Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HCK4

- ROBO2_HUMAN

UniProt

Q9HCK4 - ROBO2_HUMAN

Protein

Roundabout homolog 2

Gene

ROBO2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 2 (21 Jun 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development.

    GO - Molecular functioni

    1. axon guidance receptor activity Source: UniProtKB
    2. identical protein binding Source: UniProtKB
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. apoptotic process involved in luteolysis Source: UniProtKB
    2. axon guidance Source: UniProtKB
    3. axon midline choice point recognition Source: UniProtKB
    4. brain development Source: UniProtKB
    5. cellular response to hormone stimulus Source: UniProtKB
    6. central nervous system development Source: UniProtKB
    7. homophilic cell adhesion Source: UniProtKB
    8. metanephros development Source: UniProtKB
    9. negative regulation of negative chemotaxis Source: UniProtKB
    10. negative regulation of synapse assembly Source: UniProtKB
    11. olfactory bulb interneuron development Source: UniProtKB
    12. positive regulation of axonogenesis Source: UniProtKB
    13. retinal ganglion cell axon guidance Source: UniProtKB
    14. ureteric bud development Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Chemotaxis, Differentiation, Neurogenesis

    Enzyme and pathway databases

    ReactomeiREACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Roundabout homolog 2
    Gene namesi
    Name:ROBO2
    Synonyms:KIAA1568
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:10250. ROBO2.

    Subcellular locationi

    GO - Cellular componenti

    1. axolemma Source: UniProtKB
    2. cell surface Source: UniProtKB
    3. extracellular vesicular exosome Source: UniProt
    4. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Vesicoureteral reflux 2 (VUR2) [MIM:610878]: A disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti945 – 9451I → T in VUR2. 1 Publication
    VAR_032960
    Natural varianti1236 – 12361A → T in VUR2. 1 Publication
    VAR_032961
    A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro.

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi610878. phenotype.
    Orphaneti289365. Familial vesicoureteral reflux.
    PharmGKBiPA34621.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Sequence AnalysisAdd
    BLAST
    Chaini22 – 13781357Roundabout homolog 2PRO_0000031036Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi52 ↔ 110PROSITE-ProRule annotation
    Glycosylationi123 – 1231N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi154 ↔ 203PROSITE-ProRule annotation
    Disulfide bondi246 ↔ 293PROSITE-ProRule annotation
    Disulfide bondi335 ↔ 391PROSITE-ProRule annotation
    Glycosylationi426 – 4261N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi439 ↔ 488PROSITE-ProRule annotation
    Glycosylationi752 – 7521N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi782 – 7821N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi789 – 7891N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi845 – 8451N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9HCK4.
    PRIDEiQ9HCK4.

    PTM databases

    PhosphoSiteiQ9HCK4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9HCK4.
    BgeeiQ9HCK4.
    CleanExiHS_ROBO2.
    GenevestigatoriQ9HCK4.

    Organism-specific databases

    HPAiHPA013371.

    Interactioni

    Subunit structurei

    Interacts with SLIT2.2 Publications

    Protein-protein interaction databases

    BioGridi112019. 13 interactions.
    IntActiQ9HCK4. 17 interactions.
    MINTiMINT-1418118.
    STRINGi9606.ENSP00000417164.

    Structurei

    Secondary structure

    1
    1378
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi419 – 4224
    Beta strandi427 – 43711
    Beta strandi440 – 4423
    Beta strandi448 – 46114
    Beta strandi473 – 4775
    Turni480 – 4823
    Beta strandi485 – 4917
    Beta strandi501 – 5077
    Beta strandi529 – 5335
    Beta strandi538 – 5414
    Beta strandi548 – 5503
    Beta strandi554 – 5618
    Turni562 – 5643
    Beta strandi565 – 57511
    Beta strandi577 – 5826
    Beta strandi590 – 59910
    Beta strandi602 – 6065
    Helixi630 – 6367
    Beta strandi639 – 6413
    Beta strandi651 – 66010
    Beta strandi667 – 67913
    Turni680 – 6823
    Beta strandi685 – 6884
    Beta strandi696 – 7016
    Beta strandi704 – 71815
    Beta strandi727 – 7315

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1UEMNMR-A514-617[»]
    1UJTNMR-A628-734[»]
    2EDJNMR-A417-509[»]
    ProteinModelPortaliQ9HCK4.
    SMRiQ9HCK4. Positions 24-831.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9HCK4.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini22 – 859838ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini881 – 1378498CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei860 – 88021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini31 – 12797Ig-like C2-type 1Add
    BLAST
    Domaini133 – 22088Ig-like C2-type 2Add
    BLAST
    Domaini225 – 30985Ig-like C2-type 3Add
    BLAST
    Domaini314 – 40996Ig-like C2-type 4Add
    BLAST
    Domaini418 – 50487Ig-like C2-type 5Add
    BLAST
    Domaini524 – 61895Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini637 – 73599Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini739 – 83698Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the immunoglobulin superfamily. ROBO family.Curated
    Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG238978.
    HOGENOMiHOG000010267.
    HOVERGENiHBG073476.
    KOiK06754.
    PhylomeDBiQ9HCK4.
    TreeFamiTF351053.

    Family and domain databases

    Gene3Di2.60.40.10. 9 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    [Graphical view]
    PfamiPF00041. fn3. 3 hits.
    PF07679. I-set. 5 hits.
    [Graphical view]
    SMARTiSM00060. FN3. 3 hits.
    SM00408. IGc2. 5 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 2 hits.
    PROSITEiPS50853. FN3. 3 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HCK4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSLLMFTQLL LCGFLYVRVD GSRLRQEDFP PRIVEHPSDV IVSKGEPTTL     50
    NCKAEGRPTP TIEWYKDGER VETDKDDPRS HRMLLPSGSL FFLRIVHGRR 100
    SKPDEGSYVC VARNYLGEAV SRNASLEVAL LRDDFRQNPT DVVVAAGEPA 150
    ILECQPPRGH PEPTIYWKKD KVRIDDKEER ISIRGGKLMI SNTRKSDAGM 200
    YTCVGTNMVG ERDSDPAELT VFERPTFLRR PINQVVLEEE AVEFRCQVQG 250
    DPQPTVRWKK DDADLPRGRY DIKDDYTLRI KKTMSTDEGT YMCIAENRVG 300
    KMEASATLTV RAPPQFVVRP RDQIVAQGRT VTFPCETKGN PQPAVFWQKE 350
    GSQNLLFPNQ PQQPNSRCSV SPTGDLTITN IQRSDAGYYI CQALTVAGSI 400
    LAKAQLEVTD VLTDRPPPII LQGPANQTLA VDGTALLKCK ATGDPLPVIS 450
    WLKEGFTFPG RDPRATIQEQ GTLQIKNLRI SDTGTYTCVA TSSSGETSWS 500
    AVLDVTESGA TISKNYDLSD LPGPPSKPQV TDVTKNSVTL SWQPGTPGTL 550
    PASAYIIEAF SQSVSNSWQT VANHVKTTLY TVRGLRPNTI YLFMVRAINP 600
    QGLSDPSPMS DPVRTQDISP PAQGVDHRQV QKELGDVLVR LHNPVVLTPT 650
    TVQVTWTVDR QPQFIQGYRV MYRQTSGLQA TSSWQNLDAK VPTERSAVLV 700
    NLKKGVTYEI KVRPYFNEFQ GMDSESKTVR TTEEAPSAPP QSVTVLTVGS 750
    YNSTSISVSW DPPPPDHQNG IIQEYKIWCL GNETRFHINK TVDAAIRSVI 800
    IGGLFPGIQY RVEVAASTSA GVGVKSEPQP IIIGRRNEVV ITENNNSITE 850
    QITDVVKQPA FIAGIGGACW VILMGFSIWL YWRRKKRKGL SNYAVTFQRG 900
    DGGLMSNGSR PGLLNAGDPS YPWLADSWPA TSLPVNNSNS GPNEIGNFGR 950
    GDVLPPVPGQ GDKTATMLSD GAIYSSIDFT TKTSYNSSSQ ITQATPYATT 1000
    QILHSNSIHE LAVDLPDPQW KSSIQQKTDL MGFGYSLPDQ NKGNNGGKGG 1050
    KKKKNKNSSK PQKNNGSTWA NVPLPPPPVQ PLPGTELEHY AVEQQENGYD 1100
    SDSWCPPLPV QTYLHQGLED ELEEDDDRVP TPPVRGVASS PAISFGQQST 1150
    ATLTPSPREE MQPMLQAHLD ELTRAYQFDI AKQTWHIQSN NQPPQPPVPP 1200
    LGYVSGALIS DLETDVADDD ADDEEEALEI PRPLRALDQT PGSSMDNLDS 1250
    SVTGKAFTSS QRPRPTSPFS TDSNTSAALS QSQRPRPTKK HKGGRMDQQP 1300
    ALPHRREGMT DEEALVPYSK PSFPSPGGHS SSGTASSKGS TGPRKTEVLR 1350
    AGHQRNASDL LDIGYMGSNS QGQFTGEL 1378
    Length:1,378
    Mass (Da):151,200
    Last modified:June 21, 2004 - v2
    Checksum:i60F7CE3E53622B50
    GO
    Isoform 2 (identifier: Q9HCK4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1186-1378: Missing.

    Show »
    Length:1,185
    Mass (Da):130,669
    Checksum:i5A6ABDBD4A2111A3
    GO
    Isoform 3 (identifier: Q9HCK4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MSLLMFTQLLLCGFLYVRVD → MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQ

    Note: No experimental confirmation available.

    Show »
    Length:1,394
    Mass (Da):153,120
    Checksum:i860FFDE4892D51B7
    GO

    Sequence cautioni

    The sequence AAC39576.1 differs from that shown. Reason: Frameshift at position 601.
    The sequence BAB13394.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti497 – 4971T → A(PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti945 – 9451I → T in VUR2. 1 Publication
    VAR_032960
    Natural varianti1236 – 12361A → T in VUR2. 1 Publication
    VAR_032961

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2020MSLLM…YVRVD → MARRHERVTRRMWTWAPGLL MMTVVFWGHQGNGQGQ in isoform 3. 1 PublicationVSP_043394Add
    BLAST
    Alternative sequencei1186 – 1378193Missing in isoform 2. 1 PublicationVSP_010647Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ533874 mRNA. Translation: ABF83431.1.
    AB046788 mRNA. Translation: BAB13394.1. Different initiation.
    DQ533873 mRNA. Translation: ABF83430.1.
    AC016942 Genomic DNA. No translation available.
    AC016952 Genomic DNA. No translation available.
    AC024256 Genomic DNA. No translation available.
    AC026877 Genomic DNA. No translation available.
    AC067717 Genomic DNA. No translation available.
    AC117514 Genomic DNA. No translation available.
    AC117515 Genomic DNA. No translation available.
    AC117516 Genomic DNA. No translation available.
    AC126467 Genomic DNA. No translation available.
    AC130004 Genomic DNA. No translation available.
    AC131005 Genomic DNA. No translation available.
    AC131154 Genomic DNA. No translation available.
    AC133040 Genomic DNA. No translation available.
    AC138974 Genomic DNA. No translation available.
    BC064374 mRNA. Translation: AAH64374.1.
    BC146772 mRNA. Translation: AAI46773.1.
    AF040991 mRNA. Translation: AAC39576.1. Frameshift.
    CCDSiCCDS43109.1. [Q9HCK4-1]
    CCDS54609.1. [Q9HCK4-3]
    RefSeqiNP_001122401.1. NM_001128929.3. [Q9HCK4-3]
    NP_001276968.1. NM_001290039.1.
    NP_001276969.1. NM_001290040.1.
    NP_001276994.1. NM_001290065.1.
    NP_002933.1. NM_002942.4. [Q9HCK4-1]
    UniGeneiHs.13305.

    Genome annotation databases

    EnsembliENST00000461745; ENSP00000417164; ENSG00000185008. [Q9HCK4-1]
    ENST00000487694; ENSP00000417335; ENSG00000185008. [Q9HCK4-3]
    GeneIDi6092.
    KEGGihsa:6092.
    UCSCiuc003dpy.4. human. [Q9HCK4-1]
    uc021xat.1. human. [Q9HCK4-3]

    Polymorphism databases

    DMDMi49036496.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ533874 mRNA. Translation: ABF83431.1 .
    AB046788 mRNA. Translation: BAB13394.1 . Different initiation.
    DQ533873 mRNA. Translation: ABF83430.1 .
    AC016942 Genomic DNA. No translation available.
    AC016952 Genomic DNA. No translation available.
    AC024256 Genomic DNA. No translation available.
    AC026877 Genomic DNA. No translation available.
    AC067717 Genomic DNA. No translation available.
    AC117514 Genomic DNA. No translation available.
    AC117515 Genomic DNA. No translation available.
    AC117516 Genomic DNA. No translation available.
    AC126467 Genomic DNA. No translation available.
    AC130004 Genomic DNA. No translation available.
    AC131005 Genomic DNA. No translation available.
    AC131154 Genomic DNA. No translation available.
    AC133040 Genomic DNA. No translation available.
    AC138974 Genomic DNA. No translation available.
    BC064374 mRNA. Translation: AAH64374.1 .
    BC146772 mRNA. Translation: AAI46773.1 .
    AF040991 mRNA. Translation: AAC39576.1 . Frameshift.
    CCDSi CCDS43109.1. [Q9HCK4-1 ]
    CCDS54609.1. [Q9HCK4-3 ]
    RefSeqi NP_001122401.1. NM_001128929.3. [Q9HCK4-3 ]
    NP_001276968.1. NM_001290039.1.
    NP_001276969.1. NM_001290040.1.
    NP_001276994.1. NM_001290065.1.
    NP_002933.1. NM_002942.4. [Q9HCK4-1 ]
    UniGenei Hs.13305.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1UEM NMR - A 514-617 [» ]
    1UJT NMR - A 628-734 [» ]
    2EDJ NMR - A 417-509 [» ]
    ProteinModelPortali Q9HCK4.
    SMRi Q9HCK4. Positions 24-831.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112019. 13 interactions.
    IntActi Q9HCK4. 17 interactions.
    MINTi MINT-1418118.
    STRINGi 9606.ENSP00000417164.

    PTM databases

    PhosphoSitei Q9HCK4.

    Polymorphism databases

    DMDMi 49036496.

    Proteomic databases

    PaxDbi Q9HCK4.
    PRIDEi Q9HCK4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000461745 ; ENSP00000417164 ; ENSG00000185008 . [Q9HCK4-1 ]
    ENST00000487694 ; ENSP00000417335 ; ENSG00000185008 . [Q9HCK4-3 ]
    GeneIDi 6092.
    KEGGi hsa:6092.
    UCSCi uc003dpy.4. human. [Q9HCK4-1 ]
    uc021xat.1. human. [Q9HCK4-3 ]

    Organism-specific databases

    CTDi 6092.
    GeneCardsi GC03P075955.
    HGNCi HGNC:10250. ROBO2.
    HPAi HPA013371.
    MIMi 602431. gene.
    610878. phenotype.
    neXtProti NX_Q9HCK4.
    Orphaneti 289365. Familial vesicoureteral reflux.
    PharmGKBi PA34621.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG238978.
    HOGENOMi HOG000010267.
    HOVERGENi HBG073476.
    KOi K06754.
    PhylomeDBi Q9HCK4.
    TreeFami TF351053.

    Enzyme and pathway databases

    Reactomei REACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.

    Miscellaneous databases

    ChiTaRSi ROBO2. human.
    EvolutionaryTracei Q9HCK4.
    GeneWikii ROBO2.
    GenomeRNAii 6092.
    NextBioi 23691.
    PROi Q9HCK4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HCK4.
    Bgeei Q9HCK4.
    CleanExi HS_ROBO2.
    Genevestigatori Q9HCK4.

    Family and domain databases

    Gene3Di 2.60.40.10. 9 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    [Graphical view ]
    Pfami PF00041. fn3. 3 hits.
    PF07679. I-set. 5 hits.
    [Graphical view ]
    SMARTi SM00060. FN3. 3 hits.
    SM00408. IGc2. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 2 hits.
    PROSITEi PS50853. FN3. 3 hits.
    PS50835. IG_LIKE. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and differential expression of two isoforms of the ROBO2/Robo2 axon guidance receptor gene in humans and mice."
      Yue Y., Grossmann B., Galetzka D., Zechner U., Haaf T.
      Genomics 88:772-778(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
    2. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
      DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. Yue Y., Grossmann B., Galetzka D., Zechner U., Haaf T.
      Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    4. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 845-1378 (ISOFORM 2).
      Tissue: Ovary.
    6. "Roundabout controls axon crossing of the CNS midline and defines a novel subfamily of evolutionarily conserved guidance receptors."
      Kidd T., Brose K., Mitchell K.J., Fetter R.D., Tessier-Lavigne M., Goodman C.S., Tear G.
      Cell 92:205-215(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 323-607.
    7. "Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance."
      Brose K., Bland K.S., Wang K.H., Arnott D., Henzel W., Goodman C.S., Tessier-Lavigne M., Kidd T.
      Cell 96:795-806(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SLIT2.
    8. "Diversity and specificity of actions of Slit2 proteolytic fragments in axon guidance."
      Nguyen-Ba-Charvet K.T., Brose K., Ma L., Wang K.H., Marillat V., Sotelo C., Tessier-Lavigne M., Chedotal A.
      J. Neurosci. 21:4281-4289(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SLIT2.
    9. "Solution structure of the fifth Ig-like domain and of first and second fibronectin type III domain from human roundabout homolog 2."
      RIKEN structural genomics initiative (RSGI)
      Submitted (AUG-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 417-734.
    10. Cited for: VARIANTS VUR2 THR-945 AND THR-1236, CHROMOSOMAL TRANSLOCATION WITH PCDH11Y.

    Entry informationi

    Entry nameiROBO2_HUMAN
    AccessioniPrimary (citable) accession number: Q9HCK4
    Secondary accession number(s): O43608, Q19AB4, Q19AB5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 21, 2004
    Last sequence update: June 21, 2004
    Last modified: October 1, 2014
    This is version 129 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3