Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plexin-A4

Gene

PLXNA4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

ReactomeiR-HSA-399954 Sema3A PAK dependent Axon repulsion
R-HSA-399955 SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
R-HSA-399956 CRMPs in Sema3A signaling
R-HSA-416700 Other semaphorin interactions

Names & Taxonomyi

Protein namesi
Recommended name:
Plexin-A4
Gene namesi
Name:PLXNA4
Synonyms:KIAA1550, PLXNA4A, PLXNA4B
ORF Names:UNQ2820/PRO34003
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000221866.9
HGNCiHGNC:9102 PLXNA4
MIMi604280 gene
neXtProtiNX_Q9HCM2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 1237ExtracellularSequence analysisAdd BLAST1214
Transmembranei1238 – 1258HelicalSequence analysisAdd BLAST21
Topological domaini1259 – 1894CytoplasmicSequence analysisAdd BLAST636

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi91584
OpenTargetsiENSG00000221866
PharmGKBiPA162399757
PA33428

Polymorphism and mutation databases

BioMutaiPLXNA4
DMDMi108860890

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000024028324 – 1894Plexin-A4Add BLAST1871

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi95 ↔ 104PROSITE-ProRule annotation
Disulfide bondi130 ↔ 138PROSITE-ProRule annotation
Disulfide bondi284 ↔ 405PROSITE-ProRule annotation
Disulfide bondi300 ↔ 356PROSITE-ProRule annotation
Disulfide bondi374 ↔ 393PROSITE-ProRule annotation
Disulfide bondi510 ↔ 527PROSITE-ProRule annotation
Disulfide bondi516 ↔ 558PROSITE-ProRule annotation
Disulfide bondi519 ↔ 536PROSITE-ProRule annotation
Disulfide bondi530 ↔ 542PROSITE-ProRule annotation
Disulfide bondi593 ↔ 612PROSITE-ProRule annotation
Glycosylationi655N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1007N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1132N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1180N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei1350N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ9HCM2
MaxQBiQ9HCM2
PaxDbiQ9HCM2
PeptideAtlasiQ9HCM2
PRIDEiQ9HCM2

PTM databases

iPTMnetiQ9HCM2
PhosphoSitePlusiQ9HCM2

Expressioni

Gene expression databases

BgeeiENSG00000221866
CleanExiHS_PLXNA4
ExpressionAtlasiQ9HCM2 baseline and differential
GenevisibleiQ9HCM2 HS

Organism-specific databases

HPAiHPA029919
HPA052141

Interactioni

Subunit structurei

Interacts with NRP1 and NRP2.By similarity

Protein-protein interaction databases

BioGridi124849, 4 interactors
CORUMiQ9HCM2
STRINGi9606.ENSP00000323194

Structurei

Secondary structure

11894
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi1499 – 1504Combined sources6
Beta strandi1515 – 1520Combined sources6
Helixi1525 – 1536Combined sources12
Turni1537 – 1539Combined sources3
Helixi1542 – 1544Combined sources3
Helixi1548 – 1550Combined sources3
Beta strandi1551 – 1556Combined sources6
Beta strandi1562 – 1565Combined sources4
Beta strandi1567 – 1569Combined sources3
Helixi1584 – 1587Combined sources4
Beta strandi1594 – 1599Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4E74X-ray1.58A1488-1603[»]
ProteinModelPortaliQ9HCM2
SMRiQ9HCM2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 507SemaPROSITE-ProRule annotationAdd BLAST484
Domaini509 – 559PSI 1Add BLAST51
Domaini655 – 702PSI 2Add BLAST48
Domaini803 – 856PSI 3Add BLAST54
Domaini858 – 952IPT/TIG 1Add BLAST95
Domaini954 – 1037IPT/TIG 2Add BLAST84
Domaini1040 – 1139IPT/TIG 3Add BLAST100
Domaini1142 – 1230IPT/TIG 4Add BLAST89

Sequence similaritiesi

Belongs to the plexin family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3610 Eukaryota
ENOG410XR88 LUCA
GeneTreeiENSGT00760000119048
HOGENOMiHOG000252970
HOVERGENiHBG105711
InParanoidiQ9HCM2
KOiK06820
OMAiHQSDLTE
OrthoDBiEOG091G00EK
PhylomeDBiQ9HCM2
TreeFamiTF312962

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR22625 PTHR22625, 1 hit
PfamiView protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 2 hits
PF01403 Sema, 1 hit
PF01833 TIG, 4 hits
SMARTiView protein in SMART
SM00429 IPT, 4 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit
SUPFAMiSSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 2 hits
SSF81296 SSF81296, 4 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HCM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKAMPWNWTC LLSHLLMVGM GSSTLLTRQP APLSQKQRSF VTFRGEPAEG
60 70 80 90 100
FNHLVVDERT GHIYLGAVNR IYKLSSDLKV LVTHETGPDE DNPKCYPPRI
110 120 130 140 150
VQTCNEPLTT TNNVNKMLLI DYKENRLIAC GSLYQGICKL LRLEDLFKLG
160 170 180 190 200
EPYHKKEHYL SGVNESGSVF GVIVSYSNLD DKLFIATAVD GKPEYFPTIS
210 220 230 240 250
SRKLTKNSEA DGMFAYVFHD EFVASMIKIP SDTFTIIPDF DIYYVYGFSS
260 270 280 290 300
GNFVYFLTLQ PEMVSPPGST TKEQVYTSKL VRLCKEDTAF NSYVEVPIGC
310 320 330 340 350
ERSGVEYRLL QAAYLSKAGA VLGRTLGVHP DDDLLFTVFS KGQKRKMKSL
360 370 380 390 400
DESALCIFIL KQINDRIKER LQSCYRGEGT LDLAWLKVKD IPCSSALLTI
410 420 430 440 450
DDNFCGLDMN APLGVSDMVR GIPVFTEDRD RMTSVIAYVY KNHSLAFVGT
460 470 480 490 500
KSGKLKKIRV DGPRGNALQY ETVQVVDPGP VLRDMAFSKD HEQLYIMSER
510 520 530 540 550
QLTRVPVESC GQYQSCGECL GSGDPHCGWC VLHNTCTRKE RCERSKEPRR
560 570 580 590 600
FASEMKQCVR LTVHPNNISV SQYNVLLVLE TYNVPELSAG VNCTFEDLSE
610 620 630 640 650
MDGLVVGNQI QCYSPAAKEV PRIITENGDH HVVQLQLKSK ETGMTFASTS
660 670 680 690 700
FVFYNCSVHN SCLSCVESPY RCHWCKYRHV CTHDPKTCSF QEGRVKLPED
710 720 730 740 750
CPQLLRVDKI LVPVEVIKPI TLKAKNLPQP QSGQRGYECI LNIQGSEQRV
760 770 780 790 800
PALRFNSSSV QCQNTSYSYE GMEINNLPVE LTVVWNGHFN IDNPAQNKVH
810 820 830 840 850
LYKCGAMRES CGLCLKADPD FACGWCQGPG QCTLRQHCPA QESQWLELSG
860 870 880 890 900
AKSKCTNPRI TEIIPVTGPR EGGTKVTIRG ENLGLEFRDI ASHVKVAGVE
910 920 930 940 950
CSPLVDGYIP AEQIVCEMGE AKPSQHAGFV EICVAVCRPE FMARSSQLYY
960 970 980 990 1000
FMTLTLSDLK PSRGPMSGGT QVTITGTNLN AGSNVVVMFG KQPCLFHRRS
1010 1020 1030 1040 1050
PSYIVCNTTS SDEVLEMKVS VQVDRAKIHQ DLVFQYVEDP TIVRIEPEWS
1060 1070 1080 1090 1100
IVSGNTPIAV WGTHLDLIQN PQIRAKHGGK EHINICEVLN ATEMTCQAPA
1110 1120 1130 1140 1150
LALGPDHQSD LTERPEEFGF ILDNVQSLLI LNKTNFTYYP NPVFEAFGPS
1160 1170 1180 1190 1200
GILELKPGTP IILKGKNLIP PVAGGNVKLN YTVLVGEKPC TVTVSDVQLL
1210 1220 1230 1240 1250
CESPNLIGRH KVMARVGGME YSPGMVYIAP DSPLSLPAIV SIAVAGGLLI
1260 1270 1280 1290 1300
IFIVAVLIAY KRKSRESDLT LKRLQMQMDN LESRVALECK EAFAELQTDI
1310 1320 1330 1340 1350
HELTSDLDGA GIPFLDYRTY TMRVLFPGIE DHPVLRDLEV PGYRQERVEK
1360 1370 1380 1390 1400
GLKLFAQLIN NKVFLLSFIR TLESQRSFSM RDRGNVASLI MTVLQSKLEY
1410 1420 1430 1440 1450
ATDVLKQLLA DLIDKNLESK NHPKLLLRRT ESVAEKMLTN WFTFLLYKFL
1460 1470 1480 1490 1500
KECAGEPLFS LFCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIDYKTL
1510 1520 1530 1540 1550
VLSCVSPDNA NSPEVPVKIL NCDTITQVKE KILDAIFKNV PCSHRPKAAD
1560 1570 1580 1590 1600
MDLEWRQGSG ARMILQDEDI TTKIENDWKR LNTLAHYQVP DGSVVALVSK
1610 1620 1630 1640 1650
QVTAYNAVNN STVSRTSASK YENMIRYTGS PDSLRSRTPM ITPDLESGVK
1660 1670 1680 1690 1700
MWHLVKNHEH GDQKEGDRGS KMVSEIYLTR LLATKGTLQK FVDDLFETIF
1710 1720 1730 1740 1750
STAHRGSALP LAIKYMFDFL DEQADKHGIH DPHVRHTWKS NCLPLRFWVN
1760 1770 1780 1790 1800
MIKNPQFVFD IHKNSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY
1810 1820 1830 1840 1850
AKDIPSYKNW VERYYSDIGK MPAISDQDMN AYLAEQSRMH MNEFNTMSAL
1860 1870 1880 1890
SEIFSYVGKY SEEILGPLDH DDQCGKQKLA YKLEQVITLM SLDS
Length:1,894
Mass (Da):212,455
Last modified:June 13, 2006 - v4
Checksum:i7B45C8929C5847DF
GO
Isoform 2 (identifier: Q9HCM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-492: IRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHE → MPGTSLCPTLELQTGPRSHRATVTLELLFSSCSSN
     493-1894: Missing.

Show »
Length:492
Mass (Da):55,034
Checksum:iEA48649E41364BCA
GO
Isoform 3 (identifier: Q9HCM2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-522: IRVDGPRGNA...YQSCGECLGS → SFGTGPQGGI...CFLNVPGNSS
     523-1894: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:522
Mass (Da):58,165
Checksum:iDF8322647088FE4B
GO
Isoform 4 (identifier: Q9HCM2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1550: Missing.

Show »
Length:344
Mass (Da):39,312
Checksum:i500F224FA6A400E8
GO

Sequence cautioni

The sequence AAQ89209 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1750N → D in CAD39161 (PubMed:17974005).Curated1
Sequence conflicti1804I → V in CAD39161 (PubMed:17974005).Curated1
Isoform 2 (identifier: Q9HCM2-2)
Sequence conflicti458M → V in BAC85615 (PubMed:14702039).Curated1
Sequence conflicti458M → V in AAQ89209 (PubMed:12975309).Curated1
Isoform 3 (identifier: Q9HCM2-3)
Sequence conflicti475E → A in AAH28744 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0193341 – 1550Missing in isoform 4. 1 PublicationAdd BLAST1550
Alternative sequenceiVSP_019330458 – 522IRVDG…ECLGS → SFGTGPQGGITQEWIGVEGD PPGANIASQEQMLCVYLQCS SHKAISDQRVQPLLCCFLNV PGNSS in isoform 3. 2 PublicationsAdd BLAST65
Alternative sequenceiVSP_019331458 – 492IRVDG…SKDHE → MPGTSLCPTLELQTGPRSHR ATVTLELLFSSCSSN in isoform 2. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_019332493 – 1894Missing in isoform 2. 2 PublicationsAdd BLAST1402
Alternative sequenceiVSP_019333523 – 1894Missing in isoform 3. 2 PublicationsAdd BLAST1372

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK095606 mRNA Translation: BAC04587.1
AK123428 mRNA Translation: BAC85615.1
AC009364 Genomic DNA No translation available.
AC009365 Genomic DNA No translation available.
AC009785 Genomic DNA No translation available.
AC011625 Genomic DNA No translation available.
AC018643 Genomic DNA No translation available.
AC026239 Genomic DNA No translation available.
CH236950 Genomic DNA Translation: EAL24076.1
CH471070 Genomic DNA Translation: EAW83793.1
BC028744 mRNA Translation: AAH28744.1
AY358850 mRNA Translation: AAQ89209.1 Different initiation.
AL137352 mRNA Translation: CAB70707.1
AL834504 mRNA Translation: CAD39161.3
AB046770 mRNA Translation: BAB13376.3
CCDSiCCDS43646.1 [Q9HCM2-1]
CCDS43647.1 [Q9HCM2-2]
CCDS5826.1 [Q9HCM2-3]
PIRiT46426
RefSeqiNP_001099013.1, NM_001105543.1 [Q9HCM2-2]
NP_065962.1, NM_020911.1 [Q9HCM2-1]
NP_861440.2, NM_181775.3 [Q9HCM2-3]
XP_005250743.1, XM_005250686.4 [Q9HCM2-1]
XP_006716234.1, XM_006716171.3 [Q9HCM2-1]
UniGeneiHs.511454

Genome annotation databases

EnsembliENST00000321063; ENSP00000323194; ENSG00000221866 [Q9HCM2-1]
ENST00000359827; ENSP00000352882; ENSG00000221866 [Q9HCM2-1]
ENST00000378539; ENSP00000367800; ENSG00000221866 [Q9HCM2-3]
ENST00000423507; ENSP00000392772; ENSG00000221866 [Q9HCM2-2]
GeneIDi91584
KEGGihsa:91584
UCSCiuc003vra.4 human [Q9HCM2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPLXA4_HUMAN
AccessioniPrimary (citable) accession number: Q9HCM2
Secondary accession number(s): A4D1N6
, E9PAM2, Q6UWC6, Q6ZW89, Q8N969, Q8ND00, Q8NEN3, Q9NTD4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: February 28, 2018
This is version 142 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health