Q9HD40 (SPCS_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: O-phosphoseryl-tRNA(Sec) selenium transferase EC=2.9.1.2 Alternative name(s): Liver-pancreas antigen Short name=LP SLA-p35 SLA/LP autoantigen Selenocysteine synthase Short name=Sec synthase Selenocysteinyl-tRNA(Sec) synthase Sep-tRNA:Sec-tRNA synthase Short name=SepSecS Soluble liver antigen Short name=SLA UGA suppressor tRNA-associated protein tRNA(Ser/Sec)-associated antigenic protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 501 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis. Ref.11 |
| Catalytic activity | O-phospho-L-seryl-tRNA(Sec) + selenophosphate = L-selenocysteinyl-tRNA(Sec) + phosphate. |
| Cofactor | |
| Pathway | |
| Subunit structure | Homotetramer formed by a catalytic dimer and a non-catalytic dimer serving as a binding platform that orients tRNASec for catalysis. Each tetramer binds the CCA ends of two tRNAs which point to the active sites of the catalytic dimer. Ref.12 |
| Subcellular location | |
| Tissue specificity | Primarily expressed in liver, pancreas, kidney and lung. Overexpressed in PHA-stimulated T-cells. |
| Involvement in disease | Pontocerebellar hypoplasia 2D (PCH2D) [MIM:613811]: A disorder characterized by postnatal onset of progressive atrophy of the cerebrum and cerebellum, microcephaly, profound mental retardation, spasticity, and variable seizures. |
| Miscellaneous | Possible diagnostic marker for autoimmune hepatitis (AIH). |
| Sequence similarities | Belongs to the SepSecS family. |
| Sequence caution | The sequence AAD33963.2 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence AAH23539.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence CAB62209.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAB89517.1 differs from that shown. Reason: Frameshift at position 39. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation |
| Ligand | Pyridoxal phosphate RNA-binding Selenium tRNA-binding |
| Molecular function | Transferase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | selenocysteine incorporation Inferred from sequence or structural similarity. Source: HGNC selenocysteinyl-tRNA(Sec) biosynthetic processInferred from electronic annotation. Source: UniProtKB-UniPathway |
| Cellular_component | cytoplasm Inferred from sequence or structural similarity. Source: HGNC nucleusInferred from sequence or structural similarity. Source: HGNC |
| Molecular_function | pyridoxal phosphate binding Inferred from electronic annotation. Source: InterPro tRNA bindingInferred from sequence or structural similarity. Source: HGNC transferase activity, transferring selenium-containing groupsInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| gag | P04591 | 3 | EBI-6163446,EBI-6163428 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HD40-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HD40-2) The sequence of this isoform differs from the canonical sequence as follows: 39-47: GKCPENGWD → VHSWHWTIR 48-501: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9HD40-3) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEK → MQCDDLGSLQPPPPGFTPFACLSLPSSWDYRRPPPHP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 501 | 501 | O-phosphoseryl-tRNA(Sec) selenium transferase | PRO_0000219875 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 44 | 44 | Tetramerization | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 96 – 106 | 11 | Phosphate loop (P-loop) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 474 – 493 | 20 | SLA/LP epitope | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 75 | 1 | PLP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 97 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 98 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 105 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 271 | 1 | tRNA variable arm | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 313 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 398 | 1 | tRNA discriminator base | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 463 | 1 | tRNA acceptor arm | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 74 | 1 | May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 284 | 1 | N6-(pyridoxal phosphate)lysine | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 38 | 38 | MNRES…LLLEK → MQCDDLGSLQPPPPGFTPFA CLSLPSSWDYRRPPPHP in isoform 3. | VSP_038080 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 39 – 47 | 9 | GKCPENGWD → VHSWHWTIR in isoform 2. | VSP_038078 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 48 – 501 | 454 | Missing in isoform 2. | VSP_038079 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 239 | 1 | A → T in PCH2D; abrogates enzyme activity. Ref.13 | VAR_065585 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 334 | 1 | Y → C in PCH2D; abrogates enzyme activity. Ref.13 | VAR_065586 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 75 | 1 | R → A: Inactive in vivo. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 97 | 1 | R → A: Indistinguishable from wild-type. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 97 | 1 | R → Q: Indistinguishable from wild-type. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 105 | 1 | Q → A: Inactive in vivo. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 173 | 1 | K → A: Indistinguishable from wild-type. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 173 | 1 | K → M: Indistinguishable from wild-type. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 284 | 1 | K → A: Loss of activity. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 313 | 1 | R → A: Inactive in vivo. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 98 | 1 | S → P in AAG00491. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 264 | 1 | H → R in BAF85165. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 398 | 1 | R → K in AAD33963. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 398 | 1 | R → K in CAB89517. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 452 | 1 | K → N in AAD33963. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 452 | 1 | K → N in CAB89517. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 467 | 1 | K → R in AAG00491. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 26 – 38 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 48 – 59 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 63 – 65 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 82 – 87 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 88 – 90 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 128 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 136 – 142 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 144 – 158 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 164 – 168 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 181 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 185 – 189 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 191 – 194 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 197 – 200 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 212 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 214 – 216 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 217 – 223 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 235 – 245 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 249 – 252 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 260 – 272 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 277 – 281 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 282 – 286 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 293 – 298 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 300 – 308 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 317 – 357 | 41 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 358 – 360 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 370 – 376 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 382 – 384 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 387 – 397 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 404 – 406 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 412 – 414 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 417 – 421 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 422 – 425 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 433 – 437 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 444 – 462 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Endometrium. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain and Muscle. |
| [6] | "Identification of target antigen for SLA/LP autoantibodies in autoimmune hepatitis." Wies I., Brunner S., Henninger J., Herkel J., Kanzler S., Meyer zum Bueschenfelde K.-H., Lohse A.W. Lancet 355:1510-1515(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 29-501 (ISOFORM 2). Tissue: Liver and T-cell lymphoma. |
| [7] | "Isolation and characterization of cDNA encoding the antigenic protein of the human tRNP(Ser)Sec complex recognized by autoantibodies from patients withtype-1 autoimmune hepatitis." Costa M., Rodriguez-Sanchez J.L., Czaja A.J., Gelpi C. Clin. Exp. Immunol. 121:364-374(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1). Tissue: Liver. |
| [8] | "Coding sequence of the human SLA/LP autoantigen." Seelig H.-P., Wiemann C., Plaikner M., Schranz P., Seelig R., Renz M. Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-501 (ISOFORM 1). Tissue: Liver. |
| [9] | "Soluble liver antigen: isolation of a 35-kd recombinant protein (SLA-p35) specifically recognizing sera from patients with autoimmune hepatitis." Volkmann M., Martin L., Baeurle A., Heid H., Strassburg C.P., Trautwein C., Fiehn W., Manns M.P. Hepatology 33:591-596(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-501. |
| [10] | "Fine specificity of autoantibodies to soluble liver antigen and liver/pancreas." Herkel J., Heidrich B., Nieraad N., Wies I., Rother M., Lohse A.W. Hepatology 35:403-408(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 434-493, SLA/LP EPITOPE MAPPING. |
| [11] | "RNA-dependent conversion of phosphoserine forms selenocysteine in eukaryotes and archaea." Yuan J., Palioura S., Salazar J.C., Su D., O'Donoghue P., Hohn M.J., Cardoso A.M., Whitman W.B., Soell D. Proc. Natl. Acad. Sci. U.S.A. 103:18923-18927(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, COFACTOR, MUTAGENESIS OF LYS-284. |
| [12] | "The human SepSecS-tRNASec complex reveals the mechanism of selenocysteine formation." Palioura S., Sherrer R.L., Steitz T.A., Soll D., Simonovic M. Science 325:321-325(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.81 ANGSTROMS) IN COMPLEX WITH TRNA AND PYRIDOXAL PHOSPHATE, SUBUNIT, SUBSTRATE-BINDING SITES, COFACTOR, MUTAGENESIS OF ARG-75; ARG-97; GLN-105; LYS-173 AND ARG-313. |
| [13] | "Mutations disrupting selenocysteine formation cause progressive cerebello-cerebral atrophy." Agamy O., Ben Zeev B., Lev D., Marcus B., Fine D., Su D., Narkis G., Ofir R., Hoffmann C., Leshinsky-Silver E., Flusser H., Sivan S., Soll D., Lerman-Sagie T., Birk O.S. Am. J. Hum. Genet. 87:538-544(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PCH2D THR-239 AND CYS-334, CHARACTERIZATION OF VARIANTS PCH2D THR-239 AND CYS-334. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK292476 mRNA. Translation: BAF85165.1. BX648976 mRNA. No translation available. AC007073 Genomic DNA. No translation available. AC104662 Genomic DNA. No translation available. CH471069 Genomic DNA. Translation: EAW92832.1. BC023539 mRNA. Translation: AAH23539.1. Sequence problems. BC117202 mRNA. Translation: AAI17203.1. AF146396 mRNA. Translation: AAD33963.2. Sequence problems. AJ277541 mRNA. Translation: CAB89517.1. Frameshift. AJ238617 mRNA. Translation: CAB62209.1. Different initiation. AF282065 mRNA. Translation: AAG00491.1. | ||||||||||||
| IPI | IPI00155389. IPI00302283. IPI00930339. | ||||||||||||
| RefSeq | NP_058651.3. NM_016955.3. | ||||||||||||
| UniGene | Hs.253305. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9HD40. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9HD40. 1 interaction. | ||||||||||||
| STRING | 9606.ENSP00000305956. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9HD40. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 62287911. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9HD40. | ||||||||||||
| PRIDE | Q9HD40. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 51091. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000302922; ENSP00000305956; ENSG00000109618. ENST00000382103; ENSP00000371535; ENSG00000109618. ENST00000514585; ENSP00000421880; ENSG00000109618. | ||||||||||||
| GeneID | 51091. | ||||||||||||
| KEGG | hsa:51091. | ||||||||||||
| UCSC | uc003grg.3. human. uc003gri.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 51091. | ||||||||||||
| GeneCards | GC04M025121. | ||||||||||||
| HGNC | HGNC:30605. SEPSECS. | ||||||||||||
| MIM | 613009. gene. 613811. phenotype. | ||||||||||||
| neXtProt | NX_Q9HD40. | ||||||||||||
| Orphanet | 2524. Pontocerebellar hypoplasia type 2. 247198. Progressive cerebello-cerebral atrophy. | ||||||||||||
| PharmGKB | PA162402915. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0076. | ||||||||||||
| HOGENOM | HOG000254245. | ||||||||||||
| HOVERGEN | HBG061363. | ||||||||||||
| InParanoid | Q9HD40. | ||||||||||||
| KO | K03341. | ||||||||||||
| OMA | IPHVVNN. | ||||||||||||
| OrthoDB | EOG4JQ3XB. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| UniPathway | UPA00906; UER00898. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9HD40. | ||||||||||||
| Bgee | Q9HD40. | ||||||||||||
| CleanEx | HS_SEPSECS. | ||||||||||||
| Genevestigator | Q9HD40. | ||||||||||||
| GermOnline | ENSG00000109618. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.40.640.10. 1 hit. | ||||||||||||
| InterPro | IPR019793. Peroxidases_heam-ligand_BS. IPR015424. PyrdxlP-dep_Trfase. IPR015421. PyrdxlP-dep_Trfase_major_sub1. IPR019872. Sec-tRNA_Se_transferase. IPR008829. SLA/LP_auto_ag. [Graphical view] | ||||||||||||
| PANTHER | PTHR12944. PTHR12944. 1 hit. | ||||||||||||
| Pfam | PF05889. SLA_LP_auto_ag. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF017689. SepSecS. 1 hit. | ||||||||||||
| SUPFAM | SSF53383. PyrdxlP-dep_Trfase_major. 1 hit. | ||||||||||||
| TIGRFAMs | TIGR03531. selenium_SpcS. 1 hit. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| DrugBank | DB00114. Pyridoxal Phosphate. | ||||||||||||
| EvolutionaryTrace | Q9HD40. | ||||||||||||
| GenomeRNAi | 51091. | ||||||||||||
| NextBio | 53771. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | SPCS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HD40 Secondary accession number(s): A8K8W1 Q9Y353 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
