Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HCM2

- PLXA4_HUMAN

UniProt

Q9HCM2 - PLXA4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Plexin-A4

Gene

PLXNA4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).By similarity

GO - Molecular functioni

  1. semaphorin receptor activity Source: Ensembl

GO - Biological processi

  1. anterior commissure morphogenesis Source: Ensembl
  2. axon guidance Source: Reactome
  3. chemorepulsion of branchiomotor axon Source: Ensembl
  4. facial nerve structural organization Source: Ensembl
  5. glossopharyngeal nerve morphogenesis Source: Ensembl
  6. postganglionic parasympathetic nervous system development Source: Ensembl
  7. regulation of axon extension involved in axon guidance Source: Ensembl
  8. regulation of negative chemotaxis Source: Ensembl
  9. semaphorin-plexin signaling pathway Source: BHF-UCL
  10. semaphorin-plexin signaling pathway involved in axon guidance Source: Ensembl
  11. sympathetic nervous system development Source: Ensembl
  12. trigeminal nerve structural organization Source: Ensembl
  13. vagus nerve morphogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

ReactomeiREACT_19199. CRMPs in Sema3A signaling.
REACT_19200. Other semaphorin interactions.
REACT_19236. Sema3A PAK dependent Axon repulsion.
REACT_19279. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.

Names & Taxonomyi

Protein namesi
Recommended name:
Plexin-A4
Gene namesi
Name:PLXNA4
Synonyms:KIAA1550, PLXNA4A, PLXNA4B
ORF Names:UNQ2820/PRO34003
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:9102. PLXNA4.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. intracellular Source: InterPro
  3. plasma membrane Source: Reactome
  4. semaphorin receptor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162399757.
PA33428.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence AnalysisAdd
BLAST
Chaini24 – 18941871Plexin-A4PRO_0000240283Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi95 ↔ 104PROSITE-ProRule annotation
Disulfide bondi130 ↔ 138PROSITE-ProRule annotation
Disulfide bondi284 ↔ 405PROSITE-ProRule annotation
Disulfide bondi300 ↔ 356PROSITE-ProRule annotation
Disulfide bondi374 ↔ 393PROSITE-ProRule annotation
Disulfide bondi510 ↔ 527PROSITE-ProRule annotation
Disulfide bondi516 ↔ 558PROSITE-ProRule annotation
Disulfide bondi519 ↔ 536PROSITE-ProRule annotation
Disulfide bondi530 ↔ 542PROSITE-ProRule annotation
Disulfide bondi593 ↔ 612PROSITE-ProRule annotation
Glycosylationi655 – 6551N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1007 – 10071N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1132 – 11321N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1180 – 11801N-linked (GlcNAc...)Sequence Analysis
Modified residuei1350 – 13501N6-acetyllysine1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9HCM2.
PaxDbiQ9HCM2.
PRIDEiQ9HCM2.

PTM databases

PhosphoSiteiQ9HCM2.

Expressioni

Gene expression databases

BgeeiQ9HCM2.
CleanExiHS_PLXNA4.
GenevestigatoriQ9HCM2.

Organism-specific databases

HPAiHPA029919.

Interactioni

Subunit structurei

Interacts with NRP1 and NRP2.By similarity

Protein-protein interaction databases

BioGridi124849. 1 interaction.
STRINGi9606.ENSP00000323194.

Structurei

Secondary structure

1
1894
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1499 – 15046
Beta strandi1515 – 15206
Helixi1525 – 153612
Turni1537 – 15393
Helixi1542 – 15443
Helixi1548 – 15503
Beta strandi1551 – 15566
Beta strandi1562 – 15654
Beta strandi1567 – 15693
Helixi1584 – 15874
Beta strandi1594 – 15996

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4E74X-ray1.58A1488-1603[»]
ProteinModelPortaliQ9HCM2.
SMRiQ9HCM2. Positions 40-657, 735-1039, 1273-1890.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 12371214ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1259 – 1894636CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1238 – 125821HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 507484SemaPROSITE-ProRule annotationAdd
BLAST
Domaini509 – 55951PSI 1Add
BLAST
Domaini655 – 70248PSI 2Add
BLAST
Domaini803 – 85654PSI 3Add
BLAST
Domaini858 – 95295IPT/TIG 1Add
BLAST
Domaini954 – 103784IPT/TIG 2Add
BLAST
Domaini1040 – 1139100IPT/TIG 3Add
BLAST
Domaini1142 – 123089IPT/TIG 4Add
BLAST

Sequence similaritiesi

Belongs to the plexin family.Curated
Contains 4 IPT/TIG domains.Curated
Contains 3 PSI domains.Curated
Contains 1 Sema domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG254546.
GeneTreeiENSGT00760000119048.
HOGENOMiHOG000252970.
HOVERGENiHBG105711.
InParanoidiQ9HCM2.
OMAiEQMLCVY.
OrthoDBiEOG7Q8CM9.
PhylomeDBiQ9HCM2.
TreeFamiTF312962.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
2.60.40.10. 4 hits.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PfamiPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 3 hits.
PF01403. Sema. 1 hit.
PF01833. TIG. 4 hits.
[Graphical view]
SMARTiSM00429. IPT. 4 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMiSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 2 hits.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 4 hits.
PROSITEiPS51004. SEMA. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HCM2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKAMPWNWTC LLSHLLMVGM GSSTLLTRQP APLSQKQRSF VTFRGEPAEG
60 70 80 90 100
FNHLVVDERT GHIYLGAVNR IYKLSSDLKV LVTHETGPDE DNPKCYPPRI
110 120 130 140 150
VQTCNEPLTT TNNVNKMLLI DYKENRLIAC GSLYQGICKL LRLEDLFKLG
160 170 180 190 200
EPYHKKEHYL SGVNESGSVF GVIVSYSNLD DKLFIATAVD GKPEYFPTIS
210 220 230 240 250
SRKLTKNSEA DGMFAYVFHD EFVASMIKIP SDTFTIIPDF DIYYVYGFSS
260 270 280 290 300
GNFVYFLTLQ PEMVSPPGST TKEQVYTSKL VRLCKEDTAF NSYVEVPIGC
310 320 330 340 350
ERSGVEYRLL QAAYLSKAGA VLGRTLGVHP DDDLLFTVFS KGQKRKMKSL
360 370 380 390 400
DESALCIFIL KQINDRIKER LQSCYRGEGT LDLAWLKVKD IPCSSALLTI
410 420 430 440 450
DDNFCGLDMN APLGVSDMVR GIPVFTEDRD RMTSVIAYVY KNHSLAFVGT
460 470 480 490 500
KSGKLKKIRV DGPRGNALQY ETVQVVDPGP VLRDMAFSKD HEQLYIMSER
510 520 530 540 550
QLTRVPVESC GQYQSCGECL GSGDPHCGWC VLHNTCTRKE RCERSKEPRR
560 570 580 590 600
FASEMKQCVR LTVHPNNISV SQYNVLLVLE TYNVPELSAG VNCTFEDLSE
610 620 630 640 650
MDGLVVGNQI QCYSPAAKEV PRIITENGDH HVVQLQLKSK ETGMTFASTS
660 670 680 690 700
FVFYNCSVHN SCLSCVESPY RCHWCKYRHV CTHDPKTCSF QEGRVKLPED
710 720 730 740 750
CPQLLRVDKI LVPVEVIKPI TLKAKNLPQP QSGQRGYECI LNIQGSEQRV
760 770 780 790 800
PALRFNSSSV QCQNTSYSYE GMEINNLPVE LTVVWNGHFN IDNPAQNKVH
810 820 830 840 850
LYKCGAMRES CGLCLKADPD FACGWCQGPG QCTLRQHCPA QESQWLELSG
860 870 880 890 900
AKSKCTNPRI TEIIPVTGPR EGGTKVTIRG ENLGLEFRDI ASHVKVAGVE
910 920 930 940 950
CSPLVDGYIP AEQIVCEMGE AKPSQHAGFV EICVAVCRPE FMARSSQLYY
960 970 980 990 1000
FMTLTLSDLK PSRGPMSGGT QVTITGTNLN AGSNVVVMFG KQPCLFHRRS
1010 1020 1030 1040 1050
PSYIVCNTTS SDEVLEMKVS VQVDRAKIHQ DLVFQYVEDP TIVRIEPEWS
1060 1070 1080 1090 1100
IVSGNTPIAV WGTHLDLIQN PQIRAKHGGK EHINICEVLN ATEMTCQAPA
1110 1120 1130 1140 1150
LALGPDHQSD LTERPEEFGF ILDNVQSLLI LNKTNFTYYP NPVFEAFGPS
1160 1170 1180 1190 1200
GILELKPGTP IILKGKNLIP PVAGGNVKLN YTVLVGEKPC TVTVSDVQLL
1210 1220 1230 1240 1250
CESPNLIGRH KVMARVGGME YSPGMVYIAP DSPLSLPAIV SIAVAGGLLI
1260 1270 1280 1290 1300
IFIVAVLIAY KRKSRESDLT LKRLQMQMDN LESRVALECK EAFAELQTDI
1310 1320 1330 1340 1350
HELTSDLDGA GIPFLDYRTY TMRVLFPGIE DHPVLRDLEV PGYRQERVEK
1360 1370 1380 1390 1400
GLKLFAQLIN NKVFLLSFIR TLESQRSFSM RDRGNVASLI MTVLQSKLEY
1410 1420 1430 1440 1450
ATDVLKQLLA DLIDKNLESK NHPKLLLRRT ESVAEKMLTN WFTFLLYKFL
1460 1470 1480 1490 1500
KECAGEPLFS LFCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIDYKTL
1510 1520 1530 1540 1550
VLSCVSPDNA NSPEVPVKIL NCDTITQVKE KILDAIFKNV PCSHRPKAAD
1560 1570 1580 1590 1600
MDLEWRQGSG ARMILQDEDI TTKIENDWKR LNTLAHYQVP DGSVVALVSK
1610 1620 1630 1640 1650
QVTAYNAVNN STVSRTSASK YENMIRYTGS PDSLRSRTPM ITPDLESGVK
1660 1670 1680 1690 1700
MWHLVKNHEH GDQKEGDRGS KMVSEIYLTR LLATKGTLQK FVDDLFETIF
1710 1720 1730 1740 1750
STAHRGSALP LAIKYMFDFL DEQADKHGIH DPHVRHTWKS NCLPLRFWVN
1760 1770 1780 1790 1800
MIKNPQFVFD IHKNSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY
1810 1820 1830 1840 1850
AKDIPSYKNW VERYYSDIGK MPAISDQDMN AYLAEQSRMH MNEFNTMSAL
1860 1870 1880 1890
SEIFSYVGKY SEEILGPLDH DDQCGKQKLA YKLEQVITLM SLDS
Length:1,894
Mass (Da):212,455
Last modified:June 13, 2006 - v4
Checksum:i7B45C8929C5847DF
GO
Isoform 2 (identifier: Q9HCM2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-492: IRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHE → MPGTSLCPTLELQTGPRSHRATVTLELLFSSCSSN
     493-1894: Missing.

Show »
Length:492
Mass (Da):55,034
Checksum:iEA48649E41364BCA
GO
Isoform 3 (identifier: Q9HCM2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-522: IRVDGPRGNA...YQSCGECLGS → SFGTGPQGGI...CFLNVPGNSS
     523-1894: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:522
Mass (Da):58,165
Checksum:iDF8322647088FE4B
GO
Isoform 4 (identifier: Q9HCM2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1550: Missing.

Show »
Length:344
Mass (Da):39,312
Checksum:i500F224FA6A400E8
GO

Sequence cautioni

The sequence AAQ89209.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1750 – 17501N → D in CAD39161. (PubMed:17974005)Curated
Sequence conflicti1804 – 18041I → V in CAD39161. (PubMed:17974005)Curated
Isoform 2 (identifier: Q9HCM2-2)
Sequence conflicti458 – 4581M → V in BAC85615. (PubMed:14702039)Curated
Sequence conflicti458 – 4581M → V in AAQ89209. (PubMed:12975309)Curated
Isoform 3 (identifier: Q9HCM2-3)
Sequence conflicti475 – 4751E → A in AAH28744. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 15501550Missing in isoform 4. 1 PublicationVSP_019334Add
BLAST
Alternative sequencei458 – 52265IRVDG…ECLGS → SFGTGPQGGITQEWIGVEGD PPGANIASQEQMLCVYLQCS SHKAISDQRVQPLLCCFLNV PGNSS in isoform 3. 2 PublicationsVSP_019330Add
BLAST
Alternative sequencei458 – 49235IRVDG…SKDHE → MPGTSLCPTLELQTGPRSHR ATVTLELLFSSCSSN in isoform 2. 2 PublicationsVSP_019331Add
BLAST
Alternative sequencei493 – 18941402Missing in isoform 2. 2 PublicationsVSP_019332Add
BLAST
Alternative sequencei523 – 18941372Missing in isoform 3. 2 PublicationsVSP_019333Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK095606 mRNA. Translation: BAC04587.1.
AK123428 mRNA. Translation: BAC85615.1.
AC009364 Genomic DNA. No translation available.
AC009365 Genomic DNA. No translation available.
AC009785 Genomic DNA. No translation available.
AC011625 Genomic DNA. No translation available.
AC018643 Genomic DNA. No translation available.
AC026239 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24076.1.
CH471070 Genomic DNA. Translation: EAW83793.1.
BC028744 mRNA. Translation: AAH28744.1.
AY358850 mRNA. Translation: AAQ89209.1. Different initiation.
AL137352 mRNA. Translation: CAB70707.1.
AL834504 mRNA. Translation: CAD39161.3.
AB046770 mRNA. Translation: BAB13376.3.
CCDSiCCDS43646.1. [Q9HCM2-1]
CCDS43647.1. [Q9HCM2-2]
CCDS5826.1. [Q9HCM2-3]
PIRiT46426.
RefSeqiNP_001099013.1. NM_001105543.1. [Q9HCM2-2]
NP_065962.1. NM_020911.1. [Q9HCM2-1]
NP_861440.2. NM_181775.3. [Q9HCM2-3]
XP_005250743.1. XM_005250686.2. [Q9HCM2-1]
XP_005250744.1. XM_005250687.1. [Q9HCM2-3]
XP_006716234.1. XM_006716171.1. [Q9HCM2-1]
UniGeneiHs.511454.

Genome annotation databases

EnsembliENST00000321063; ENSP00000323194; ENSG00000221866. [Q9HCM2-1]
ENST00000359827; ENSP00000352882; ENSG00000221866. [Q9HCM2-1]
ENST00000378539; ENSP00000367800; ENSG00000221866. [Q9HCM2-3]
ENST00000423507; ENSP00000392772; ENSG00000221866. [Q9HCM2-2]
GeneIDi91584.
KEGGihsa:91584.
UCSCiuc003vqz.4. human. [Q9HCM2-4]
uc003vra.4. human. [Q9HCM2-1]
uc003vrb.3. human.
uc003vrc.2. human. [Q9HCM2-2]

Polymorphism databases

DMDMi108860890.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK095606 mRNA. Translation: BAC04587.1 .
AK123428 mRNA. Translation: BAC85615.1 .
AC009364 Genomic DNA. No translation available.
AC009365 Genomic DNA. No translation available.
AC009785 Genomic DNA. No translation available.
AC011625 Genomic DNA. No translation available.
AC018643 Genomic DNA. No translation available.
AC026239 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24076.1 .
CH471070 Genomic DNA. Translation: EAW83793.1 .
BC028744 mRNA. Translation: AAH28744.1 .
AY358850 mRNA. Translation: AAQ89209.1 . Different initiation.
AL137352 mRNA. Translation: CAB70707.1 .
AL834504 mRNA. Translation: CAD39161.3 .
AB046770 mRNA. Translation: BAB13376.3 .
CCDSi CCDS43646.1. [Q9HCM2-1 ]
CCDS43647.1. [Q9HCM2-2 ]
CCDS5826.1. [Q9HCM2-3 ]
PIRi T46426.
RefSeqi NP_001099013.1. NM_001105543.1. [Q9HCM2-2 ]
NP_065962.1. NM_020911.1. [Q9HCM2-1 ]
NP_861440.2. NM_181775.3. [Q9HCM2-3 ]
XP_005250743.1. XM_005250686.2. [Q9HCM2-1 ]
XP_005250744.1. XM_005250687.1. [Q9HCM2-3 ]
XP_006716234.1. XM_006716171.1. [Q9HCM2-1 ]
UniGenei Hs.511454.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4E74 X-ray 1.58 A 1488-1603 [» ]
ProteinModelPortali Q9HCM2.
SMRi Q9HCM2. Positions 40-657, 735-1039, 1273-1890.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124849. 1 interaction.
STRINGi 9606.ENSP00000323194.

PTM databases

PhosphoSitei Q9HCM2.

Polymorphism databases

DMDMi 108860890.

Proteomic databases

MaxQBi Q9HCM2.
PaxDbi Q9HCM2.
PRIDEi Q9HCM2.

Protocols and materials databases

DNASUi 91584.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000321063 ; ENSP00000323194 ; ENSG00000221866 . [Q9HCM2-1 ]
ENST00000359827 ; ENSP00000352882 ; ENSG00000221866 . [Q9HCM2-1 ]
ENST00000378539 ; ENSP00000367800 ; ENSG00000221866 . [Q9HCM2-3 ]
ENST00000423507 ; ENSP00000392772 ; ENSG00000221866 . [Q9HCM2-2 ]
GeneIDi 91584.
KEGGi hsa:91584.
UCSCi uc003vqz.4. human. [Q9HCM2-4 ]
uc003vra.4. human. [Q9HCM2-1 ]
uc003vrb.3. human.
uc003vrc.2. human. [Q9HCM2-2 ]

Organism-specific databases

CTDi 91584.
GeneCardsi GC07M131720.
H-InvDB HIX0007090.
HGNCi HGNC:9102. PLXNA4.
HPAi HPA029919.
MIMi 604280. gene.
neXtProti NX_Q9HCM2.
PharmGKBi PA162399757.
PA33428.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG254546.
GeneTreei ENSGT00760000119048.
HOGENOMi HOG000252970.
HOVERGENi HBG105711.
InParanoidi Q9HCM2.
OMAi EQMLCVY.
OrthoDBi EOG7Q8CM9.
PhylomeDBi Q9HCM2.
TreeFami TF312962.

Enzyme and pathway databases

Reactomei REACT_19199. CRMPs in Sema3A signaling.
REACT_19200. Other semaphorin interactions.
REACT_19236. Sema3A PAK dependent Axon repulsion.
REACT_19279. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.

Miscellaneous databases

ChiTaRSi PLXNA4. human.
GeneWikii PLXNA4A.
GenomeRNAii 91584.
NextBioi 77311.
PROi Q9HCM2.
SOURCEi Search...

Gene expression databases

Bgeei Q9HCM2.
CleanExi HS_PLXNA4.
Genevestigatori Q9HCM2.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
2.60.40.10. 4 hits.
InterProi IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view ]
Pfami PF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 3 hits.
PF01403. Sema. 1 hit.
PF01833. TIG. 4 hits.
[Graphical view ]
SMARTi SM00429. IPT. 4 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view ]
SUPFAMi SSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 2 hits.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 4 hits.
PROSITEi PS51004. SEMA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Brain and Hippocampus.
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-1894 (ISOFORM 2).
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 206-1894 (ISOFORM 3), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Kidney and Testis.
  8. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 433-1894 (ISOFORM 1).
    Tissue: Brain.
  9. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  10. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1350, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPLXA4_HUMAN
AccessioniPrimary (citable) accession number: Q9HCM2
Secondary accession number(s): A4D1N6
, E9PAM2, Q6UWC6, Q6ZW89, Q8N969, Q8ND00, Q8NEN3, Q9NTD4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: October 29, 2014
This is version 112 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3