Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9HCM2 (PLXA4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Plexin-A4
Gene names
Name:PLXNA4
Synonyms:KIAA1550, PLXNA4A, PLXNA4B
ORF Names:UNQ2820/PRO34003
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1894 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm By similarity.

Subunit structure

Interacts with NRP1 and NRP2 By similarity.

Subcellular location

Cell membrane; Single-pass type I membrane protein Potential.

Sequence similarities

Belongs to the plexin family.

Contains 4 IPT/TIG domains.

Contains 3 PSI domains.

Contains 1 Sema domain.

Sequence caution

The sequence AAQ89209.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMAcetylation
Disulfide bond
Glycoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processanterior commissure morphogenesis

Inferred from electronic annotation. Source: Ensembl

axon guidance

Traceable author statement. Source: Reactome

chemorepulsion of branchiomotor axon

Inferred from electronic annotation. Source: Ensembl

facial nerve morphogenesis

Inferred from electronic annotation. Source: Ensembl

glossopharyngeal nerve morphogenesis

Inferred from electronic annotation. Source: Ensembl

postganglionic parasympathetic nervous system development

Inferred from electronic annotation. Source: Ensembl

regulation of axon extension involved in axon guidance

Inferred from electronic annotation. Source: Ensembl

regulation of negative chemotaxis

Inferred from electronic annotation. Source: Ensembl

semaphorin-plexin signaling pathway

Non-traceable author statement PubMed 19909241. Source: BHF-UCL

sympathetic nervous system development

Inferred from electronic annotation. Source: Ensembl

trigeminal nerve morphogenesis

Inferred from electronic annotation. Source: Ensembl

vagus nerve morphogenesis

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

intracellular

Inferred from electronic annotation. Source: InterPro

plasma membrane

Traceable author statement. Source: Reactome

semaphorin receptor complex

Traceable author statement PubMed 19909241. Source: BHF-UCL

   Molecular_functionsemaphorin receptor activity

Inferred from electronic annotation. Source: Ensembl

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9HCM2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9HCM2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     458-492: IRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHE → MPGTSLCPTLELQTGPRSHRATVTLELLFSSCSSN
     493-1894: Missing.
Isoform 3 (identifier: Q9HCM2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     458-522: IRVDGPRGNA...YQSCGECLGS → SFGTGPQGGI...CFLNVPGNSS
     523-1894: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9HCM2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1550: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2323 Potential
Chain24 – 18941871Plexin-A4
PRO_0000240283

Regions

Topological domain24 – 12371214Extracellular Potential
Transmembrane1238 – 125821Helical; Potential
Topological domain1259 – 1894636Cytoplasmic Potential
Domain24 – 507484Sema
Domain509 – 55951PSI 1
Domain655 – 70248PSI 2
Domain803 – 85654PSI 3
Domain858 – 95295IPT/TIG 1
Domain954 – 103784IPT/TIG 2
Domain1040 – 1139100IPT/TIG 3
Domain1142 – 123089IPT/TIG 4

Amino acid modifications

Modified residue13501N6-acetyllysine Ref.10
Glycosylation6551N-linked (GlcNAc...) Potential
Glycosylation10071N-linked (GlcNAc...) Potential
Glycosylation11321N-linked (GlcNAc...) Potential
Glycosylation11801N-linked (GlcNAc...) Potential
Disulfide bond95 ↔ 104 By similarity
Disulfide bond130 ↔ 138 By similarity
Disulfide bond284 ↔ 405 By similarity
Disulfide bond300 ↔ 356 By similarity
Disulfide bond374 ↔ 393 By similarity
Disulfide bond510 ↔ 527 By similarity
Disulfide bond516 ↔ 558 By similarity
Disulfide bond519 ↔ 536 By similarity
Disulfide bond530 ↔ 542 By similarity
Disulfide bond593 ↔ 612 By similarity

Natural variations

Alternative sequence1 – 15501550Missing in isoform 4.
VSP_019334
Alternative sequence458 – 52265IRVDG…ECLGS → SFGTGPQGGITQEWIGVEGD PPGANIASQEQMLCVYLQCS SHKAISDQRVQPLLCCFLNV PGNSS in isoform 3.
VSP_019330
Alternative sequence458 – 49235IRVDG…SKDHE → MPGTSLCPTLELQTGPRSHR ATVTLELLFSSCSSN in isoform 2.
VSP_019331
Alternative sequence493 – 18941402Missing in isoform 2.
VSP_019332
Alternative sequence523 – 18941372Missing in isoform 3.
VSP_019333

Experimental info

Sequence conflict17501N → D in CAD39161. Ref.7
Sequence conflict18041I → V in CAD39161. Ref.7
Isoform 2:
Sequence conflict4581M → V in BAC85615. Ref.1
Sequence conflict4581M → V in AAQ89209. Ref.6
Isoform 3:
Sequence conflict4751E → A in AAH28744. Ref.5

Secondary structure

..................... 1894
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 13, 2006. Version 4.
Checksum: 7B45C8929C5847DF

FASTA1,894212,455
        10         20         30         40         50         60 
MKAMPWNWTC LLSHLLMVGM GSSTLLTRQP APLSQKQRSF VTFRGEPAEG FNHLVVDERT 

        70         80         90        100        110        120 
GHIYLGAVNR IYKLSSDLKV LVTHETGPDE DNPKCYPPRI VQTCNEPLTT TNNVNKMLLI 

       130        140        150        160        170        180 
DYKENRLIAC GSLYQGICKL LRLEDLFKLG EPYHKKEHYL SGVNESGSVF GVIVSYSNLD 

       190        200        210        220        230        240 
DKLFIATAVD GKPEYFPTIS SRKLTKNSEA DGMFAYVFHD EFVASMIKIP SDTFTIIPDF 

       250        260        270        280        290        300 
DIYYVYGFSS GNFVYFLTLQ PEMVSPPGST TKEQVYTSKL VRLCKEDTAF NSYVEVPIGC 

       310        320        330        340        350        360 
ERSGVEYRLL QAAYLSKAGA VLGRTLGVHP DDDLLFTVFS KGQKRKMKSL DESALCIFIL 

       370        380        390        400        410        420 
KQINDRIKER LQSCYRGEGT LDLAWLKVKD IPCSSALLTI DDNFCGLDMN APLGVSDMVR 

       430        440        450        460        470        480 
GIPVFTEDRD RMTSVIAYVY KNHSLAFVGT KSGKLKKIRV DGPRGNALQY ETVQVVDPGP 

       490        500        510        520        530        540 
VLRDMAFSKD HEQLYIMSER QLTRVPVESC GQYQSCGECL GSGDPHCGWC VLHNTCTRKE 

       550        560        570        580        590        600 
RCERSKEPRR FASEMKQCVR LTVHPNNISV SQYNVLLVLE TYNVPELSAG VNCTFEDLSE 

       610        620        630        640        650        660 
MDGLVVGNQI QCYSPAAKEV PRIITENGDH HVVQLQLKSK ETGMTFASTS FVFYNCSVHN 

       670        680        690        700        710        720 
SCLSCVESPY RCHWCKYRHV CTHDPKTCSF QEGRVKLPED CPQLLRVDKI LVPVEVIKPI 

       730        740        750        760        770        780 
TLKAKNLPQP QSGQRGYECI LNIQGSEQRV PALRFNSSSV QCQNTSYSYE GMEINNLPVE 

       790        800        810        820        830        840 
LTVVWNGHFN IDNPAQNKVH LYKCGAMRES CGLCLKADPD FACGWCQGPG QCTLRQHCPA 

       850        860        870        880        890        900 
QESQWLELSG AKSKCTNPRI TEIIPVTGPR EGGTKVTIRG ENLGLEFRDI ASHVKVAGVE 

       910        920        930        940        950        960 
CSPLVDGYIP AEQIVCEMGE AKPSQHAGFV EICVAVCRPE FMARSSQLYY FMTLTLSDLK 

       970        980        990       1000       1010       1020 
PSRGPMSGGT QVTITGTNLN AGSNVVVMFG KQPCLFHRRS PSYIVCNTTS SDEVLEMKVS 

      1030       1040       1050       1060       1070       1080 
VQVDRAKIHQ DLVFQYVEDP TIVRIEPEWS IVSGNTPIAV WGTHLDLIQN PQIRAKHGGK 

      1090       1100       1110       1120       1130       1140 
EHINICEVLN ATEMTCQAPA LALGPDHQSD LTERPEEFGF ILDNVQSLLI LNKTNFTYYP 

      1150       1160       1170       1180       1190       1200 
NPVFEAFGPS GILELKPGTP IILKGKNLIP PVAGGNVKLN YTVLVGEKPC TVTVSDVQLL 

      1210       1220       1230       1240       1250       1260 
CESPNLIGRH KVMARVGGME YSPGMVYIAP DSPLSLPAIV SIAVAGGLLI IFIVAVLIAY 

      1270       1280       1290       1300       1310       1320 
KRKSRESDLT LKRLQMQMDN LESRVALECK EAFAELQTDI HELTSDLDGA GIPFLDYRTY 

      1330       1340       1350       1360       1370       1380 
TMRVLFPGIE DHPVLRDLEV PGYRQERVEK GLKLFAQLIN NKVFLLSFIR TLESQRSFSM 

      1390       1400       1410       1420       1430       1440 
RDRGNVASLI MTVLQSKLEY ATDVLKQLLA DLIDKNLESK NHPKLLLRRT ESVAEKMLTN 

      1450       1460       1470       1480       1490       1500 
WFTFLLYKFL KECAGEPLFS LFCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIDYKTL 

      1510       1520       1530       1540       1550       1560 
VLSCVSPDNA NSPEVPVKIL NCDTITQVKE KILDAIFKNV PCSHRPKAAD MDLEWRQGSG 

      1570       1580       1590       1600       1610       1620 
ARMILQDEDI TTKIENDWKR LNTLAHYQVP DGSVVALVSK QVTAYNAVNN STVSRTSASK 

      1630       1640       1650       1660       1670       1680 
YENMIRYTGS PDSLRSRTPM ITPDLESGVK MWHLVKNHEH GDQKEGDRGS KMVSEIYLTR 

      1690       1700       1710       1720       1730       1740 
LLATKGTLQK FVDDLFETIF STAHRGSALP LAIKYMFDFL DEQADKHGIH DPHVRHTWKS 

      1750       1760       1770       1780       1790       1800 
NCLPLRFWVN MIKNPQFVFD IHKNSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY 

      1810       1820       1830       1840       1850       1860 
AKDIPSYKNW VERYYSDIGK MPAISDQDMN AYLAEQSRMH MNEFNTMSAL SEIFSYVGKY 

      1870       1880       1890 
SEEILGPLDH DDQCGKQKLA YKLEQVITLM SLDS 

« Hide

Isoform 2 [UniParc].

Checksum: EA48649E41364BCA
Show »

FASTA49255,034
Isoform 3 [UniParc].

Checksum: DF8322647088FE4B
Show »

FASTA52258,165
Isoform 4 [UniParc].

Checksum: 500F224FA6A400E8
Show »

FASTA34439,312

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
Tissue: Brain and Hippocampus.
[2]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Testis.
[6]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-1894 (ISOFORM 2).
[7]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 206-1894 (ISOFORM 3), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Kidney and Testis.
[8]"Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 433-1894 (ISOFORM 1).
Tissue: Brain.
[9]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[10]"Lysine acetylation targets protein complexes and co-regulates major cellular functions."
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1350, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK095606 mRNA. Translation: BAC04587.1.
AK123428 mRNA. Translation: BAC85615.1.
AC009364 Genomic DNA. No translation available.
AC009365 Genomic DNA. No translation available.
AC009785 Genomic DNA. No translation available.
AC011625 Genomic DNA. No translation available.
AC018643 Genomic DNA. No translation available.
AC026239 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24076.1.
CH471070 Genomic DNA. Translation: EAW83793.1.
BC028744 mRNA. Translation: AAH28744.1.
AY358850 mRNA. Translation: AAQ89209.1. Different initiation.
AL137352 mRNA. Translation: CAB70707.1.
AL834504 mRNA. Translation: CAD39161.3.
AB046770 mRNA. Translation: BAB13376.3.
CCDSCCDS43646.1. [Q9HCM2-1]
CCDS43647.1. [Q9HCM2-2]
CCDS5826.1. [Q9HCM2-3]
PIRT46426.
RefSeqNP_001099013.1. NM_001105543.1. [Q9HCM2-2]
NP_065962.1. NM_020911.1. [Q9HCM2-1]
NP_861440.2. NM_181775.3. [Q9HCM2-3]
XP_005250743.1. XM_005250686.2. [Q9HCM2-1]
XP_005250744.1. XM_005250687.1. [Q9HCM2-3]
XP_006716234.1. XM_006716171.1. [Q9HCM2-1]
UniGeneHs.511454.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
4E74X-ray1.58A1488-1603[»]
ProteinModelPortalQ9HCM2.
SMRQ9HCM2. Positions 40-657, 735-1039, 1273-1890.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000323194.

PTM databases

PhosphoSiteQ9HCM2.

Polymorphism databases

DMDM108860890.

Proteomic databases

MaxQBQ9HCM2.
PaxDbQ9HCM2.
PRIDEQ9HCM2.

Protocols and materials databases

DNASU91584.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000321063; ENSP00000323194; ENSG00000221866. [Q9HCM2-1]
ENST00000359827; ENSP00000352882; ENSG00000221866. [Q9HCM2-1]
ENST00000378539; ENSP00000367800; ENSG00000221866.
ENST00000423507; ENSP00000392772; ENSG00000221866. [Q9HCM2-2]
GeneID91584.
KEGGhsa:91584.
UCSCuc003vqz.4. human. [Q9HCM2-4]
uc003vra.4. human. [Q9HCM2-1]
uc003vrc.2. human. [Q9HCM2-2]

Organism-specific databases

CTD91584.
GeneCardsGC07M131720.
H-InvDBHIX0007090.
HGNCHGNC:9102. PLXNA4.
HPAHPA029919.
MIM604280. gene.
neXtProtNX_Q9HCM2.
PharmGKBPA162399757.
PA33428.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG254546.
HOGENOMHOG000252970.
HOVERGENHBG105711.
InParanoidQ9HCM2.
OMAEQMLCVY.
OrthoDBEOG7Q8CM9.
PhylomeDBQ9HCM2.
TreeFamTF312962.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.

Gene expression databases

ArrayExpressQ9HCM2.
BgeeQ9HCM2.
CleanExHS_PLXNA4.
GenevestigatorQ9HCM2.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
2.60.40.10. 4 hits.
InterProIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PfamPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 3 hits.
PF01403. Sema. 1 hit.
PF01833. TIG. 4 hits.
[Graphical view]
SMARTSM00429. IPT. 4 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 2 hits.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 4 hits.
PROSITEPS51004. SEMA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPLXNA4. human.
GeneWikiPLXNA4A.
GenomeRNAi91584.
NextBio77311.
PROQ9HCM2.
SOURCESearch...

Entry information

Entry namePLXA4_HUMAN
AccessionPrimary (citable) accession number: Q9HCM2
Secondary accession number(s): A4D1N6 expand/collapse secondary AC list , E9PAM2, Q6UWC6, Q6ZW89, Q8N969, Q8ND00, Q8NEN3, Q9NTD4
Entry history
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: July 9, 2014
This is version 109 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM