Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HCU8

- DPOD4_HUMAN

UniProt

Q9HCU8 - DPOD4_HUMAN

Protein

DNA polymerase delta subunit 4

Gene

POLD4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Required for optimal DNA polymerase delta activity. May contribute to PCNA-dependent activity of DNA polymerase delta.1 Publication

    GO - Molecular functioni

    1. DNA-directed DNA polymerase activity Source: ProtInc
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. base-excision repair Source: Reactome
    2. DNA repair Source: Reactome
    3. DNA replication Source: ProtInc
    4. DNA strand elongation involved in DNA replication Source: Reactome
    5. mitotic cell cycle Source: Reactome
    6. nucleotide-excision repair Source: Reactome
    7. nucleotide-excision repair, DNA gap filling Source: Reactome
    8. positive regulation of endothelial cell proliferation Source: Ensembl
    9. telomere maintenance Source: Reactome
    10. telomere maintenance via recombination Source: Reactome
    11. telomere maintenance via semi-conservative replication Source: Reactome
    12. transcription-coupled nucleotide-excision repair Source: Reactome

    Keywords - Molecular functioni

    DNA-directed DNA polymerase, Nucleotidyltransferase, Transferase

    Keywords - Biological processi

    DNA replication

    Enzyme and pathway databases

    ReactomeiREACT_1128. Resolution of AP sites via the multiple-nucleotide patch replacement pathway.
    REACT_1385. Processive synthesis on the lagging strand.
    REACT_1792. Polymerase switching.
    REACT_1838. Leading Strand Synthesis.
    REACT_1993. Repair synthesis for gap-filling by DNA polymerase in TC-NER.
    REACT_2192. Removal of DNA patch containing abasic residue.
    REACT_378. Repair synthesis of patch ~27-30 bases long by DNA polymerase.
    REACT_70. Removal of the Flap Intermediate.
    REACT_7961. Telomere C-strand (Lagging Strand) Synthesis.
    REACT_7987. Polymerase switching on the C-strand of the telomere.
    REACT_7999. Removal of the Flap Intermediate from the C-strand.
    REACT_8027. Processive synthesis on the C-strand of the telomere.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DNA polymerase delta subunit 4
    Alternative name(s):
    DNA polymerase delta subunit p12
    Gene namesi
    Name:POLD4
    Synonyms:POLDS
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:14106. POLD4.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleoplasm Source: Reactome
    2. nucleus Source: ProtInc

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi7 – 71I → A: Abolishes interaction with PCNA; when associated with 10-AA-11. 1 Publication
    Mutagenesisi10 – 112SY → A: Abolishes interaction with PCNA; when associated with A-7.

    Organism-specific databases

    PharmGKBiPA33498.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 107107DNA polymerase delta subunit 4PRO_0000186051Add
    BLAST

    Proteomic databases

    MaxQBiQ9HCU8.
    PaxDbiQ9HCU8.
    PRIDEiQ9HCU8.

    PTM databases

    PhosphoSiteiQ9HCU8.

    Expressioni

    Gene expression databases

    BgeeiQ9HCU8.
    CleanExiHS_POLD4.
    GenevestigatoriQ9HCU8.

    Interactioni

    Subunit structurei

    Heterotetramer composed of subunits of 125 kDa, 50 kDa, 66 kDa and 12 kDa. Interacts with WRNIP1. Interacts with POLD4, POLD2, POLD1 and PCNA.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PCNAP120044EBI-864968,EBI-358311
    POLD1P2834010EBI-864968,EBI-716569
    POLD2P490053EBI-864968,EBI-372354
    WRNIP1Q96S552EBI-864968,EBI-2513471

    Protein-protein interaction databases

    BioGridi121774. 7 interactions.
    IntActiQ9HCU8. 7 interactions.
    STRINGi9606.ENSP00000311368.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9HCU8.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG70894.
    HOGENOMiHOG000031022.
    HOVERGENiHBG057838.
    InParanoidiQ9HCU8.
    KOiK03505.
    OMAiQTHPGDP.
    PhylomeDBiQ9HCU8.
    TreeFamiTF103004.

    Family and domain databases

    InterProiIPR007218. DNA_pol_delta_4.
    [Graphical view]
    PfamiPF04081. DNA_pol_delta_4. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HCU8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGRKRLITDS YPVVKRREGP AGHSKGELAP ELGEEPQPRD EEEAELELLR    50
    QFDLAWQYGP CTGITRLQRW CRAKQMGLEP PPEVWQVLKT HPGDPRFQCS 100
    LWHLYPL 107
    Length:107
    Mass (Da):12,433
    Last modified:March 1, 2001 - v1
    Checksum:i6F412738E4D9A19C
    GO
    Isoform 2 (identifier: Q9HCU8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-107: GITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL → VSGISIPYEAPRKTSCP

    Note: No experimental confirmation available.

    Show »
    Length:79
    Mass (Da):8,868
    Checksum:iC8CD845791BE8759
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti39 – 391R → P.1 Publication
    Corresponds to variant rs28364240 [ dbSNP | Ensembl ].
    VAR_022269
    Natural varianti59 – 591G → R.
    Corresponds to variant rs34136263 [ dbSNP | Ensembl ].
    VAR_057526

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei63 – 10745GITRL…HLYPL → VSGISIPYEAPRKTSCP in isoform 2. 1 PublicationVSP_046864Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF179890 mRNA. Translation: AAG08966.1.
    AY928482 Genomic DNA. Translation: AAX09676.1.
    AP003419 Genomic DNA. No translation available.
    BG403692 mRNA. No translation available.
    CCDSiCCDS58149.1. [Q9HCU8-2]
    CCDS8158.1. [Q9HCU8-1]
    RefSeqiNP_001243799.1. NM_001256870.1. [Q9HCU8-2]
    NP_066996.3. NM_021173.4. [Q9HCU8-1]
    UniGeneiHs.523829.

    Genome annotation databases

    EnsembliENST00000312419; ENSP00000311368; ENSG00000175482. [Q9HCU8-1]
    ENST00000539074; ENSP00000444780; ENSG00000175482. [Q9HCU8-2]
    GeneIDi57804.
    KEGGihsa:57804.
    UCSCiuc001okm.4. human. [Q9HCU8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF179890 mRNA. Translation: AAG08966.1 .
    AY928482 Genomic DNA. Translation: AAX09676.1 .
    AP003419 Genomic DNA. No translation available.
    BG403692 mRNA. No translation available.
    CCDSi CCDS58149.1. [Q9HCU8-2 ]
    CCDS8158.1. [Q9HCU8-1 ]
    RefSeqi NP_001243799.1. NM_001256870.1. [Q9HCU8-2 ]
    NP_066996.3. NM_021173.4. [Q9HCU8-1 ]
    UniGenei Hs.523829.

    3D structure databases

    ProteinModelPortali Q9HCU8.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121774. 7 interactions.
    IntActi Q9HCU8. 7 interactions.
    STRINGi 9606.ENSP00000311368.

    PTM databases

    PhosphoSitei Q9HCU8.

    Proteomic databases

    MaxQBi Q9HCU8.
    PaxDbi Q9HCU8.
    PRIDEi Q9HCU8.

    Protocols and materials databases

    DNASUi 57804.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000312419 ; ENSP00000311368 ; ENSG00000175482 . [Q9HCU8-1 ]
    ENST00000539074 ; ENSP00000444780 ; ENSG00000175482 . [Q9HCU8-2 ]
    GeneIDi 57804.
    KEGGi hsa:57804.
    UCSCi uc001okm.4. human. [Q9HCU8-1 ]

    Organism-specific databases

    CTDi 57804.
    GeneCardsi GC11M067119.
    HGNCi HGNC:14106. POLD4.
    MIMi 611525. gene.
    neXtProti NX_Q9HCU8.
    PharmGKBi PA33498.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG70894.
    HOGENOMi HOG000031022.
    HOVERGENi HBG057838.
    InParanoidi Q9HCU8.
    KOi K03505.
    OMAi QTHPGDP.
    PhylomeDBi Q9HCU8.
    TreeFami TF103004.

    Enzyme and pathway databases

    Reactomei REACT_1128. Resolution of AP sites via the multiple-nucleotide patch replacement pathway.
    REACT_1385. Processive synthesis on the lagging strand.
    REACT_1792. Polymerase switching.
    REACT_1838. Leading Strand Synthesis.
    REACT_1993. Repair synthesis for gap-filling by DNA polymerase in TC-NER.
    REACT_2192. Removal of DNA patch containing abasic residue.
    REACT_378. Repair synthesis of patch ~27-30 bases long by DNA polymerase.
    REACT_70. Removal of the Flap Intermediate.
    REACT_7961. Telomere C-strand (Lagging Strand) Synthesis.
    REACT_7987. Polymerase switching on the C-strand of the telomere.
    REACT_7999. Removal of the Flap Intermediate from the C-strand.
    REACT_8027. Processive synthesis on the C-strand of the telomere.

    Miscellaneous databases

    GeneWikii POLD4.
    GenomeRNAii 57804.
    NextBioi 64752.
    PROi Q9HCU8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9HCU8.
    CleanExi HS_POLD4.
    Genevestigatori Q9HCU8.

    Family and domain databases

    InterProi IPR007218. DNA_pol_delta_4.
    [Graphical view ]
    Pfami PF04081. DNA_pol_delta_4. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a fourth subunit of mammalian DNA polymerase delta."
      Liu L., Mo J.-Y., Rodriguez-Belmonte E.M., Lee M.Y.W.T.
      J. Biol. Chem. 275:18739-18744(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Ovarian carcinoma.
    2. NIEHS SNPs program
      Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT PRO-39.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Urinary bladder.
    5. "Human Werner helicase interacting protein 1 (WRNIP1) functions as a novel modulator for DNA polymerase delta."
      Tsurimoto T., Shinozaki A., Yano M., Seki M., Enomoto T.
      Genes Cells 10:13-22(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH WRNIP1.
    6. "Functional roles of p12, the fourth subunit of human DNA polymerase delta."
      Li H., Xie B., Zhou Y., Rahmeh A., Trusa S., Zhang S., Gao Y., Lee E.Y., Lee M.Y.
      J. Biol. Chem. 281:14748-14755(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH POLD2; POLD1 AND PCNA, MUTAGENESIS OF ILE-7 AND 10-SER-TYR-11.

    Entry informationi

    Entry nameiDPOD4_HUMAN
    AccessioniPrimary (citable) accession number: Q9HCU8
    Secondary accession number(s): F5H506
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 108 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3