Q9HCM2 (PLXA4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Plexin-A4 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1894 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm By similarity. |
| Subunit structure | Interacts with NRP1 and NRP2 By similarity. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Potential. |
| Sequence similarities | Belongs to the plexin family. Contains 4 IPT/TIG domains. Contains 3 PSI domains. Contains 1 Sema domain. |
| Sequence caution | The sequence AAQ89209.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HCM2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HCM2-2) The sequence of this isoform differs from the canonical sequence as follows: 458-492: IRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHE → MPGTSLCPTLELQTGPRSHRATVTLELLFSSCSSN 493-1894: Missing. | ||||||
| Isoform 3 (identifier: Q9HCM2-3) The sequence of this isoform differs from the canonical sequence as follows: 458-522: IRVDGPRGNA...YQSCGECLGS → SFGTGPQGGI...CFLNVPGNSS 523-1894: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9HCM2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1550: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||||||||||||||||||||||
| Chain | 24 – 1894 | 1871 | Plexin-A4 | PRO_0000240283 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Topological domain | 24 – 1237 | 1214 | Extracellular Potential | ||||||||||||||||||||||||||
| Transmembrane | 1238 – 1258 | 21 | Helical; Potential | ||||||||||||||||||||||||||
| Topological domain | 1259 – 1894 | 636 | Cytoplasmic Potential | ||||||||||||||||||||||||||
| Domain | 24 – 507 | 484 | Sema | ||||||||||||||||||||||||||
| Domain | 509 – 559 | 51 | PSI 1 | ||||||||||||||||||||||||||
| Domain | 655 – 702 | 48 | PSI 2 | ||||||||||||||||||||||||||
| Domain | 803 – 856 | 54 | PSI 3 | ||||||||||||||||||||||||||
| Domain | 858 – 952 | 95 | IPT/TIG 1 | ||||||||||||||||||||||||||
| Domain | 954 – 1037 | 84 | IPT/TIG 2 | ||||||||||||||||||||||||||
| Domain | 1040 – 1139 | 100 | IPT/TIG 3 | ||||||||||||||||||||||||||
| Domain | 1142 – 1230 | 89 | IPT/TIG 4 | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 1350 | 1 | N6-acetyllysine Ref.8 | ||||||||||||||||||||||||||
| Glycosylation | 655 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||
| Glycosylation | 1007 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||
| Glycosylation | 1132 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||
| Glycosylation | 1180 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||
| Disulfide bond | 95 ↔ 104 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 130 ↔ 138 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 284 ↔ 405 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 300 ↔ 356 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 374 ↔ 393 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 510 ↔ 527 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 516 ↔ 558 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 519 ↔ 536 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 530 ↔ 542 | By similarity | |||||||||||||||||||||||||||
| Disulfide bond | 593 ↔ 612 | By similarity | |||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 1 – 1550 | 1550 | Missing in isoform 4. | VSP_019334 | |||||||||||||||||||||||||
| Alternative sequence | 458 – 522 | 65 | IRVDG…ECLGS → SFGTGPQGGITQEWIGVAGD PPGANIASQEQMLCVYLQCS SHKAISDQRVQPLLCCFLNV PGNSS in isoform 3. | VSP_019330 | |||||||||||||||||||||||||
| Alternative sequence | 458 – 492 | 35 | IRVDG…SKDHE → MPGTSLCPTLELQTGPRSHR ATVTLELLFSSCSSN in isoform 2. | VSP_019331 | |||||||||||||||||||||||||
| Alternative sequence | 493 – 1894 | 1402 | Missing in isoform 2. | VSP_019332 | |||||||||||||||||||||||||
| Alternative sequence | 523 – 1894 | 1372 | Missing in isoform 3. | VSP_019333 | |||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||
| Sequence conflict | 1750 | 1 | N → D in CAD39161. Ref.5 | ||||||||||||||||||||||||||
| Sequence conflict | 1804 | 1 | I → V in CAD39161. Ref.5 | ||||||||||||||||||||||||||
| Isoform 2: | |||||||||||||||||||||||||||||
| Sequence conflict | 458 | 1 | M → V in BAC85615. Ref.1 | ||||||||||||||||||||||||||
| Sequence conflict | 458 | 1 | M → V in AAQ89209. Ref.4 | ||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Beta strand | 1499 – 1504 | 6 | |||||||||||||||||||||||||||
| Beta strand | 1515 – 1520 | 6 | |||||||||||||||||||||||||||
| Helix | 1525 – 1536 | 12 | |||||||||||||||||||||||||||
| Turn | 1537 – 1539 | 3 | |||||||||||||||||||||||||||
| Helix | 1542 – 1544 | 3 | |||||||||||||||||||||||||||
| Helix | 1548 – 1550 | 3 | |||||||||||||||||||||||||||
| Beta strand | 1551 – 1556 | 6 | |||||||||||||||||||||||||||
| Beta strand | 1562 – 1565 | 4 | |||||||||||||||||||||||||||
| Beta strand | 1567 – 1569 | 3 | |||||||||||||||||||||||||||
| Helix | 1584 – 1587 | 4 | |||||||||||||||||||||||||||
| Beta strand | 1594 – 1599 | 6 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Brain and Hippocampus. |
| [2] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-1894 (ISOFORM 2). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 206-1894 (ISOFORM 3), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Kidney and Testis. |
| [6] | "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 433-1894 (ISOFORM 1). Tissue: Brain. |
| [7] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [8] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1350, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK095606 mRNA. Translation: BAC04587.1. AK123428 mRNA. Translation: BAC85615.1. AC009364 Genomic DNA. No translation available. AC009365 Genomic DNA. No translation available. AC009785 Genomic DNA. No translation available. AC011625 Genomic DNA. No translation available. AC018643 Genomic DNA. No translation available. AC026239 Genomic DNA. No translation available. BC028744 mRNA. Translation: AAH28744.1. AY358850 mRNA. Translation: AAQ89209.1. Different initiation. AL137352 mRNA. Translation: CAB70707.1. AL834504 mRNA. Translation: CAD39161.3. AB046770 mRNA. Translation: BAB13376.3. | ||||||||||||
| IPI | IPI00165931. IPI00446588. IPI00748846. IPI00759587. | ||||||||||||
| PIR | T46426. | ||||||||||||
| RefSeq | NP_001099013.1. NM_001105543.1. NP_065962.1. NM_020911.1. NP_861440.2. NM_181775.3. | ||||||||||||
| UniGene | Hs.511454. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9HCM2. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000323194. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9HCM2. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 108860890. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9HCM2. | ||||||||||||
| PRIDE | Q9HCM2. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 91584. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000321063; ENSP00000323194; ENSG00000221866. ENST00000359827; ENSP00000352882; ENSG00000221866. ENST00000423507; ENSP00000392772; ENSG00000221866. | ||||||||||||
| GeneID | 91584. | ||||||||||||
| KEGG | hsa:91584. | ||||||||||||
| UCSC | uc003vqz.4. human. uc003vra.4. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 91584. | ||||||||||||
| GeneCards | GC07M131720. | ||||||||||||
| H-InvDB | HIX0007090. | ||||||||||||
| HGNC | HGNC:9102. PLXNA4. | ||||||||||||
| HPA | HPA029919. | ||||||||||||
| MIM | 604280. gene. | ||||||||||||
| neXtProt | NX_Q9HCM2. | ||||||||||||
| PharmGKB | PA162399757. PA33428. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG254546. | ||||||||||||
| HOVERGEN | HBG105711. | ||||||||||||
| InParanoid | Q9HCM2. | ||||||||||||
| OMA | LEWRQGS. | ||||||||||||
| OrthoDB | EOG4N30N0. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9HCM2. | ||||||||||||
| Bgee | Q9HCM2. | ||||||||||||
| CleanEx | HS_PLXNA4. | ||||||||||||
| Genevestigator | Q9HCM2. | ||||||||||||
| GermOnline | ENSG00000189437. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.130.10.10. 1 hit. 2.60.40.10. 4 hits. | ||||||||||||
| InterPro | IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR003659. Plexin-like. IPR016201. Plexin-like_fold. IPR013548. Plexin_cytoplasmic_RasGAP_dom. IPR002165. Plexin_repeat. IPR008936. Rho_GTPase_activation_prot. IPR001627. Semaphorin/CD100_Ag. IPR015943. WD40/YVTN_repeat-like_dom. [Graphical view] | ||||||||||||
| Pfam | PF08337. Plexin_cytopl. 1 hit. PF01437. PSI. 3 hits. PF01403. Sema. 1 hit. PF01833. TIG. 4 hits. [Graphical view] | ||||||||||||
| SMART | SM00429. IPT. 4 hits. SM00423. PSI. 3 hits. SM00630. Sema. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF81296. Ig_E-set. 4 hits. SSF103575. Plexin-like_fold. 2 hits. SSF48350. Rho_GAP. 1 hit. SSF101912. Sema. 1 hit. | ||||||||||||
| PROSITE | PS51004. SEMA. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | PLXNA4. human. | ||||||||||||
| GenomeRNAi | 91584. | ||||||||||||
| NextBio | 77311. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PLXA4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HCM2 Secondary accession number(s): E9PAM2 Q9NTD4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
