Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9HCU8 (DPOD4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
DNA polymerase delta subunit 4
Alternative name(s):
DNA polymerase delta subunit p12
Gene names
Name:POLD4
Synonyms:POLDS
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length107 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for optimal DNA polymerase delta activity. May contribute to PCNA-dependent activity of DNA polymerase delta. Ref.6

Subunit structure

Heterotetramer composed of subunits of 125 kDa, 50 kDa, 66 kDa and 12 kDa. Interacts with WRNIP1. Interacts with POLD4, POLD2, POLD1 and PCNA. Ref.5 Ref.6

Subcellular location

Nucleus.

Sequence similarities

Belongs to the DNA polymerase delta subunit 4 family.

Ontologies

Keywords
   Biological processDNA replication
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   Molecular functionDNA-directed DNA polymerase
Nucleotidyltransferase
Transferase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processDNA repair

Traceable author statement. Source: Reactome

DNA replication

Traceable author statement Ref.1. Source: ProtInc

DNA strand elongation involved in DNA replication

Traceable author statement. Source: Reactome

base-excision repair

Traceable author statement. Source: Reactome

mitotic cell cycle

Traceable author statement. Source: Reactome

nucleotide-excision repair

Traceable author statement. Source: Reactome

nucleotide-excision repair, DNA gap filling

Traceable author statement. Source: Reactome

positive regulation of endothelial cell proliferation

Inferred from electronic annotation. Source: Ensembl

telomere maintenance

Traceable author statement. Source: Reactome

telomere maintenance via recombination

Traceable author statement. Source: Reactome

telomere maintenance via semi-conservative replication

Traceable author statement. Source: Reactome

transcription-coupled nucleotide-excision repair

Traceable author statement. Source: Reactome

   Cellular_componentnucleoplasm

Traceable author statement. Source: Reactome

nucleus

Traceable author statement Ref.1. Source: ProtInc

   Molecular_functionDNA-directed DNA polymerase activity

Traceable author statement Ref.1. Source: ProtInc

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9HCU8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9HCU8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     63-107: GITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL → VSGISIPYEAPRKTSCP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 107107DNA polymerase delta subunit 4
PRO_0000186051

Natural variations

Alternative sequence63 – 10745GITRL…HLYPL → VSGISIPYEAPRKTSCP in isoform 2.
VSP_046864
Natural variant391R → P. Ref.2
Corresponds to variant rs28364240 [ dbSNP | Ensembl ].
VAR_022269
Natural variant591G → R.
Corresponds to variant rs34136263 [ dbSNP | Ensembl ].
VAR_057526

Experimental info

Mutagenesis71I → A: Abolishes interaction with PCNA; when associated with 10-AA-11. Ref.6
Mutagenesis10 – 112SY → A: Abolishes interaction with PCNA; when associated with A-7.

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: 6F412738E4D9A19C

FASTA10712,433
        10         20         30         40         50         60 
MGRKRLITDS YPVVKRREGP AGHSKGELAP ELGEEPQPRD EEEAELELLR QFDLAWQYGP 

        70         80         90        100 
CTGITRLQRW CRAKQMGLEP PPEVWQVLKT HPGDPRFQCS LWHLYPL 

« Hide

Isoform 2 [UniParc].

Checksum: C8CD845791BE8759
Show »

FASTA798,868

References

« Hide 'large scale' references
[1]"Identification of a fourth subunit of mammalian DNA polymerase delta."
Liu L., Mo J.-Y., Rodriguez-Belmonte E.M., Lee M.Y.W.T.
J. Biol. Chem. 275:18739-18744(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Ovarian carcinoma.
[2]NIEHS SNPs program
Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT PRO-39.
[3]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Urinary bladder.
[5]"Human Werner helicase interacting protein 1 (WRNIP1) functions as a novel modulator for DNA polymerase delta."
Tsurimoto T., Shinozaki A., Yano M., Seki M., Enomoto T.
Genes Cells 10:13-22(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH WRNIP1.
[6]"Functional roles of p12, the fourth subunit of human DNA polymerase delta."
Li H., Xie B., Zhou Y., Rahmeh A., Trusa S., Zhang S., Gao Y., Lee E.Y., Lee M.Y.
J. Biol. Chem. 281:14748-14755(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH POLD2; POLD1 AND PCNA, MUTAGENESIS OF ILE-7 AND 10-SER-TYR-11.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF179890 mRNA. Translation: AAG08966.1.
AY928482 Genomic DNA. Translation: AAX09676.1.
AP003419 Genomic DNA. No translation available.
BG403692 mRNA. No translation available.
RefSeqNP_001243799.1. NM_001256870.1.
NP_066996.3. NM_021173.4.
UniGeneHs.523829.

3D structure databases

ProteinModelPortalQ9HCU8.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121774. 7 interactions.
IntActQ9HCU8. 7 interactions.
STRING9606.ENSP00000311368.

PTM databases

PhosphoSiteQ9HCU8.

Proteomic databases

PaxDbQ9HCU8.
PRIDEQ9HCU8.

Protocols and materials databases

DNASU57804.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000312419; ENSP00000311368; ENSG00000175482. [Q9HCU8-1]
ENST00000539074; ENSP00000444780; ENSG00000175482. [Q9HCU8-2]
GeneID57804.
KEGGhsa:57804.
UCSCuc001okm.4. human. [Q9HCU8-1]

Organism-specific databases

CTD57804.
GeneCardsGC11M067119.
HGNCHGNC:14106. POLD4.
MIM611525. gene.
neXtProtNX_Q9HCU8.
PharmGKBPA33498.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG70894.
HOGENOMHOG000031022.
HOVERGENHBG057838.
InParanoidQ9HCU8.
KOK03505.
OMAQTHPGDP.
PhylomeDBQ9HCU8.
TreeFamTF103004.

Enzyme and pathway databases

ReactomeREACT_115566. Cell Cycle.
REACT_216. DNA Repair.
REACT_383. DNA Replication.

Gene expression databases

BgeeQ9HCU8.
CleanExHS_POLD4.
GenevestigatorQ9HCU8.

Family and domain databases

InterProIPR007218. DNA_pol_delta_4.
[Graphical view]
PfamPF04081. DNA_pol_delta_4. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiPOLD4.
GenomeRNAi57804.
NextBio64752.
PROQ9HCU8.
SOURCESearch...

Entry information

Entry nameDPOD4_HUMAN
AccessionPrimary (citable) accession number: Q9HCU8
Secondary accession number(s): F5H506
Entry history
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: March 1, 2001
Last modified: April 16, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM