SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HCK4

- ROBO2_HUMAN

UniProt

Q9HCK4 - ROBO2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Roundabout homolog 2
Gene
ROBO2, KIAA1568
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development.

GO - Molecular functioni

  1. axon guidance receptor activity Source: UniProtKB
  2. identical protein binding Source: UniProtKB
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. apoptotic process involved in luteolysis Source: UniProtKB
  2. axon guidance Source: UniProtKB
  3. axon midline choice point recognition Source: UniProtKB
  4. brain development Source: UniProtKB
  5. cellular response to hormone stimulus Source: UniProtKB
  6. central nervous system development Source: UniProtKB
  7. homophilic cell adhesion Source: UniProtKB
  8. metanephros development Source: UniProtKB
  9. negative regulation of negative chemotaxis Source: UniProtKB
  10. negative regulation of synapse assembly Source: UniProtKB
  11. olfactory bulb interneuron development Source: UniProtKB
  12. positive regulation of axonogenesis Source: UniProtKB
  13. retinal ganglion cell axon guidance Source: UniProtKB
  14. ureteric bud development Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Chemotaxis, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.

Names & Taxonomyi

Protein namesi
Recommended name:
Roundabout homolog 2
Gene namesi
Name:ROBO2
Synonyms:KIAA1568
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:10250. ROBO2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 859838Extracellular Reviewed prediction
Add
BLAST
Transmembranei860 – 88021Helical; Reviewed prediction
Add
BLAST
Topological domaini881 – 1378498Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. axolemma Source: UniProtKB
  2. cell surface Source: UniProtKB
  3. extracellular vesicular exosome Source: UniProt
  4. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Vesicoureteral reflux 2 (VUR2) [MIM:610878]: A disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti945 – 9451I → T in VUR2. 1 Publication
VAR_032960
Natural varianti1236 – 12361A → T in VUR2. 1 Publication
VAR_032961
A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro.

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi610878. phenotype.
Orphaneti289365. Familial vesicoureteral reflux.
PharmGKBiPA34621.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121 Reviewed prediction
Add
BLAST
Chaini22 – 13781357Roundabout homolog 2
PRO_0000031036Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi52 ↔ 110 Reviewed prediction
Glycosylationi123 – 1231N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi154 ↔ 203 Reviewed prediction
Disulfide bondi246 ↔ 293 Reviewed prediction
Disulfide bondi335 ↔ 391 Reviewed prediction
Glycosylationi426 – 4261N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi439 ↔ 488 Reviewed prediction
Glycosylationi752 – 7521N-linked (GlcNAc...) Reviewed prediction
Glycosylationi782 – 7821N-linked (GlcNAc...) Reviewed prediction
Glycosylationi789 – 7891N-linked (GlcNAc...) Reviewed prediction
Glycosylationi845 – 8451N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9HCK4.
PRIDEiQ9HCK4.

PTM databases

PhosphoSiteiQ9HCK4.

Expressioni

Gene expression databases

ArrayExpressiQ9HCK4.
BgeeiQ9HCK4.
CleanExiHS_ROBO2.
GenevestigatoriQ9HCK4.

Organism-specific databases

HPAiHPA013371.

Interactioni

Subunit structurei

Interacts with SLIT2.2 Publications

Protein-protein interaction databases

BioGridi112019. 13 interactions.
IntActiQ9HCK4. 17 interactions.
MINTiMINT-1418118.
STRINGi9606.ENSP00000417164.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi419 – 4224
Beta strandi427 – 43711
Beta strandi440 – 4423
Beta strandi448 – 46114
Beta strandi473 – 4775
Turni480 – 4823
Beta strandi485 – 4917
Beta strandi501 – 5077
Beta strandi529 – 5335
Beta strandi538 – 5414
Beta strandi548 – 5503
Beta strandi554 – 5618
Turni562 – 5643
Beta strandi565 – 57511
Beta strandi577 – 5826
Beta strandi590 – 59910
Beta strandi602 – 6065
Helixi630 – 6367
Beta strandi639 – 6413
Beta strandi651 – 66010
Beta strandi667 – 67913
Turni680 – 6823
Beta strandi685 – 6884
Beta strandi696 – 7016
Beta strandi704 – 71815
Beta strandi727 – 7315

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1UEMNMR-A514-617[»]
1UJTNMR-A628-734[»]
2EDJNMR-A417-509[»]
ProteinModelPortaliQ9HCK4.
SMRiQ9HCK4. Positions 24-831.

Miscellaneous databases

EvolutionaryTraceiQ9HCK4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 12797Ig-like C2-type 1
Add
BLAST
Domaini133 – 22088Ig-like C2-type 2
Add
BLAST
Domaini225 – 30985Ig-like C2-type 3
Add
BLAST
Domaini314 – 40996Ig-like C2-type 4
Add
BLAST
Domaini418 – 50487Ig-like C2-type 5
Add
BLAST
Domaini524 – 61895Fibronectin type-III 1
Add
BLAST
Domaini637 – 73599Fibronectin type-III 2
Add
BLAST
Domaini739 – 83698Fibronectin type-III 3
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG238978.
HOGENOMiHOG000010267.
HOVERGENiHBG073476.
KOiK06754.
PhylomeDBiQ9HCK4.
TreeFamiTF351053.

Family and domain databases

Gene3Di2.60.40.10. 9 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF00041. fn3. 3 hits.
PF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00060. FN3. 3 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 3 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HCK4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSLLMFTQLL LCGFLYVRVD GSRLRQEDFP PRIVEHPSDV IVSKGEPTTL     50
NCKAEGRPTP TIEWYKDGER VETDKDDPRS HRMLLPSGSL FFLRIVHGRR 100
SKPDEGSYVC VARNYLGEAV SRNASLEVAL LRDDFRQNPT DVVVAAGEPA 150
ILECQPPRGH PEPTIYWKKD KVRIDDKEER ISIRGGKLMI SNTRKSDAGM 200
YTCVGTNMVG ERDSDPAELT VFERPTFLRR PINQVVLEEE AVEFRCQVQG 250
DPQPTVRWKK DDADLPRGRY DIKDDYTLRI KKTMSTDEGT YMCIAENRVG 300
KMEASATLTV RAPPQFVVRP RDQIVAQGRT VTFPCETKGN PQPAVFWQKE 350
GSQNLLFPNQ PQQPNSRCSV SPTGDLTITN IQRSDAGYYI CQALTVAGSI 400
LAKAQLEVTD VLTDRPPPII LQGPANQTLA VDGTALLKCK ATGDPLPVIS 450
WLKEGFTFPG RDPRATIQEQ GTLQIKNLRI SDTGTYTCVA TSSSGETSWS 500
AVLDVTESGA TISKNYDLSD LPGPPSKPQV TDVTKNSVTL SWQPGTPGTL 550
PASAYIIEAF SQSVSNSWQT VANHVKTTLY TVRGLRPNTI YLFMVRAINP 600
QGLSDPSPMS DPVRTQDISP PAQGVDHRQV QKELGDVLVR LHNPVVLTPT 650
TVQVTWTVDR QPQFIQGYRV MYRQTSGLQA TSSWQNLDAK VPTERSAVLV 700
NLKKGVTYEI KVRPYFNEFQ GMDSESKTVR TTEEAPSAPP QSVTVLTVGS 750
YNSTSISVSW DPPPPDHQNG IIQEYKIWCL GNETRFHINK TVDAAIRSVI 800
IGGLFPGIQY RVEVAASTSA GVGVKSEPQP IIIGRRNEVV ITENNNSITE 850
QITDVVKQPA FIAGIGGACW VILMGFSIWL YWRRKKRKGL SNYAVTFQRG 900
DGGLMSNGSR PGLLNAGDPS YPWLADSWPA TSLPVNNSNS GPNEIGNFGR 950
GDVLPPVPGQ GDKTATMLSD GAIYSSIDFT TKTSYNSSSQ ITQATPYATT 1000
QILHSNSIHE LAVDLPDPQW KSSIQQKTDL MGFGYSLPDQ NKGNNGGKGG 1050
KKKKNKNSSK PQKNNGSTWA NVPLPPPPVQ PLPGTELEHY AVEQQENGYD 1100
SDSWCPPLPV QTYLHQGLED ELEEDDDRVP TPPVRGVASS PAISFGQQST 1150
ATLTPSPREE MQPMLQAHLD ELTRAYQFDI AKQTWHIQSN NQPPQPPVPP 1200
LGYVSGALIS DLETDVADDD ADDEEEALEI PRPLRALDQT PGSSMDNLDS 1250
SVTGKAFTSS QRPRPTSPFS TDSNTSAALS QSQRPRPTKK HKGGRMDQQP 1300
ALPHRREGMT DEEALVPYSK PSFPSPGGHS SSGTASSKGS TGPRKTEVLR 1350
AGHQRNASDL LDIGYMGSNS QGQFTGEL 1378
Length:1,378
Mass (Da):151,200
Last modified:June 21, 2004 - v2
Checksum:i60F7CE3E53622B50
GO
Isoform 2 (identifier: Q9HCK4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1186-1378: Missing.

Show »
Length:1,185
Mass (Da):130,669
Checksum:i5A6ABDBD4A2111A3
GO
Isoform 3 (identifier: Q9HCK4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MSLLMFTQLLLCGFLYVRVD → MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQ

Note: No experimental confirmation available.

Show »
Length:1,394
Mass (Da):153,120
Checksum:i860FFDE4892D51B7
GO

Sequence cautioni

The sequence AAC39576.1 differs from that shown. Reason: Frameshift at position 601.
The sequence BAB13394.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti945 – 9451I → T in VUR2. 1 Publication
VAR_032960
Natural varianti1236 – 12361A → T in VUR2. 1 Publication
VAR_032961

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2020MSLLM…YVRVD → MARRHERVTRRMWTWAPGLL MMTVVFWGHQGNGQGQ in isoform 3.
VSP_043394Add
BLAST
Alternative sequencei1186 – 1378193Missing in isoform 2.
VSP_010647Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti497 – 4971T → A1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ533874 mRNA. Translation: ABF83431.1.
AB046788 mRNA. Translation: BAB13394.1. Different initiation.
DQ533873 mRNA. Translation: ABF83430.1.
AC016942 Genomic DNA. No translation available.
AC016952 Genomic DNA. No translation available.
AC024256 Genomic DNA. No translation available.
AC026877 Genomic DNA. No translation available.
AC067717 Genomic DNA. No translation available.
AC117514 Genomic DNA. No translation available.
AC117515 Genomic DNA. No translation available.
AC117516 Genomic DNA. No translation available.
AC126467 Genomic DNA. No translation available.
AC130004 Genomic DNA. No translation available.
AC131005 Genomic DNA. No translation available.
AC131154 Genomic DNA. No translation available.
AC133040 Genomic DNA. No translation available.
AC138974 Genomic DNA. No translation available.
BC064374 mRNA. Translation: AAH64374.1.
BC146772 mRNA. Translation: AAI46773.1.
AF040991 mRNA. Translation: AAC39576.1. Frameshift.
CCDSiCCDS43109.1. [Q9HCK4-1]
CCDS54609.1. [Q9HCK4-3]
RefSeqiNP_001122401.1. NM_001128929.3. [Q9HCK4-3]
NP_001276968.1. NM_001290039.1.
NP_001276969.1. NM_001290040.1.
NP_001276994.1. NM_001290065.1.
NP_002933.1. NM_002942.4. [Q9HCK4-1]
UniGeneiHs.13305.

Genome annotation databases

EnsembliENST00000461745; ENSP00000417164; ENSG00000185008. [Q9HCK4-1]
ENST00000487694; ENSP00000417335; ENSG00000185008. [Q9HCK4-3]
GeneIDi6092.
KEGGihsa:6092.
UCSCiuc003dpy.4. human. [Q9HCK4-1]
uc021xat.1. human. [Q9HCK4-3]

Polymorphism databases

DMDMi49036496.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ533874 mRNA. Translation: ABF83431.1 .
AB046788 mRNA. Translation: BAB13394.1 . Different initiation.
DQ533873 mRNA. Translation: ABF83430.1 .
AC016942 Genomic DNA. No translation available.
AC016952 Genomic DNA. No translation available.
AC024256 Genomic DNA. No translation available.
AC026877 Genomic DNA. No translation available.
AC067717 Genomic DNA. No translation available.
AC117514 Genomic DNA. No translation available.
AC117515 Genomic DNA. No translation available.
AC117516 Genomic DNA. No translation available.
AC126467 Genomic DNA. No translation available.
AC130004 Genomic DNA. No translation available.
AC131005 Genomic DNA. No translation available.
AC131154 Genomic DNA. No translation available.
AC133040 Genomic DNA. No translation available.
AC138974 Genomic DNA. No translation available.
BC064374 mRNA. Translation: AAH64374.1 .
BC146772 mRNA. Translation: AAI46773.1 .
AF040991 mRNA. Translation: AAC39576.1 . Frameshift.
CCDSi CCDS43109.1. [Q9HCK4-1 ]
CCDS54609.1. [Q9HCK4-3 ]
RefSeqi NP_001122401.1. NM_001128929.3. [Q9HCK4-3 ]
NP_001276968.1. NM_001290039.1.
NP_001276969.1. NM_001290040.1.
NP_001276994.1. NM_001290065.1.
NP_002933.1. NM_002942.4. [Q9HCK4-1 ]
UniGenei Hs.13305.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1UEM NMR - A 514-617 [» ]
1UJT NMR - A 628-734 [» ]
2EDJ NMR - A 417-509 [» ]
ProteinModelPortali Q9HCK4.
SMRi Q9HCK4. Positions 24-831.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112019. 13 interactions.
IntActi Q9HCK4. 17 interactions.
MINTi MINT-1418118.
STRINGi 9606.ENSP00000417164.

PTM databases

PhosphoSitei Q9HCK4.

Polymorphism databases

DMDMi 49036496.

Proteomic databases

PaxDbi Q9HCK4.
PRIDEi Q9HCK4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000461745 ; ENSP00000417164 ; ENSG00000185008 . [Q9HCK4-1 ]
ENST00000487694 ; ENSP00000417335 ; ENSG00000185008 . [Q9HCK4-3 ]
GeneIDi 6092.
KEGGi hsa:6092.
UCSCi uc003dpy.4. human. [Q9HCK4-1 ]
uc021xat.1. human. [Q9HCK4-3 ]

Organism-specific databases

CTDi 6092.
GeneCardsi GC03P075955.
HGNCi HGNC:10250. ROBO2.
HPAi HPA013371.
MIMi 602431. gene.
610878. phenotype.
neXtProti NX_Q9HCK4.
Orphaneti 289365. Familial vesicoureteral reflux.
PharmGKBi PA34621.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG238978.
HOGENOMi HOG000010267.
HOVERGENi HBG073476.
KOi K06754.
PhylomeDBi Q9HCK4.
TreeFami TF351053.

Enzyme and pathway databases

Reactomei REACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.

Miscellaneous databases

ChiTaRSi ROBO2. human.
EvolutionaryTracei Q9HCK4.
GeneWikii ROBO2.
GenomeRNAii 6092.
NextBioi 23691.
PROi Q9HCK4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9HCK4.
Bgeei Q9HCK4.
CleanExi HS_ROBO2.
Genevestigatori Q9HCK4.

Family and domain databases

Gene3Di 2.60.40.10. 9 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
[Graphical view ]
Pfami PF00041. fn3. 3 hits.
PF07679. I-set. 5 hits.
[Graphical view ]
SMARTi SM00060. FN3. 3 hits.
SM00408. IGc2. 5 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
PROSITEi PS50853. FN3. 3 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and differential expression of two isoforms of the ROBO2/Robo2 axon guidance receptor gene in humans and mice."
    Yue Y., Grossmann B., Galetzka D., Zechner U., Haaf T.
    Genomics 88:772-778(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
  2. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. Yue Y., Grossmann B., Galetzka D., Zechner U., Haaf T.
    Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 845-1378 (ISOFORM 2).
    Tissue: Ovary.
  6. "Roundabout controls axon crossing of the CNS midline and defines a novel subfamily of evolutionarily conserved guidance receptors."
    Kidd T., Brose K., Mitchell K.J., Fetter R.D., Tessier-Lavigne M., Goodman C.S., Tear G.
    Cell 92:205-215(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 323-607.
  7. "Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance."
    Brose K., Bland K.S., Wang K.H., Arnott D., Henzel W., Goodman C.S., Tessier-Lavigne M., Kidd T.
    Cell 96:795-806(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SLIT2.
  8. "Diversity and specificity of actions of Slit2 proteolytic fragments in axon guidance."
    Nguyen-Ba-Charvet K.T., Brose K., Ma L., Wang K.H., Marillat V., Sotelo C., Tessier-Lavigne M., Chedotal A.
    J. Neurosci. 21:4281-4289(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SLIT2.
  9. "Solution structure of the fifth Ig-like domain and of first and second fibronectin type III domain from human roundabout homolog 2."
    RIKEN structural genomics initiative (RSGI)
    Submitted (AUG-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 417-734.
  10. Cited for: VARIANTS VUR2 THR-945 AND THR-1236, CHROMOSOMAL TRANSLOCATION WITH PCDH11Y.

Entry informationi

Entry nameiROBO2_HUMAN
AccessioniPrimary (citable) accession number: Q9HCK4
Secondary accession number(s): O43608, Q19AB4, Q19AB5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: September 3, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi