SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HCM2

- PLXA4_HUMAN

UniProt

Q9HCM2 - PLXA4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Plexin-A4
Gene
PLXNA4, KIAA1550, PLXNA4A, PLXNA4B, UNQ2820/PRO34003
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm By similarity.

GO - Molecular functioni

  1. semaphorin receptor activity Source: Ensembl
Complete GO annotation...

GO - Biological processi

  1. anterior commissure morphogenesis Source: Ensembl
  2. axon guidance Source: Reactome
  3. chemorepulsion of branchiomotor axon Source: Ensembl
  4. facial nerve morphogenesis Source: Ensembl
  5. glossopharyngeal nerve morphogenesis Source: Ensembl
  6. postganglionic parasympathetic nervous system development Source: Ensembl
  7. regulation of axon extension involved in axon guidance Source: Ensembl
  8. regulation of negative chemotaxis Source: Ensembl
  9. semaphorin-plexin signaling pathway Source: BHF-UCL
  10. sympathetic nervous system development Source: Ensembl
  11. trigeminal nerve morphogenesis Source: Ensembl
  12. vagus nerve morphogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

ReactomeiREACT_19199. CRMPs in Sema3A signaling.
REACT_19200. Other semaphorin interactions.
REACT_19236. Sema3A PAK dependent Axon repulsion.
REACT_19279. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.

Names & Taxonomyi

Protein namesi
Recommended name:
Plexin-A4
Gene namesi
Name:PLXNA4
Synonyms:KIAA1550, PLXNA4A, PLXNA4B
ORF Names:UNQ2820/PRO34003
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:9102. PLXNA4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 12371214Extracellular Reviewed prediction
Add
BLAST
Transmembranei1238 – 125821Helical; Reviewed prediction
Add
BLAST
Topological domaini1259 – 1894636Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. intracellular Source: InterPro
  3. plasma membrane Source: Reactome
  4. semaphorin receptor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162399757.
PA33428.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323 Reviewed prediction
Add
BLAST
Chaini24 – 18941871Plexin-A4
PRO_0000240283Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi95 ↔ 104 By similarity
Disulfide bondi130 ↔ 138 By similarity
Disulfide bondi284 ↔ 405 By similarity
Disulfide bondi300 ↔ 356 By similarity
Disulfide bondi374 ↔ 393 By similarity
Disulfide bondi510 ↔ 527 By similarity
Disulfide bondi516 ↔ 558 By similarity
Disulfide bondi519 ↔ 536 By similarity
Disulfide bondi530 ↔ 542 By similarity
Disulfide bondi593 ↔ 612 By similarity
Glycosylationi655 – 6551N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1007 – 10071N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1132 – 11321N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1180 – 11801N-linked (GlcNAc...) Reviewed prediction
Modified residuei1350 – 13501N6-acetyllysine1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9HCM2.
PaxDbiQ9HCM2.
PRIDEiQ9HCM2.

PTM databases

PhosphoSiteiQ9HCM2.

Expressioni

Gene expression databases

ArrayExpressiQ9HCM2.
BgeeiQ9HCM2.
CleanExiHS_PLXNA4.
GenevestigatoriQ9HCM2.

Organism-specific databases

HPAiHPA029919.

Interactioni

Subunit structurei

Interacts with NRP1 and NRP2 By similarity.

Protein-protein interaction databases

STRINGi9606.ENSP00000323194.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1499 – 15046
Beta strandi1515 – 15206
Helixi1525 – 153612
Turni1537 – 15393
Helixi1542 – 15443
Helixi1548 – 15503
Beta strandi1551 – 15566
Beta strandi1562 – 15654
Beta strandi1567 – 15693
Helixi1584 – 15874
Beta strandi1594 – 15996

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4E74X-ray1.58A1488-1603[»]
ProteinModelPortaliQ9HCM2.
SMRiQ9HCM2. Positions 40-657, 735-1039, 1273-1890.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 507484Sema
Add
BLAST
Domaini509 – 55951PSI 1
Add
BLAST
Domaini655 – 70248PSI 2
Add
BLAST
Domaini803 – 85654PSI 3
Add
BLAST
Domaini858 – 95295IPT/TIG 1
Add
BLAST
Domaini954 – 103784IPT/TIG 2
Add
BLAST
Domaini1040 – 1139100IPT/TIG 3
Add
BLAST
Domaini1142 – 123089IPT/TIG 4
Add
BLAST

Sequence similaritiesi

Belongs to the plexin family.
Contains 4 IPT/TIG domains.
Contains 3 PSI domains.
Contains 1 Sema domain.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG254546.
HOGENOMiHOG000252970.
HOVERGENiHBG105711.
InParanoidiQ9HCM2.
OMAiEQMLCVY.
OrthoDBiEOG7Q8CM9.
PhylomeDBiQ9HCM2.
TreeFamiTF312962.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
2.60.40.10. 4 hits.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PfamiPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 3 hits.
PF01403. Sema. 1 hit.
PF01833. TIG. 4 hits.
[Graphical view]
SMARTiSM00429. IPT. 4 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMiSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 2 hits.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 4 hits.
PROSITEiPS51004. SEMA. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HCM2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKAMPWNWTC LLSHLLMVGM GSSTLLTRQP APLSQKQRSF VTFRGEPAEG     50
FNHLVVDERT GHIYLGAVNR IYKLSSDLKV LVTHETGPDE DNPKCYPPRI 100
VQTCNEPLTT TNNVNKMLLI DYKENRLIAC GSLYQGICKL LRLEDLFKLG 150
EPYHKKEHYL SGVNESGSVF GVIVSYSNLD DKLFIATAVD GKPEYFPTIS 200
SRKLTKNSEA DGMFAYVFHD EFVASMIKIP SDTFTIIPDF DIYYVYGFSS 250
GNFVYFLTLQ PEMVSPPGST TKEQVYTSKL VRLCKEDTAF NSYVEVPIGC 300
ERSGVEYRLL QAAYLSKAGA VLGRTLGVHP DDDLLFTVFS KGQKRKMKSL 350
DESALCIFIL KQINDRIKER LQSCYRGEGT LDLAWLKVKD IPCSSALLTI 400
DDNFCGLDMN APLGVSDMVR GIPVFTEDRD RMTSVIAYVY KNHSLAFVGT 450
KSGKLKKIRV DGPRGNALQY ETVQVVDPGP VLRDMAFSKD HEQLYIMSER 500
QLTRVPVESC GQYQSCGECL GSGDPHCGWC VLHNTCTRKE RCERSKEPRR 550
FASEMKQCVR LTVHPNNISV SQYNVLLVLE TYNVPELSAG VNCTFEDLSE 600
MDGLVVGNQI QCYSPAAKEV PRIITENGDH HVVQLQLKSK ETGMTFASTS 650
FVFYNCSVHN SCLSCVESPY RCHWCKYRHV CTHDPKTCSF QEGRVKLPED 700
CPQLLRVDKI LVPVEVIKPI TLKAKNLPQP QSGQRGYECI LNIQGSEQRV 750
PALRFNSSSV QCQNTSYSYE GMEINNLPVE LTVVWNGHFN IDNPAQNKVH 800
LYKCGAMRES CGLCLKADPD FACGWCQGPG QCTLRQHCPA QESQWLELSG 850
AKSKCTNPRI TEIIPVTGPR EGGTKVTIRG ENLGLEFRDI ASHVKVAGVE 900
CSPLVDGYIP AEQIVCEMGE AKPSQHAGFV EICVAVCRPE FMARSSQLYY 950
FMTLTLSDLK PSRGPMSGGT QVTITGTNLN AGSNVVVMFG KQPCLFHRRS 1000
PSYIVCNTTS SDEVLEMKVS VQVDRAKIHQ DLVFQYVEDP TIVRIEPEWS 1050
IVSGNTPIAV WGTHLDLIQN PQIRAKHGGK EHINICEVLN ATEMTCQAPA 1100
LALGPDHQSD LTERPEEFGF ILDNVQSLLI LNKTNFTYYP NPVFEAFGPS 1150
GILELKPGTP IILKGKNLIP PVAGGNVKLN YTVLVGEKPC TVTVSDVQLL 1200
CESPNLIGRH KVMARVGGME YSPGMVYIAP DSPLSLPAIV SIAVAGGLLI 1250
IFIVAVLIAY KRKSRESDLT LKRLQMQMDN LESRVALECK EAFAELQTDI 1300
HELTSDLDGA GIPFLDYRTY TMRVLFPGIE DHPVLRDLEV PGYRQERVEK 1350
GLKLFAQLIN NKVFLLSFIR TLESQRSFSM RDRGNVASLI MTVLQSKLEY 1400
ATDVLKQLLA DLIDKNLESK NHPKLLLRRT ESVAEKMLTN WFTFLLYKFL 1450
KECAGEPLFS LFCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIDYKTL 1500
VLSCVSPDNA NSPEVPVKIL NCDTITQVKE KILDAIFKNV PCSHRPKAAD 1550
MDLEWRQGSG ARMILQDEDI TTKIENDWKR LNTLAHYQVP DGSVVALVSK 1600
QVTAYNAVNN STVSRTSASK YENMIRYTGS PDSLRSRTPM ITPDLESGVK 1650
MWHLVKNHEH GDQKEGDRGS KMVSEIYLTR LLATKGTLQK FVDDLFETIF 1700
STAHRGSALP LAIKYMFDFL DEQADKHGIH DPHVRHTWKS NCLPLRFWVN 1750
MIKNPQFVFD IHKNSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY 1800
AKDIPSYKNW VERYYSDIGK MPAISDQDMN AYLAEQSRMH MNEFNTMSAL 1850
SEIFSYVGKY SEEILGPLDH DDQCGKQKLA YKLEQVITLM SLDS 1894
Length:1,894
Mass (Da):212,455
Last modified:June 13, 2006 - v4
Checksum:i7B45C8929C5847DF
GO
Isoform 2 (identifier: Q9HCM2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-492: IRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHE → MPGTSLCPTLELQTGPRSHRATVTLELLFSSCSSN
     493-1894: Missing.

Show »
Length:492
Mass (Da):55,034
Checksum:iEA48649E41364BCA
GO
Isoform 3 (identifier: Q9HCM2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-522: IRVDGPRGNA...YQSCGECLGS → SFGTGPQGGI...CFLNVPGNSS
     523-1894: Missing.

Note: No experimental confirmation available.

Show »
Length:522
Mass (Da):58,165
Checksum:iDF8322647088FE4B
GO
Isoform 4 (identifier: Q9HCM2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1550: Missing.

Show »
Length:344
Mass (Da):39,312
Checksum:i500F224FA6A400E8
GO

Sequence cautioni

The sequence AAQ89209.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 15501550Missing in isoform 4.
VSP_019334Add
BLAST
Alternative sequencei458 – 52265IRVDG…ECLGS → SFGTGPQGGITQEWIGVEGD PPGANIASQEQMLCVYLQCS SHKAISDQRVQPLLCCFLNV PGNSS in isoform 3.
VSP_019330Add
BLAST
Alternative sequencei458 – 49235IRVDG…SKDHE → MPGTSLCPTLELQTGPRSHR ATVTLELLFSSCSSN in isoform 2.
VSP_019331Add
BLAST
Alternative sequencei493 – 18941402Missing in isoform 2.
VSP_019332Add
BLAST
Alternative sequencei523 – 18941372Missing in isoform 3.
VSP_019333Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1750 – 17501N → D in CAD39161. 1 Publication
Sequence conflicti1804 – 18041I → V in CAD39161. 1 Publication
Isoform 2 (identifier: Q9HCM2-2)
Sequence conflicti458 – 4581M → V in BAC85615. 1 Publication
Sequence conflicti458 – 4581M → V in AAQ89209. 1 Publication
Isoform 3 (identifier: Q9HCM2-3)
Sequence conflicti475 – 4751E → A in AAH28744. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK095606 mRNA. Translation: BAC04587.1.
AK123428 mRNA. Translation: BAC85615.1.
AC009364 Genomic DNA. No translation available.
AC009365 Genomic DNA. No translation available.
AC009785 Genomic DNA. No translation available.
AC011625 Genomic DNA. No translation available.
AC018643 Genomic DNA. No translation available.
AC026239 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24076.1.
CH471070 Genomic DNA. Translation: EAW83793.1.
BC028744 mRNA. Translation: AAH28744.1.
AY358850 mRNA. Translation: AAQ89209.1. Different initiation.
AL137352 mRNA. Translation: CAB70707.1.
AL834504 mRNA. Translation: CAD39161.3.
AB046770 mRNA. Translation: BAB13376.3.
CCDSiCCDS43646.1. [Q9HCM2-1]
CCDS43647.1. [Q9HCM2-2]
CCDS5826.1. [Q9HCM2-3]
PIRiT46426.
RefSeqiNP_001099013.1. NM_001105543.1. [Q9HCM2-2]
NP_065962.1. NM_020911.1. [Q9HCM2-1]
NP_861440.2. NM_181775.3. [Q9HCM2-3]
XP_005250743.1. XM_005250686.2. [Q9HCM2-1]
XP_005250744.1. XM_005250687.1. [Q9HCM2-3]
XP_006716234.1. XM_006716171.1. [Q9HCM2-1]
UniGeneiHs.511454.

Genome annotation databases

EnsembliENST00000321063; ENSP00000323194; ENSG00000221866. [Q9HCM2-1]
ENST00000359827; ENSP00000352882; ENSG00000221866. [Q9HCM2-1]
ENST00000378539; ENSP00000367800; ENSG00000221866.
ENST00000423507; ENSP00000392772; ENSG00000221866. [Q9HCM2-2]
GeneIDi91584.
KEGGihsa:91584.
UCSCiuc003vqz.4. human. [Q9HCM2-4]
uc003vra.4. human. [Q9HCM2-1]
uc003vrb.3. human.
uc003vrc.2. human. [Q9HCM2-2]

Polymorphism databases

DMDMi108860890.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK095606 mRNA. Translation: BAC04587.1 .
AK123428 mRNA. Translation: BAC85615.1 .
AC009364 Genomic DNA. No translation available.
AC009365 Genomic DNA. No translation available.
AC009785 Genomic DNA. No translation available.
AC011625 Genomic DNA. No translation available.
AC018643 Genomic DNA. No translation available.
AC026239 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24076.1 .
CH471070 Genomic DNA. Translation: EAW83793.1 .
BC028744 mRNA. Translation: AAH28744.1 .
AY358850 mRNA. Translation: AAQ89209.1 . Different initiation.
AL137352 mRNA. Translation: CAB70707.1 .
AL834504 mRNA. Translation: CAD39161.3 .
AB046770 mRNA. Translation: BAB13376.3 .
CCDSi CCDS43646.1. [Q9HCM2-1 ]
CCDS43647.1. [Q9HCM2-2 ]
CCDS5826.1. [Q9HCM2-3 ]
PIRi T46426.
RefSeqi NP_001099013.1. NM_001105543.1. [Q9HCM2-2 ]
NP_065962.1. NM_020911.1. [Q9HCM2-1 ]
NP_861440.2. NM_181775.3. [Q9HCM2-3 ]
XP_005250743.1. XM_005250686.2. [Q9HCM2-1 ]
XP_005250744.1. XM_005250687.1. [Q9HCM2-3 ]
XP_006716234.1. XM_006716171.1. [Q9HCM2-1 ]
UniGenei Hs.511454.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4E74 X-ray 1.58 A 1488-1603 [» ]
ProteinModelPortali Q9HCM2.
SMRi Q9HCM2. Positions 40-657, 735-1039, 1273-1890.
ModBasei Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000323194.

PTM databases

PhosphoSitei Q9HCM2.

Polymorphism databases

DMDMi 108860890.

Proteomic databases

MaxQBi Q9HCM2.
PaxDbi Q9HCM2.
PRIDEi Q9HCM2.

Protocols and materials databases

DNASUi 91584.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000321063 ; ENSP00000323194 ; ENSG00000221866 . [Q9HCM2-1 ]
ENST00000359827 ; ENSP00000352882 ; ENSG00000221866 . [Q9HCM2-1 ]
ENST00000378539 ; ENSP00000367800 ; ENSG00000221866 .
ENST00000423507 ; ENSP00000392772 ; ENSG00000221866 . [Q9HCM2-2 ]
GeneIDi 91584.
KEGGi hsa:91584.
UCSCi uc003vqz.4. human. [Q9HCM2-4 ]
uc003vra.4. human. [Q9HCM2-1 ]
uc003vrb.3. human.
uc003vrc.2. human. [Q9HCM2-2 ]

Organism-specific databases

CTDi 91584.
GeneCardsi GC07M131720.
H-InvDB HIX0007090.
HGNCi HGNC:9102. PLXNA4.
HPAi HPA029919.
MIMi 604280. gene.
neXtProti NX_Q9HCM2.
PharmGKBi PA162399757.
PA33428.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG254546.
HOGENOMi HOG000252970.
HOVERGENi HBG105711.
InParanoidi Q9HCM2.
OMAi EQMLCVY.
OrthoDBi EOG7Q8CM9.
PhylomeDBi Q9HCM2.
TreeFami TF312962.

Enzyme and pathway databases

Reactomei REACT_19199. CRMPs in Sema3A signaling.
REACT_19200. Other semaphorin interactions.
REACT_19236. Sema3A PAK dependent Axon repulsion.
REACT_19279. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.

Miscellaneous databases

ChiTaRSi PLXNA4. human.
GeneWikii PLXNA4A.
GenomeRNAii 91584.
NextBioi 77311.
PROi Q9HCM2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9HCM2.
Bgeei Q9HCM2.
CleanExi HS_PLXNA4.
Genevestigatori Q9HCM2.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
2.60.40.10. 4 hits.
InterProi IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view ]
Pfami PF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 3 hits.
PF01403. Sema. 1 hit.
PF01833. TIG. 4 hits.
[Graphical view ]
SMARTi SM00429. IPT. 4 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view ]
SUPFAMi SSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 2 hits.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 4 hits.
PROSITEi PS51004. SEMA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Brain and Hippocampus.
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-1894 (ISOFORM 2).
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 206-1894 (ISOFORM 3), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Kidney and Testis.
  8. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 433-1894 (ISOFORM 1).
    Tissue: Brain.
  9. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  10. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1350, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPLXA4_HUMAN
AccessioniPrimary (citable) accession number: Q9HCM2
Secondary accession number(s): A4D1N6
, E9PAM2, Q6UWC6, Q6ZW89, Q8N969, Q8ND00, Q8NEN3, Q9NTD4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: September 3, 2014
This is version 110 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi