Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HCM2

- PLXA4_HUMAN

UniProt

Q9HCM2 - PLXA4_HUMAN

Protein

Plexin-A4

Gene

PLXNA4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 4 (13 Jun 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm By similarity.By similarity

    GO - Molecular functioni

    1. semaphorin receptor activity Source: Ensembl

    GO - Biological processi

    1. anterior commissure morphogenesis Source: Ensembl
    2. axon guidance Source: Reactome
    3. chemorepulsion of branchiomotor axon Source: Ensembl
    4. facial nerve morphogenesis Source: Ensembl
    5. glossopharyngeal nerve morphogenesis Source: Ensembl
    6. postganglionic parasympathetic nervous system development Source: Ensembl
    7. regulation of axon extension involved in axon guidance Source: Ensembl
    8. regulation of negative chemotaxis Source: Ensembl
    9. semaphorin-plexin signaling pathway Source: BHF-UCL
    10. sympathetic nervous system development Source: Ensembl
    11. trigeminal nerve morphogenesis Source: Ensembl
    12. vagus nerve morphogenesis Source: Ensembl

    Keywords - Molecular functioni

    Receptor

    Enzyme and pathway databases

    ReactomeiREACT_19199. CRMPs in Sema3A signaling.
    REACT_19200. Other semaphorin interactions.
    REACT_19236. Sema3A PAK dependent Axon repulsion.
    REACT_19279. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Plexin-A4
    Gene namesi
    Name:PLXNA4
    Synonyms:KIAA1550, PLXNA4A, PLXNA4B
    ORF Names:UNQ2820/PRO34003
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:9102. PLXNA4.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. intracellular Source: InterPro
    3. plasma membrane Source: Reactome
    4. semaphorin receptor complex Source: BHF-UCL

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162399757.
    PA33428.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2323Sequence AnalysisAdd
    BLAST
    Chaini24 – 18941871Plexin-A4PRO_0000240283Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi95 ↔ 104PROSITE-ProRule annotation
    Disulfide bondi130 ↔ 138PROSITE-ProRule annotation
    Disulfide bondi284 ↔ 405PROSITE-ProRule annotation
    Disulfide bondi300 ↔ 356PROSITE-ProRule annotation
    Disulfide bondi374 ↔ 393PROSITE-ProRule annotation
    Disulfide bondi510 ↔ 527PROSITE-ProRule annotation
    Disulfide bondi516 ↔ 558PROSITE-ProRule annotation
    Disulfide bondi519 ↔ 536PROSITE-ProRule annotation
    Disulfide bondi530 ↔ 542PROSITE-ProRule annotation
    Disulfide bondi593 ↔ 612PROSITE-ProRule annotation
    Glycosylationi655 – 6551N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1007 – 10071N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1132 – 11321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1180 – 11801N-linked (GlcNAc...)Sequence Analysis
    Modified residuei1350 – 13501N6-acetyllysine1 Publication

    Keywords - PTMi

    Acetylation, Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ9HCM2.
    PaxDbiQ9HCM2.
    PRIDEiQ9HCM2.

    PTM databases

    PhosphoSiteiQ9HCM2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9HCM2.
    BgeeiQ9HCM2.
    CleanExiHS_PLXNA4.
    GenevestigatoriQ9HCM2.

    Organism-specific databases

    HPAiHPA029919.

    Interactioni

    Subunit structurei

    Interacts with NRP1 and NRP2.By similarity

    Protein-protein interaction databases

    STRINGi9606.ENSP00000323194.

    Structurei

    Secondary structure

    1
    1894
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi1499 – 15046
    Beta strandi1515 – 15206
    Helixi1525 – 153612
    Turni1537 – 15393
    Helixi1542 – 15443
    Helixi1548 – 15503
    Beta strandi1551 – 15566
    Beta strandi1562 – 15654
    Beta strandi1567 – 15693
    Helixi1584 – 15874
    Beta strandi1594 – 15996

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4E74X-ray1.58A1488-1603[»]
    ProteinModelPortaliQ9HCM2.
    SMRiQ9HCM2. Positions 40-657, 735-1039, 1273-1890.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini24 – 12371214ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1259 – 1894636CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1238 – 125821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini24 – 507484SemaPROSITE-ProRule annotationAdd
    BLAST
    Domaini509 – 55951PSI 1Add
    BLAST
    Domaini655 – 70248PSI 2Add
    BLAST
    Domaini803 – 85654PSI 3Add
    BLAST
    Domaini858 – 95295IPT/TIG 1Add
    BLAST
    Domaini954 – 103784IPT/TIG 2Add
    BLAST
    Domaini1040 – 1139100IPT/TIG 3Add
    BLAST
    Domaini1142 – 123089IPT/TIG 4Add
    BLAST

    Sequence similaritiesi

    Belongs to the plexin family.Curated
    Contains 4 IPT/TIG domains.Curated
    Contains 3 PSI domains.Curated
    Contains 1 Sema domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG254546.
    HOGENOMiHOG000252970.
    HOVERGENiHBG105711.
    InParanoidiQ9HCM2.
    OMAiEQMLCVY.
    OrthoDBiEOG7Q8CM9.
    PhylomeDBiQ9HCM2.
    TreeFamiTF312962.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    2.60.40.10. 4 hits.
    InterProiIPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR016201. Plexin-like_fold.
    IPR013548. Plexin_cytoplasmic_RasGAP_dom.
    IPR002165. Plexin_repeat.
    IPR008936. Rho_GTPase_activation_prot.
    IPR001627. Semap_dom.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view]
    PfamiPF08337. Plexin_cytopl. 1 hit.
    PF01437. PSI. 3 hits.
    PF01403. Sema. 1 hit.
    PF01833. TIG. 4 hits.
    [Graphical view]
    SMARTiSM00429. IPT. 4 hits.
    SM00423. PSI. 3 hits.
    SM00630. Sema. 1 hit.
    [Graphical view]
    SUPFAMiSSF101912. SSF101912. 1 hit.
    SSF103575. SSF103575. 2 hits.
    SSF48350. SSF48350. 2 hits.
    SSF81296. SSF81296. 4 hits.
    PROSITEiPS51004. SEMA. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HCM2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKAMPWNWTC LLSHLLMVGM GSSTLLTRQP APLSQKQRSF VTFRGEPAEG     50
    FNHLVVDERT GHIYLGAVNR IYKLSSDLKV LVTHETGPDE DNPKCYPPRI 100
    VQTCNEPLTT TNNVNKMLLI DYKENRLIAC GSLYQGICKL LRLEDLFKLG 150
    EPYHKKEHYL SGVNESGSVF GVIVSYSNLD DKLFIATAVD GKPEYFPTIS 200
    SRKLTKNSEA DGMFAYVFHD EFVASMIKIP SDTFTIIPDF DIYYVYGFSS 250
    GNFVYFLTLQ PEMVSPPGST TKEQVYTSKL VRLCKEDTAF NSYVEVPIGC 300
    ERSGVEYRLL QAAYLSKAGA VLGRTLGVHP DDDLLFTVFS KGQKRKMKSL 350
    DESALCIFIL KQINDRIKER LQSCYRGEGT LDLAWLKVKD IPCSSALLTI 400
    DDNFCGLDMN APLGVSDMVR GIPVFTEDRD RMTSVIAYVY KNHSLAFVGT 450
    KSGKLKKIRV DGPRGNALQY ETVQVVDPGP VLRDMAFSKD HEQLYIMSER 500
    QLTRVPVESC GQYQSCGECL GSGDPHCGWC VLHNTCTRKE RCERSKEPRR 550
    FASEMKQCVR LTVHPNNISV SQYNVLLVLE TYNVPELSAG VNCTFEDLSE 600
    MDGLVVGNQI QCYSPAAKEV PRIITENGDH HVVQLQLKSK ETGMTFASTS 650
    FVFYNCSVHN SCLSCVESPY RCHWCKYRHV CTHDPKTCSF QEGRVKLPED 700
    CPQLLRVDKI LVPVEVIKPI TLKAKNLPQP QSGQRGYECI LNIQGSEQRV 750
    PALRFNSSSV QCQNTSYSYE GMEINNLPVE LTVVWNGHFN IDNPAQNKVH 800
    LYKCGAMRES CGLCLKADPD FACGWCQGPG QCTLRQHCPA QESQWLELSG 850
    AKSKCTNPRI TEIIPVTGPR EGGTKVTIRG ENLGLEFRDI ASHVKVAGVE 900
    CSPLVDGYIP AEQIVCEMGE AKPSQHAGFV EICVAVCRPE FMARSSQLYY 950
    FMTLTLSDLK PSRGPMSGGT QVTITGTNLN AGSNVVVMFG KQPCLFHRRS 1000
    PSYIVCNTTS SDEVLEMKVS VQVDRAKIHQ DLVFQYVEDP TIVRIEPEWS 1050
    IVSGNTPIAV WGTHLDLIQN PQIRAKHGGK EHINICEVLN ATEMTCQAPA 1100
    LALGPDHQSD LTERPEEFGF ILDNVQSLLI LNKTNFTYYP NPVFEAFGPS 1150
    GILELKPGTP IILKGKNLIP PVAGGNVKLN YTVLVGEKPC TVTVSDVQLL 1200
    CESPNLIGRH KVMARVGGME YSPGMVYIAP DSPLSLPAIV SIAVAGGLLI 1250
    IFIVAVLIAY KRKSRESDLT LKRLQMQMDN LESRVALECK EAFAELQTDI 1300
    HELTSDLDGA GIPFLDYRTY TMRVLFPGIE DHPVLRDLEV PGYRQERVEK 1350
    GLKLFAQLIN NKVFLLSFIR TLESQRSFSM RDRGNVASLI MTVLQSKLEY 1400
    ATDVLKQLLA DLIDKNLESK NHPKLLLRRT ESVAEKMLTN WFTFLLYKFL 1450
    KECAGEPLFS LFCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIDYKTL 1500
    VLSCVSPDNA NSPEVPVKIL NCDTITQVKE KILDAIFKNV PCSHRPKAAD 1550
    MDLEWRQGSG ARMILQDEDI TTKIENDWKR LNTLAHYQVP DGSVVALVSK 1600
    QVTAYNAVNN STVSRTSASK YENMIRYTGS PDSLRSRTPM ITPDLESGVK 1650
    MWHLVKNHEH GDQKEGDRGS KMVSEIYLTR LLATKGTLQK FVDDLFETIF 1700
    STAHRGSALP LAIKYMFDFL DEQADKHGIH DPHVRHTWKS NCLPLRFWVN 1750
    MIKNPQFVFD IHKNSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY 1800
    AKDIPSYKNW VERYYSDIGK MPAISDQDMN AYLAEQSRMH MNEFNTMSAL 1850
    SEIFSYVGKY SEEILGPLDH DDQCGKQKLA YKLEQVITLM SLDS 1894
    Length:1,894
    Mass (Da):212,455
    Last modified:June 13, 2006 - v4
    Checksum:i7B45C8929C5847DF
    GO
    Isoform 2 (identifier: Q9HCM2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         458-492: IRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHE → MPGTSLCPTLELQTGPRSHRATVTLELLFSSCSSN
         493-1894: Missing.

    Show »
    Length:492
    Mass (Da):55,034
    Checksum:iEA48649E41364BCA
    GO
    Isoform 3 (identifier: Q9HCM2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         458-522: IRVDGPRGNA...YQSCGECLGS → SFGTGPQGGI...CFLNVPGNSS
         523-1894: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:522
    Mass (Da):58,165
    Checksum:iDF8322647088FE4B
    GO
    Isoform 4 (identifier: Q9HCM2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1550: Missing.

    Show »
    Length:344
    Mass (Da):39,312
    Checksum:i500F224FA6A400E8
    GO

    Sequence cautioni

    The sequence AAQ89209.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1750 – 17501N → D in CAD39161. (PubMed:17974005)Curated
    Sequence conflicti1804 – 18041I → V in CAD39161. (PubMed:17974005)Curated
    Isoform 2 (identifier: Q9HCM2-2)
    Sequence conflicti458 – 4581M → V in BAC85615. (PubMed:14702039)Curated
    Sequence conflicti458 – 4581M → V in AAQ89209. (PubMed:12975309)Curated
    Isoform 3 (identifier: Q9HCM2-3)
    Sequence conflicti475 – 4751E → A in AAH28744. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 15501550Missing in isoform 4. 1 PublicationVSP_019334Add
    BLAST
    Alternative sequencei458 – 52265IRVDG…ECLGS → SFGTGPQGGITQEWIGVEGD PPGANIASQEQMLCVYLQCS SHKAISDQRVQPLLCCFLNV PGNSS in isoform 3. 2 PublicationsVSP_019330Add
    BLAST
    Alternative sequencei458 – 49235IRVDG…SKDHE → MPGTSLCPTLELQTGPRSHR ATVTLELLFSSCSSN in isoform 2. 2 PublicationsVSP_019331Add
    BLAST
    Alternative sequencei493 – 18941402Missing in isoform 2. 2 PublicationsVSP_019332Add
    BLAST
    Alternative sequencei523 – 18941372Missing in isoform 3. 2 PublicationsVSP_019333Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK095606 mRNA. Translation: BAC04587.1.
    AK123428 mRNA. Translation: BAC85615.1.
    AC009364 Genomic DNA. No translation available.
    AC009365 Genomic DNA. No translation available.
    AC009785 Genomic DNA. No translation available.
    AC011625 Genomic DNA. No translation available.
    AC018643 Genomic DNA. No translation available.
    AC026239 Genomic DNA. No translation available.
    CH236950 Genomic DNA. Translation: EAL24076.1.
    CH471070 Genomic DNA. Translation: EAW83793.1.
    BC028744 mRNA. Translation: AAH28744.1.
    AY358850 mRNA. Translation: AAQ89209.1. Different initiation.
    AL137352 mRNA. Translation: CAB70707.1.
    AL834504 mRNA. Translation: CAD39161.3.
    AB046770 mRNA. Translation: BAB13376.3.
    CCDSiCCDS43646.1. [Q9HCM2-1]
    CCDS43647.1. [Q9HCM2-2]
    CCDS5826.1. [Q9HCM2-3]
    PIRiT46426.
    RefSeqiNP_001099013.1. NM_001105543.1. [Q9HCM2-2]
    NP_065962.1. NM_020911.1. [Q9HCM2-1]
    NP_861440.2. NM_181775.3. [Q9HCM2-3]
    XP_005250743.1. XM_005250686.2. [Q9HCM2-1]
    XP_005250744.1. XM_005250687.1. [Q9HCM2-3]
    XP_006716234.1. XM_006716171.1. [Q9HCM2-1]
    UniGeneiHs.511454.

    Genome annotation databases

    EnsembliENST00000321063; ENSP00000323194; ENSG00000221866. [Q9HCM2-1]
    ENST00000359827; ENSP00000352882; ENSG00000221866. [Q9HCM2-1]
    ENST00000378539; ENSP00000367800; ENSG00000221866. [Q9HCM2-3]
    ENST00000423507; ENSP00000392772; ENSG00000221866. [Q9HCM2-2]
    GeneIDi91584.
    KEGGihsa:91584.
    UCSCiuc003vqz.4. human. [Q9HCM2-4]
    uc003vra.4. human. [Q9HCM2-1]
    uc003vrb.3. human.
    uc003vrc.2. human. [Q9HCM2-2]

    Polymorphism databases

    DMDMi108860890.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK095606 mRNA. Translation: BAC04587.1 .
    AK123428 mRNA. Translation: BAC85615.1 .
    AC009364 Genomic DNA. No translation available.
    AC009365 Genomic DNA. No translation available.
    AC009785 Genomic DNA. No translation available.
    AC011625 Genomic DNA. No translation available.
    AC018643 Genomic DNA. No translation available.
    AC026239 Genomic DNA. No translation available.
    CH236950 Genomic DNA. Translation: EAL24076.1 .
    CH471070 Genomic DNA. Translation: EAW83793.1 .
    BC028744 mRNA. Translation: AAH28744.1 .
    AY358850 mRNA. Translation: AAQ89209.1 . Different initiation.
    AL137352 mRNA. Translation: CAB70707.1 .
    AL834504 mRNA. Translation: CAD39161.3 .
    AB046770 mRNA. Translation: BAB13376.3 .
    CCDSi CCDS43646.1. [Q9HCM2-1 ]
    CCDS43647.1. [Q9HCM2-2 ]
    CCDS5826.1. [Q9HCM2-3 ]
    PIRi T46426.
    RefSeqi NP_001099013.1. NM_001105543.1. [Q9HCM2-2 ]
    NP_065962.1. NM_020911.1. [Q9HCM2-1 ]
    NP_861440.2. NM_181775.3. [Q9HCM2-3 ]
    XP_005250743.1. XM_005250686.2. [Q9HCM2-1 ]
    XP_005250744.1. XM_005250687.1. [Q9HCM2-3 ]
    XP_006716234.1. XM_006716171.1. [Q9HCM2-1 ]
    UniGenei Hs.511454.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4E74 X-ray 1.58 A 1488-1603 [» ]
    ProteinModelPortali Q9HCM2.
    SMRi Q9HCM2. Positions 40-657, 735-1039, 1273-1890.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000323194.

    PTM databases

    PhosphoSitei Q9HCM2.

    Polymorphism databases

    DMDMi 108860890.

    Proteomic databases

    MaxQBi Q9HCM2.
    PaxDbi Q9HCM2.
    PRIDEi Q9HCM2.

    Protocols and materials databases

    DNASUi 91584.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000321063 ; ENSP00000323194 ; ENSG00000221866 . [Q9HCM2-1 ]
    ENST00000359827 ; ENSP00000352882 ; ENSG00000221866 . [Q9HCM2-1 ]
    ENST00000378539 ; ENSP00000367800 ; ENSG00000221866 . [Q9HCM2-3 ]
    ENST00000423507 ; ENSP00000392772 ; ENSG00000221866 . [Q9HCM2-2 ]
    GeneIDi 91584.
    KEGGi hsa:91584.
    UCSCi uc003vqz.4. human. [Q9HCM2-4 ]
    uc003vra.4. human. [Q9HCM2-1 ]
    uc003vrb.3. human.
    uc003vrc.2. human. [Q9HCM2-2 ]

    Organism-specific databases

    CTDi 91584.
    GeneCardsi GC07M131720.
    H-InvDB HIX0007090.
    HGNCi HGNC:9102. PLXNA4.
    HPAi HPA029919.
    MIMi 604280. gene.
    neXtProti NX_Q9HCM2.
    PharmGKBi PA162399757.
    PA33428.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG254546.
    HOGENOMi HOG000252970.
    HOVERGENi HBG105711.
    InParanoidi Q9HCM2.
    OMAi EQMLCVY.
    OrthoDBi EOG7Q8CM9.
    PhylomeDBi Q9HCM2.
    TreeFami TF312962.

    Enzyme and pathway databases

    Reactomei REACT_19199. CRMPs in Sema3A signaling.
    REACT_19200. Other semaphorin interactions.
    REACT_19236. Sema3A PAK dependent Axon repulsion.
    REACT_19279. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.

    Miscellaneous databases

    ChiTaRSi PLXNA4. human.
    GeneWikii PLXNA4A.
    GenomeRNAii 91584.
    NextBioi 77311.
    PROi Q9HCM2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HCM2.
    Bgeei Q9HCM2.
    CleanExi HS_PLXNA4.
    Genevestigatori Q9HCM2.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    2.60.40.10. 4 hits.
    InterProi IPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR016201. Plexin-like_fold.
    IPR013548. Plexin_cytoplasmic_RasGAP_dom.
    IPR002165. Plexin_repeat.
    IPR008936. Rho_GTPase_activation_prot.
    IPR001627. Semap_dom.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view ]
    Pfami PF08337. Plexin_cytopl. 1 hit.
    PF01437. PSI. 3 hits.
    PF01403. Sema. 1 hit.
    PF01833. TIG. 4 hits.
    [Graphical view ]
    SMARTi SM00429. IPT. 4 hits.
    SM00423. PSI. 3 hits.
    SM00630. Sema. 1 hit.
    [Graphical view ]
    SUPFAMi SSF101912. SSF101912. 1 hit.
    SSF103575. SSF103575. 2 hits.
    SSF48350. SSF48350. 2 hits.
    SSF81296. SSF81296. 4 hits.
    PROSITEi PS51004. SEMA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Tissue: Brain and Hippocampus.
    2. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-1894 (ISOFORM 2).
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 206-1894 (ISOFORM 3), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Kidney and Testis.
    8. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
      DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 433-1894 (ISOFORM 1).
      Tissue: Brain.
    9. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    10. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1350, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPLXA4_HUMAN
    AccessioniPrimary (citable) accession number: Q9HCM2
    Secondary accession number(s): A4D1N6
    , E9PAM2, Q6UWC6, Q6ZW89, Q8N969, Q8ND00, Q8NEN3, Q9NTD4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 13, 2006
    Last sequence update: June 13, 2006
    Last modified: October 1, 2014
    This is version 111 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3