Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HD40

- SPCS_HUMAN

UniProt

Q9HD40 - SPCS_HUMAN

Protein

O-phosphoseryl-tRNA(Sec) selenium transferase

Gene

SEPSECS

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 2 (29 Mar 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.1 Publication

    Catalytic activityi

    O-phospho-L-seryl-tRNA(Sec) + selenophosphate + H2O = L-selenocysteinyl-tRNA(Sec) + 2 phosphate.

    Cofactori

    Pyridoxal phosphate.2 Publications

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei74 – 741May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylate
    Binding sitei75 – 751PLPBy similarity
    Binding sitei97 – 971Substrate
    Binding sitei98 – 981Substrate
    Binding sitei105 – 1051Substrate
    Binding sitei271 – 2711tRNA variable arm1 Publication
    Binding sitei313 – 3131Substrate
    Binding sitei398 – 3981tRNA discriminator base1 Publication
    Binding sitei463 – 4631tRNA acceptor arm1 Publication

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. pyridoxal phosphate binding Source: InterPro
    3. transferase activity, transferring selenium-containing groups Source: InterPro
    4. tRNA binding Source: HGNC

    GO - Biological processi

    1. selenocysteine incorporation Source: HGNC
    2. selenocysteinyl-tRNA(Sec) biosynthetic process Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Transferase

    Keywords - Biological processi

    Protein biosynthesis

    Keywords - Ligandi

    Pyridoxal phosphate, RNA-binding, Selenium, tRNA-binding

    Enzyme and pathway databases

    UniPathwayiUPA00906; UER00898.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    O-phosphoseryl-tRNA(Sec) selenium transferase (EC:2.9.1.2)
    Alternative name(s):
    Liver-pancreas antigen
    Short name:
    LP
    SLA-p35
    SLA/LP autoantigen
    Selenocysteine synthase
    Short name:
    Sec synthase
    Selenocysteinyl-tRNA(Sec) synthase
    Sep-tRNA:Sec-tRNA synthase
    Short name:
    SepSecS
    Soluble liver antigen
    Short name:
    SLA
    UGA suppressor tRNA-associated protein
    tRNA(Ser/Sec)-associated antigenic protein
    Gene namesi
    Name:SEPSECS
    Synonyms:TRNP48
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:30605. SEPSECS.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: HGNC
    2. nucleus Source: HGNC

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Involvement in diseasei

    Pontocerebellar hypoplasia 2D (PCH2D) [MIM:613811]: A disorder characterized by postnatal onset of progressive atrophy of the cerebrum and cerebellum, microcephaly, profound mental retardation, spasticity, and variable seizures.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti239 – 2391A → T in PCH2D; abrogates enzyme activity. 1 Publication
    VAR_065585
    Natural varianti334 – 3341Y → C in PCH2D; abrogates enzyme activity. 1 Publication
    VAR_065586

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi75 – 751R → A: Inactive in vivo. 1 Publication
    Mutagenesisi97 – 971R → A: Indistinguishable from wild-type. 1 Publication
    Mutagenesisi97 – 971R → Q: Indistinguishable from wild-type. 1 Publication
    Mutagenesisi105 – 1051Q → A: Inactive in vivo. 1 Publication
    Mutagenesisi173 – 1731K → A: Indistinguishable from wild-type. 1 Publication
    Mutagenesisi173 – 1731K → M: Indistinguishable from wild-type. 1 Publication
    Mutagenesisi284 – 2841K → A: Loss of activity. 1 Publication
    Mutagenesisi313 – 3131R → A: Inactive in vivo. 1 Publication

    Keywords - Diseasei

    Disease mutation, Mental retardation

    Organism-specific databases

    MIMi613811. phenotype.
    Orphaneti2524. Pontocerebellar hypoplasia type 2.
    247198. Progressive cerebello-cerebral atrophy.
    PharmGKBiPA162402915.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 501501O-phosphoseryl-tRNA(Sec) selenium transferasePRO_0000219875Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei284 – 2841N6-(pyridoxal phosphate)lysine

    Proteomic databases

    MaxQBiQ9HD40.
    PaxDbiQ9HD40.
    PRIDEiQ9HD40.

    PTM databases

    PhosphoSiteiQ9HD40.

    Expressioni

    Tissue specificityi

    Primarily expressed in liver, pancreas, kidney and lung. Overexpressed in PHA-stimulated T-cells.

    Gene expression databases

    ArrayExpressiQ9HD40.
    BgeeiQ9HD40.
    CleanExiHS_SEPSECS.
    GenevestigatoriQ9HD40.

    Interactioni

    Subunit structurei

    Homotetramer formed by a catalytic dimer and a non-catalytic dimer serving as a binding platform that orients tRNASec for catalysis. Each tetramer binds the CCA ends of two tRNAs which point to the active sites of the catalytic dimer.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    gagP045913EBI-6163446,EBI-6163428From a different organism.

    Protein-protein interaction databases

    BioGridi119280. 3 interactions.
    IntActiQ9HD40. 2 interactions.
    STRINGi9606.ENSP00000305956.

    Structurei

    Secondary structure

    1
    501
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi26 – 3813
    Helixi48 – 5912
    Helixi63 – 653
    Helixi82 – 876
    Turni88 – 903
    Helixi109 – 12820
    Beta strandi136 – 1427
    Helixi144 – 15815
    Beta strandi164 – 1685
    Helixi173 – 1819
    Beta strandi185 – 1895
    Beta strandi191 – 1944
    Beta strandi197 – 2004
    Helixi202 – 21211
    Helixi214 – 2163
    Beta strandi217 – 2237
    Helixi235 – 24511
    Beta strandi249 – 2524
    Helixi260 – 27213
    Beta strandi277 – 2815
    Helixi282 – 2865
    Beta strandi293 – 2986
    Helixi300 – 3089
    Helixi317 – 35741
    Turni358 – 3603
    Beta strandi370 – 3767
    Turni382 – 3843
    Helixi387 – 39711
    Beta strandi404 – 4063
    Beta strandi412 – 4143
    Beta strandi417 – 4215
    Turni422 – 4254
    Beta strandi433 – 4375
    Helixi444 – 46219

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3HL2X-ray2.81A/B/C/D1-501[»]
    ProteinModelPortaliQ9HD40.
    SMRiQ9HD40. Positions 20-464.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9HD40.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 4444TetramerizationAdd
    BLAST
    Regioni96 – 10611Phosphate loop (P-loop)Add
    BLAST
    Regioni474 – 49320SLA/LP epitopeAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SepSecS family.Curated

    Phylogenomic databases

    eggNOGiCOG0076.
    HOGENOMiHOG000254245.
    HOVERGENiHBG061363.
    InParanoidiQ9HD40.
    KOiK03341.
    OMAiNDYPCAY.
    OrthoDBiEOG71G9TX.
    PhylomeDBiQ9HD40.
    TreeFamiTF314381.

    Family and domain databases

    Gene3Di3.40.640.10. 1 hit.
    InterProiIPR019793. Peroxidases_heam-ligand_BS.
    IPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR019872. Sec-tRNA_Se_transferase.
    IPR008829. SLA/LP_auto_ag.
    [Graphical view]
    PANTHERiPTHR12944. PTHR12944. 1 hit.
    PfamiPF05889. SLA_LP_auto_ag. 1 hit.
    [Graphical view]
    PIRSFiPIRSF017689. SepSecS. 1 hit.
    SUPFAMiSSF53383. SSF53383. 1 hit.
    TIGRFAMsiTIGR03531. selenium_SpcS. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HD40-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNRESFAAGE RLVSPAYVRQ GCEARRSHEH LIRLLLEKGK CPENGWDEST    50
    LELFLHELAI MDSNNFLGNC GVGEREGRVA SALVARRHYR FIHGIGRSGD 100
    ISAVQPKAAG SSLLNKITNS LVLDIIKLAG VHTVANCFVV PMATGMSLTL 150
    CFLTLRHKRP KAKYIIWPRI DQKSCFKSMI TAGFEPVVIE NVLEGDELRT 200
    DLKAVEAKVQ ELGPDCILCI HSTTSCFAPR VPDRLEELAV ICANYDIPHI 250
    VNNAYGVQSS KCMHLIQQGA RVGRIDAFVQ SLDKNFMVPV GGAIIAGFND 300
    SFIQEISKMY PGRASASPSL DVLITLLSLG SNGYKKLLKE RKEMFSYLSN 350
    QIKKLSEAYN ERLLHTPHNP ISLAMTLKTL DEHRDKAVTQ LGSMLFTRQV 400
    SGARVVPLGS MQTVSGYTFR GFMSHTNNYP CAYLNAASAI GMKMQDVDLF 450
    IKRLDRCLKA VRKERSKESD DNYDKTEDVD IEEMALKLDN VLLDTYQDAS 500
    S 501
    Length:501
    Mass (Da):55,726
    Last modified:March 29, 2005 - v2
    Checksum:i7136FB390B18760B
    GO
    Isoform 2 (identifier: Q9HD40-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         39-47: GKCPENGWD → VHSWHWTIR
         48-501: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

    Show »
    Length:47
    Mass (Da):5,627
    Checksum:i958F3F91D272149B
    GO
    Isoform 3 (identifier: Q9HD40-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-38: MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEK → MQCDDLGSLQPPPPGFTPFACLSLPSSWDYRRPPPHP

    Show »
    Length:500
    Mass (Da):55,411
    Checksum:i82AE23050D9C2011
    GO

    Sequence cautioni

    The sequence CAB89517.1 differs from that shown. Reason: Frameshift at position 39.
    The sequence CAB62209.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti98 – 981S → P in AAG00491. 1 PublicationCurated
    Sequence conflicti264 – 2641H → R in BAF85165. (PubMed:14702039)Curated
    Sequence conflicti398 – 3981R → K in AAD33963. (PubMed:10801173)Curated
    Sequence conflicti398 – 3981R → K in CAB89517. (PubMed:10801173)Curated
    Sequence conflicti452 – 4521K → N in AAD33963. (PubMed:10801173)Curated
    Sequence conflicti452 – 4521K → N in CAB89517. (PubMed:10801173)Curated
    Sequence conflicti467 – 4671K → R in AAG00491. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti239 – 2391A → T in PCH2D; abrogates enzyme activity. 1 Publication
    VAR_065585
    Natural varianti334 – 3341Y → C in PCH2D; abrogates enzyme activity. 1 Publication
    VAR_065586

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3838MNRES…LLLEK → MQCDDLGSLQPPPPGFTPFA CLSLPSSWDYRRPPPHP in isoform 3. 1 PublicationVSP_038080Add
    BLAST
    Alternative sequencei39 – 479GKCPENGWD → VHSWHWTIR in isoform 2. 2 PublicationsVSP_038078
    Alternative sequencei48 – 501454Missing in isoform 2. 2 PublicationsVSP_038079Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK292476 mRNA. Translation: BAF85165.1.
    BX648976 mRNA. No translation available.
    AC007073 Genomic DNA. No translation available.
    AC104662 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW92832.1.
    BC023539 mRNA. Translation: AAH23539.1. Sequence problems.
    BC117202 mRNA. Translation: AAI17203.1.
    AF146396 mRNA. Translation: AAD33963.2. Sequence problems.
    AJ277541 mRNA. Translation: CAB89517.1. Frameshift.
    AJ238617 mRNA. Translation: CAB62209.1. Different initiation.
    AF282065 mRNA. Translation: AAG00491.1.
    CCDSiCCDS3432.2. [Q9HD40-1]
    RefSeqiNP_058651.3. NM_016955.3. [Q9HD40-1]
    XP_005248225.1. XM_005248168.1.
    XP_006714028.1. XM_006713965.1.
    UniGeneiHs.253305.

    Genome annotation databases

    EnsembliENST00000382103; ENSP00000371535; ENSG00000109618. [Q9HD40-1]
    ENST00000514585; ENSP00000421880; ENSG00000109618. [Q9HD40-2]
    GeneIDi51091.
    KEGGihsa:51091.
    UCSCiuc003grg.3. human. [Q9HD40-1]
    uc003gri.3. human. [Q9HD40-3]

    Polymorphism databases

    DMDMi62287911.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK292476 mRNA. Translation: BAF85165.1 .
    BX648976 mRNA. No translation available.
    AC007073 Genomic DNA. No translation available.
    AC104662 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW92832.1 .
    BC023539 mRNA. Translation: AAH23539.1 . Sequence problems.
    BC117202 mRNA. Translation: AAI17203.1 .
    AF146396 mRNA. Translation: AAD33963.2 . Sequence problems.
    AJ277541 mRNA. Translation: CAB89517.1 . Frameshift.
    AJ238617 mRNA. Translation: CAB62209.1 . Different initiation.
    AF282065 mRNA. Translation: AAG00491.1 .
    CCDSi CCDS3432.2. [Q9HD40-1 ]
    RefSeqi NP_058651.3. NM_016955.3. [Q9HD40-1 ]
    XP_005248225.1. XM_005248168.1.
    XP_006714028.1. XM_006713965.1.
    UniGenei Hs.253305.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3HL2 X-ray 2.81 A/B/C/D 1-501 [» ]
    ProteinModelPortali Q9HD40.
    SMRi Q9HD40. Positions 20-464.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119280. 3 interactions.
    IntActi Q9HD40. 2 interactions.
    STRINGi 9606.ENSP00000305956.

    Chemistry

    DrugBanki DB00114. Pyridoxal Phosphate.

    PTM databases

    PhosphoSitei Q9HD40.

    Polymorphism databases

    DMDMi 62287911.

    Proteomic databases

    MaxQBi Q9HD40.
    PaxDbi Q9HD40.
    PRIDEi Q9HD40.

    Protocols and materials databases

    DNASUi 51091.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000382103 ; ENSP00000371535 ; ENSG00000109618 . [Q9HD40-1 ]
    ENST00000514585 ; ENSP00000421880 ; ENSG00000109618 . [Q9HD40-2 ]
    GeneIDi 51091.
    KEGGi hsa:51091.
    UCSCi uc003grg.3. human. [Q9HD40-1 ]
    uc003gri.3. human. [Q9HD40-3 ]

    Organism-specific databases

    CTDi 51091.
    GeneCardsi GC04M025121.
    HGNCi HGNC:30605. SEPSECS.
    MIMi 613009. gene.
    613811. phenotype.
    neXtProti NX_Q9HD40.
    Orphaneti 2524. Pontocerebellar hypoplasia type 2.
    247198. Progressive cerebello-cerebral atrophy.
    PharmGKBi PA162402915.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0076.
    HOGENOMi HOG000254245.
    HOVERGENi HBG061363.
    InParanoidi Q9HD40.
    KOi K03341.
    OMAi NDYPCAY.
    OrthoDBi EOG71G9TX.
    PhylomeDBi Q9HD40.
    TreeFami TF314381.

    Enzyme and pathway databases

    UniPathwayi UPA00906 ; UER00898 .

    Miscellaneous databases

    EvolutionaryTracei Q9HD40.
    GeneWikii SEPSECS.
    GenomeRNAii 51091.
    NextBioi 53771.
    PROi Q9HD40.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HD40.
    Bgeei Q9HD40.
    CleanExi HS_SEPSECS.
    Genevestigatori Q9HD40.

    Family and domain databases

    Gene3Di 3.40.640.10. 1 hit.
    InterProi IPR019793. Peroxidases_heam-ligand_BS.
    IPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR019872. Sec-tRNA_Se_transferase.
    IPR008829. SLA/LP_auto_ag.
    [Graphical view ]
    PANTHERi PTHR12944. PTHR12944. 1 hit.
    Pfami PF05889. SLA_LP_auto_ag. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF017689. SepSecS. 1 hit.
    SUPFAMi SSF53383. SSF53383. 1 hit.
    TIGRFAMsi TIGR03531. selenium_SpcS. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Endometrium.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Muscle.
    6. "Identification of target antigen for SLA/LP autoantibodies in autoimmune hepatitis."
      Wies I., Brunner S., Henninger J., Herkel J., Kanzler S., Meyer zum Bueschenfelde K.-H., Lohse A.W.
      Lancet 355:1510-1515(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 2).
      Tissue: Liver and T-cell lymphoma.
    7. "Isolation and characterization of cDNA encoding the antigenic protein of the human tRNP(Ser)Sec complex recognized by autoantibodies from patients withtype-1 autoimmune hepatitis."
      Costa M., Rodriguez-Sanchez J.L., Czaja A.J., Gelpi C.
      Clin. Exp. Immunol. 121:364-374(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1).
      Tissue: Liver.
    8. "Coding sequence of the human SLA/LP autoantigen."
      Seelig H.-P., Wiemann C., Plaikner M., Schranz P., Seelig R., Renz M.
      Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1).
      Tissue: Liver.
    9. "Soluble liver antigen: isolation of a 35-kd recombinant protein (SLA-p35) specifically recognizing sera from patients with autoimmune hepatitis."
      Volkmann M., Martin L., Baeurle A., Heid H., Strassburg C.P., Trautwein C., Fiehn W., Manns M.P.
      Hepatology 33:591-596(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-501.
    10. "Fine specificity of autoantibodies to soluble liver antigen and liver/pancreas."
      Herkel J., Heidrich B., Nieraad N., Wies I., Rother M., Lohse A.W.
      Hepatology 35:403-408(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 434-493, SLA/LP EPITOPE MAPPING.
    11. "RNA-dependent conversion of phosphoserine forms selenocysteine in eukaryotes and archaea."
      Yuan J., Palioura S., Salazar J.C., Su D., O'Donoghue P., Hohn M.J., Cardoso A.M., Whitman W.B., Soell D.
      Proc. Natl. Acad. Sci. U.S.A. 103:18923-18927(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, COFACTOR, MUTAGENESIS OF LYS-284.
    12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "The human SepSecS-tRNASec complex reveals the mechanism of selenocysteine formation."
      Palioura S., Sherrer R.L., Steitz T.A., Soll D., Simonovic M.
      Science 325:321-325(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.81 ANGSTROMS) IN COMPLEX WITH TRNA AND PYRIDOXAL PHOSPHATE, SUBUNIT, SUBSTRATE-BINDING SITES, COFACTOR, MUTAGENESIS OF ARG-75; ARG-97; GLN-105; LYS-173 AND ARG-313.
    14. Cited for: VARIANTS PCH2D THR-239 AND CYS-334, CHARACTERIZATION OF VARIANTS PCH2D THR-239 AND CYS-334.

    Entry informationi

    Entry nameiSPCS_HUMAN
    AccessioniPrimary (citable) accession number: Q9HD40
    Secondary accession number(s): A8K8W1
    , Q0D2P3, Q17RT1, Q9NXZ5, Q9UGM9, Q9Y353
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 29, 2005
    Last sequence update: March 29, 2005
    Last modified: October 1, 2014
    This is version 111 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Possible diagnostic marker for autoimmune hepatitis (AIH).

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3