKGK CPENGWDEST
60 70 80 90 100
LELFLHELAI MDSNNFLGNC GVGEREGRVA SALVARRHYR FIHGIGRSGD
110 120 130 140 150
ISAVQPKAAG SSLLNKITNS LVLDIIKLAG VHTVANCFVV PMATGMSLTL
160 170 180 190 200
CFLTLRHKRP KAKYIIWPRI DQKSCFKSMI TAGFEPVVIE NVLEGDELRT
210 220 230 240 250
DLKAVEAKVQ ELGPDCILCI HSTTSCFAPR VPDRLEELAV ICANYDIPHI
260 270 280 290 300
VNNAYGVQSS KCMHLIQQGA RVGRIDAFVQ SLDKNFMVPV GGAIIAGFND
310 320 330 340 350
SFIQEISKMY PGRASASPSL DVLITLLSLG SNGYKKLLKE RKEMFSYLSN
360 370 380 390 400
QIKKLSEAYN ERLLHTPHNP ISLAMTLKTL DEHRDKAVTQ LGSMLFTRQV
410 420 430 440 450
SGARVVPLGS MQTVSGYTFR GFMSHTNNYP CAYLNAASAI GMKMQDVDLF
460 470 480 490 500
IKRLDRCLKA VRKERSKESD DNYDKTEDVD IEEMALKLDN VLLDTYQDAS

S
Length:501
Mass (Da):55,726
Last modified:March 29, 2005 - v2
Checksum:i7136FB390B18760B
GO
Isoform 2 (identifier: Q9HD40-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-47: GKCPENGWD → VHSWHWTIR
     48-501: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:47
Mass (Da):5,627
Checksum:i958F3F91D272149B
GO
Isoform 3 (identifier: Q9HD40-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEK → MQCDDLGSLQPPPPGFTPFACLSLPSSWDYRRPPPHP

Show »
Length:500
Mass (Da):55,411
Checksum:i82AE23050D9C2011
GO

Sequence cautioni

The sequence CAB62209.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAB89517.1 differs from that shown. Reason: Frameshift at position 39. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti98 – 981S → P in AAG00491. 1 PublicationCurated
Sequence conflicti264 – 2641H → R in BAF85165. (PubMed:14702039)Curated
Sequence conflicti398 – 3981R → K in AAD33963. (PubMed:10801173)Curated
Sequence conflicti398 – 3981R → K in CAB89517. (PubMed:10801173)Curated
Sequence conflicti452 – 4521K → N in AAD33963. (PubMed:10801173)Curated
Sequence conflicti452 – 4521K → N in CAB89517. (PubMed:10801173)Curated
Sequence conflicti467 – 4671K → R in AAG00491. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti239 – 2391A → T in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065585
Natural varianti334 – 3341Y → C in PCH2D; abrogates enzyme activity. 1 Publication
VAR_065586

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3838MNRES…LLLEK → MQCDDLGSLQPPPPGFTPFA CLSLPSSWDYRRPPPHP in isoform 3. 1 PublicationVSP_038080Add
BLAST
Alternative sequencei39 – 479GKCPENGWD → VHSWHWTIR in isoform 2. 2 PublicationsVSP_038078
Alternative sequencei48 – 501454Missing in isoform 2. 2 PublicationsVSP_038079Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK292476 mRNA. Translation: BAF85165.1.
BX648976 mRNA. No translation available.
AC007073 Genomic DNA. No translation available.
AC104662 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92832.1.
BC023539 mRNA. Translation: AAH23539.1. Sequence problems.
BC117202 mRNA. Translation: AAI17203.1.
AF146396 mRNA. Translation: AAD33963.2. Sequence problems.
AJ277541 mRNA. Translation: CAB89517.1. Frameshift.
AJ238617 mRNA. Translation: CAB62209.1. Different initiation.
AF282065 mRNA. Translation: AAG00491.1.
CCDSiCCDS3432.2. [Q9HD40-1]
RefSeqiNP_058651.3. NM_016955.3. [Q9HD40-1]
XP_005248225.1. XM_005248168.1.
XP_006714028.1. XM_006713965.1.
UniGeneiHs.253305.

Genome annotation databases

EnsembliENST00000382103; ENSP00000371535; ENSG00000109618. [Q9HD40-1]
ENST00000514585; ENSP00000421880; ENSG00000109618. [Q9HD40-2]
GeneIDi51091.
KEGGihsa:51091.
UCSCiuc003grg.3. human. [Q9HD40-1]
uc003gri.3. human. [Q9HD40-3]

Polymorphism databases

DMDMi62287911.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK292476 mRNA. Translation: BAF85165.1 .
BX648976 mRNA. No translation available.
AC007073 Genomic DNA. No translation available.
AC104662 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92832.1 .
BC023539 mRNA. Translation: AAH23539.1 . Sequence problems.
BC117202 mRNA. Translation: AAI17203.1 .
AF146396 mRNA. Translation: AAD33963.2 . Sequence problems.
AJ277541 mRNA. Translation: CAB89517.1 . Frameshift.
AJ238617 mRNA. Translation: CAB62209.1 . Different initiation.
AF282065 mRNA. Translation: AAG00491.1 .
CCDSi CCDS3432.2. [Q9HD40-1 ]
RefSeqi NP_058651.3. NM_016955.3. [Q9HD40-1 ]
XP_005248225.1. XM_005248168.1.
XP_006714028.1. XM_006713965.1.
UniGenei Hs.253305.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3HL2 X-ray 2.81 A/B/C/D 1-501 [» ]
ProteinModelPortali Q9HD40.
SMRi Q9HD40. Positions 20-464.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119280. 5 interactions.
IntActi Q9HD40. 2 interactions.
STRINGi 9606.ENSP00000305956.

PTM databases

PhosphoSitei Q9HD40.

Polymorphism databases

DMDMi 62287911.

Proteomic databases

MaxQBi Q9HD40.
PaxDbi Q9HD40.
PRIDEi Q9HD40.

Protocols and materials databases

DNASUi 51091.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000382103 ; ENSP00000371535 ; ENSG00000109618 . [Q9HD40-1 ]
ENST00000514585 ; ENSP00000421880 ; ENSG00000109618 . [Q9HD40-2 ]
GeneIDi 51091.
KEGGi hsa:51091.
UCSCi uc003grg.3. human. [Q9HD40-1 ]
uc003gri.3. human. [Q9HD40-3 ]

Organism-specific databases

CTDi 51091.
GeneCardsi GC04M025121.
HGNCi HGNC:30605. SEPSECS.
MIMi 613009. gene.
613811. phenotype.
neXtProti NX_Q9HD40.
Orphaneti 2524. Pontocerebellar hypoplasia type 2.
247198. Progressive cerebello-cerebral atrophy.
PharmGKBi PA162402915.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0076.
GeneTreei ENSGT00390000007332.
HOGENOMi HOG000254245.
HOVERGENi HBG061363.
InParanoidi Q9HD40.
KOi K03341.
OMAi NDYPCAY.
OrthoDBi EOG71G9TX.
PhylomeDBi Q9HD40.
TreeFami TF314381.

Enzyme and pathway databases

UniPathwayi UPA00906 ; UER00898 .

Miscellaneous databases

EvolutionaryTracei Q9HD40.
GeneWikii SEPSECS.
GenomeRNAii 51091.
NextBioi 53771.
PROi Q9HD40.
SOURCEi Search...

Gene expression databases

Bgeei Q9HD40.
CleanExi HS_SEPSECS.
ExpressionAtlasi Q9HD40. baseline and differential.
Genevestigatori Q9HD40.

Family and domain databases

Gene3Di 3.40.640.10. 1 hit.
InterProi IPR019793. Peroxidases_heam-ligand_BS.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR019872. Sec-tRNA_Se_transferase.
IPR008829. SLA/LP_auto_ag.
[Graphical view ]
PANTHERi PTHR12944. PTHR12944. 1 hit.
Pfami PF05889. SLA_LP_auto_ag. 1 hit.
[Graphical view ]
PIRSFi PIRSF017689. SepSecS. 1 hit.
SUPFAMi SSF53383. SSF53383. 1 hit.
TIGRFAMsi TIGR03531. selenium_SpcS. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Endometrium.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Muscle.
  6. "Identification of target antigen for SLA/LP autoantibodies in autoimmune hepatitis."
    Wies I., Brunner S., Henninger J., Herkel J., Kanzler S., Meyer zum Bueschenfelde K.-H., Lohse A.W.
    Lancet 355:1510-1515(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 2).
    Tissue: Liver and T-cell lymphoma.
  7. "Isolation and characterization of cDNA encoding the antigenic protein of the human tRNP(Ser)Sec complex recognized by autoantibodies from patients withtype-1 autoimmune hepatitis."
    Costa M., Rodriguez-Sanchez J.L., Czaja A.J., Gelpi C.
    Clin. Exp. Immunol. 121:364-374(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1).
    Tissue: Liver.
  8. "Coding sequence of the human SLA/LP autoantigen."
    Seelig H.-P., Wiemann C., Plaikner M., Schranz P., Seelig R., Renz M.
    Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1).
    Tissue: Liver.
  9. "Soluble liver antigen: isolation of a 35-kd recombinant protein (SLA-p35) specifically recognizing sera from patients with autoimmune hepatitis."
    Volkmann M., Martin L., Baeurle A., Heid H., Strassburg C.P., Trautwein C., Fiehn W., Manns M.P.
    Hepatology 33:591-596(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-501.
  10. "Fine specificity of autoantibodies to soluble liver antigen and liver/pancreas."
    Herkel J., Heidrich B., Nieraad N., Wies I., Rother M., Lohse A.W.
    Hepatology 35:403-408(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 434-493, SLA/LP EPITOPE MAPPING.
  11. "RNA-dependent conversion of phosphoserine forms selenocysteine in eukaryotes and archaea."
    Yuan J., Palioura S., Salazar J.C., Su D., O'Donoghue P., Hohn M.J., Cardoso A.M., Whitman W.B., Soell D.
    Proc. Natl. Acad. Sci. U.S.A. 103:18923-18927(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, COFACTOR, MUTAGENESIS OF LYS-284.
  12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "The human SepSecS-tRNASec complex reveals the mechanism of selenocysteine formation."
    Palioura S., Sherrer R.L., Steitz T.A., Soll D., Simonovic M.
    Science 325:321-325(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.81 ANGSTROMS) IN COMPLEX WITH TRNA AND PYRIDOXAL PHOSPHATE, SUBUNIT, SUBSTRATE-BINDING SITES, COFACTOR, MUTAGENESIS OF ARG-75; ARG-97; GLN-105; LYS-173 AND ARG-313.
  14. Cited for: VARIANTS PCH2D THR-239 AND CYS-334, CHARACTERIZATION OF VARIANTS PCH2D THR-239 AND CYS-334.

Entry informationi

Entry nameiSPCS_HUMAN
AccessioniPrimary (citable) accession number: Q9HD40
Secondary accession number(s): A8K8W1
, Q0D2P3, Q17RT1, Q9NXZ5, Q9UGM9, Q9Y353
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 29, 2005
Last modified: November 26, 2014
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Possible diagnostic marker for autoimmune hepatitis (AIH).

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3