##gff-version 3
Q9HCU8	UniProtKB	Chain	1	107	.	.	.	ID=PRO_0000186051;Note=DNA polymerase delta subunit 4	
Q9HCU8	UniProtKB	Region	1	44	.	.	.	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite	
Q9HCU8	UniProtKB	Motif	1	16	.	.	.	Note=PCNA-interaction protein motif (PIP box);Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269|PubMed:16510448,ECO:0000269|PubMed:24022480;Dbxref=PMID:16510448,PMID:24022480	
Q9HCU8	UniProtKB	Compositional bias	1	35	.	.	.	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite	
Q9HCU8	UniProtKB	Alternative sequence	63	107	.	.	.	ID=VSP_046864;Note=In isoform 2. GITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL->VSGISIPYEAPRKTSCP;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334	
Q9HCU8	UniProtKB	Natural variant	39	39	.	.	.	ID=VAR_022269;Note=R->P;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.2;Dbxref=dbSNP:rs28364240	
Q9HCU8	UniProtKB	Natural variant	59	59	.	.	.	ID=VAR_057526;Note=G->R;Dbxref=dbSNP:rs34136263	
Q9HCU8	UniProtKB	Mutagenesis	1	16	.	.	.	Note=Complete loss of PCNA binding and of degradation after UV irradiation. Missing;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24022480;Dbxref=PMID:24022480	
Q9HCU8	UniProtKB	Mutagenesis	4	4	.	.	.	Note=No effect on PCNA binding. K->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24022480;Dbxref=PMID:24022480	
Q9HCU8	UniProtKB	Mutagenesis	4	4	.	.	.	Note=No effect on PCNA binding%2C nor on degradation after UV irradiation%3B when associated with Y-10. No effect on PCNA binding%2C but normal degradation after UV irradiation%3B when associated with Y-10 and A-15. K->Q;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24022480;Dbxref=PMID:24022480	
Q9HCU8	UniProtKB	Mutagenesis	4	4	.	.	.	Note=No effect on ubiquitination. Loss of ubiquitination%2C when associated with R-15%2C R-25%2C R-74 and R-89. K->R;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16934752;Dbxref=PMID:16934752	
Q9HCU8	UniProtKB	Mutagenesis	7	7	.	.	.	Note=Complete loss of PCNA binding%3B when associated with 10-AA-11. I->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16510448;Dbxref=PMID:16510448	
Q9HCU8	UniProtKB	Mutagenesis	8	8	.	.	.	Note=Strongly increased stability following UV irradiation%3B when associated with A-9. T->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23913683;Dbxref=PMID:23913683	
Q9HCU8	UniProtKB	Mutagenesis	8	8	.	.	.	Note=Complete loss of PCNA binding. T->D;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24022480;Dbxref=PMID:24022480	
Q9HCU8	UniProtKB	Mutagenesis	9	9	.	.	.	Note=Strongly increased stability following UV irradiation%3B when associated with A-8. D->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23913683;Dbxref=PMID:23913683	
Q9HCU8	UniProtKB	Mutagenesis	10	11	.	.	.	Note=Complete loss of PCNA binding%3B when associated with A-7. SY->AA;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16510448;Dbxref=PMID:16510448	
Q9HCU8	UniProtKB	Mutagenesis	10	10	.	.	.	Note=No effect on PCNA binding%2C nor on degradation after UV irradiation%3B when associated with Q-4. No effect on PCNA binding%2C but normal degradation after UV irradiation with Q-4 and A-15. S->Y;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24022480;Dbxref=PMID:24022480	
Q9HCU8	UniProtKB	Mutagenesis	15	15	.	.	.	Note=Decreased PCNA binding. No effect on PCNA binding%2C but normal degradation after UV irradiation%3B when associated with Q-4 and Y-10. Increased stability following UV irradiation and no trough during S phase%3B when associated with A-16 and A-17. K->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269|PubMed:23913683,ECO:0000269|PubMed:24022480;Dbxref=PMID:23913683,PMID:24022480	
Q9HCU8	UniProtKB	Mutagenesis	15	15	.	.	.	Note=No effect on ubiquitination. Loss of ubiquitination%3B when associated with R-4%2C R-25%2C R-74 and R-89. K->R;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16934752;Dbxref=PMID:16934752	
Q9HCU8	UniProtKB	Mutagenesis	16	16	.	.	.	Note=Increased stability following UV irradiation and no trough during S phase%3B when associated with A-15 and A-17. R->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23913683;Dbxref=PMID:23913683	
Q9HCU8	UniProtKB	Mutagenesis	17	17	.	.	.	Note=Increased stability following UV irradiation and no trough during S phase%3B when associated with A-15 and A-16. R->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23913683;Dbxref=PMID:23913683	
Q9HCU8	UniProtKB	Mutagenesis	25	25	.	.	.	Note=No effect on ubiquitination. Loss of ubiquitination%3B when associated with R-4%2C R-15%2C R-74 and R-89. K->R;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16934752;Dbxref=PMID:16934752	
Q9HCU8	UniProtKB	Mutagenesis	74	74	.	.	.	Note=No effect on ubiquitination. Loss of ubiquitination%3B when associated with R-4%2C R-15%2C R-25 and R-89. K->R;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16934752;Dbxref=PMID:16934752	
Q9HCU8	UniProtKB	Mutagenesis	89	89	.	.	.	Note=No effect on ubiquitination. Loss of ubiquitination%3B when associated with R-4%2C R-15%2C R-25 and R-74. K->R;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16934752;Dbxref=PMID:16934752	
Q9HCU8	UniProtKB	Helix	7	9	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6HVO	
Q9HCU8	UniProtKB	Beta strand	13	15	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6HVO	
Q9HCU8	UniProtKB	Helix	45	52	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6TNY	
Q9HCU8	UniProtKB	Beta strand	62	64	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6TNY	
Q9HCU8	UniProtKB	Helix	66	76	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6TNY	
Q9HCU8	UniProtKB	Beta strand	88	91	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6TNY	
Q9HCU8	UniProtKB	Turn	95	97	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6TNY	
Q9HCU8	UniProtKB	Beta strand	103	105	.	.	.	Ontology_term=ECO:0007829;evidence=ECO:0007829|PDB:6TNY