Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Roundabout homolog 2

Gene

ROBO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development.

GO - Molecular functioni

  1. axon guidance receptor activity Source: UniProtKB
  2. identical protein binding Source: UniProtKB

GO - Biological processi

  1. apoptotic process involved in luteolysis Source: UniProtKB
  2. axon guidance Source: UniProtKB
  3. axon midline choice point recognition Source: UniProtKB
  4. brain development Source: UniProtKB
  5. cellular response to hormone stimulus Source: UniProtKB
  6. central nervous system development Source: UniProtKB
  7. homophilic cell adhesion via plasma membrane adhesion molecules Source: UniProtKB
  8. metanephros development Source: UniProtKB
  9. negative regulation of negative chemotaxis Source: UniProtKB
  10. negative regulation of synapse assembly Source: UniProtKB
  11. olfactory bulb interneuron development Source: UniProtKB
  12. positive regulation of axonogenesis Source: UniProtKB
  13. retinal ganglion cell axon guidance Source: UniProtKB
  14. ureteric bud development Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Chemotaxis, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.

Names & Taxonomyi

Protein namesi
Recommended name:
Roundabout homolog 2
Gene namesi
Name:ROBO2
Synonyms:KIAA1568
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:10250. ROBO2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 859838ExtracellularSequence AnalysisAdd
BLAST
Transmembranei860 – 88021HelicalSequence AnalysisAdd
BLAST
Topological domaini881 – 1378498CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. axolemma Source: UniProtKB
  2. cell surface Source: UniProtKB
  3. extracellular vesicular exosome Source: UniProtKB
  4. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Vesicoureteral reflux 2 (VUR2)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.

See also OMIM:610878
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti945 – 9451I → T in VUR2. 1 Publication
VAR_032960
Natural varianti1236 – 12361A → T in VUR2. 1 Publication
VAR_032961

A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro.

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi610878. phenotype.
Orphaneti289365. Familial vesicoureteral reflux.
PharmGKBiPA34621.

Polymorphism and mutation databases

BioMutaiROBO2.
DMDMi49036496.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence AnalysisAdd
BLAST
Chaini22 – 13781357Roundabout homolog 2PRO_0000031036Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi52 ↔ 110PROSITE-ProRule annotation
Glycosylationi123 – 1231N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi154 ↔ 203PROSITE-ProRule annotation
Disulfide bondi246 ↔ 293PROSITE-ProRule annotation
Disulfide bondi335 ↔ 391PROSITE-ProRule annotation
Glycosylationi426 – 4261N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi439 ↔ 488PROSITE-ProRule annotation
Glycosylationi752 – 7521N-linked (GlcNAc...)Sequence Analysis
Glycosylationi782 – 7821N-linked (GlcNAc...)Sequence Analysis
Glycosylationi789 – 7891N-linked (GlcNAc...)Sequence Analysis
Glycosylationi845 – 8451N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9HCK4.
PaxDbiQ9HCK4.
PRIDEiQ9HCK4.

PTM databases

PhosphoSiteiQ9HCK4.

Expressioni

Gene expression databases

BgeeiQ9HCK4.
CleanExiHS_ROBO2.
ExpressionAtlasiQ9HCK4. baseline and differential.
GenevestigatoriQ9HCK4.

Organism-specific databases

HPAiHPA013371.

Interactioni

Subunit structurei

Interacts with SLIT2.2 Publications

Protein-protein interaction databases

BioGridi112019. 13 interactions.
IntActiQ9HCK4. 17 interactions.
MINTiMINT-1418118.
STRINGi9606.ENSP00000417164.

Structurei

Secondary structure

1
1378
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi419 – 4224Combined sources
Beta strandi427 – 43711Combined sources
Beta strandi440 – 4423Combined sources
Beta strandi448 – 46114Combined sources
Beta strandi473 – 4775Combined sources
Turni480 – 4823Combined sources
Beta strandi485 – 4917Combined sources
Beta strandi501 – 5077Combined sources
Beta strandi529 – 5335Combined sources
Beta strandi538 – 5414Combined sources
Beta strandi548 – 5503Combined sources
Beta strandi554 – 5618Combined sources
Turni562 – 5643Combined sources
Beta strandi565 – 57511Combined sources
Beta strandi577 – 5826Combined sources
Beta strandi590 – 59910Combined sources
Beta strandi602 – 6065Combined sources
Helixi630 – 6367Combined sources
Beta strandi639 – 6413Combined sources
Beta strandi651 – 66010Combined sources
Beta strandi667 – 67913Combined sources
Turni680 – 6823Combined sources
Beta strandi685 – 6884Combined sources
Beta strandi696 – 7016Combined sources
Beta strandi704 – 71815Combined sources
Beta strandi727 – 7315Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1UEMNMR-A514-617[»]
1UJTNMR-A628-734[»]
2EDJNMR-A417-509[»]
ProteinModelPortaliQ9HCK4.
SMRiQ9HCK4. Positions 24-831.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HCK4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 12797Ig-like C2-type 1Add
BLAST
Domaini133 – 22088Ig-like C2-type 2Add
BLAST
Domaini225 – 30985Ig-like C2-type 3Add
BLAST
Domaini314 – 40996Ig-like C2-type 4Add
BLAST
Domaini418 – 50487Ig-like C2-type 5Add
BLAST
Domaini524 – 61895Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini637 – 73599Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini739 – 83698Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ROBO family.Curated
Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG238978.
GeneTreeiENSGT00780000121850.
HOGENOMiHOG000010267.
HOVERGENiHBG073476.
InParanoidiQ9HCK4.
KOiK06754.
PhylomeDBiQ9HCK4.
TreeFamiTF351053.

Family and domain databases

Gene3Di2.60.40.10. 9 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF00041. fn3. 3 hits.
PF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00060. FN3. 3 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 3 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HCK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLMFTQLL LCGFLYVRVD GSRLRQEDFP PRIVEHPSDV IVSKGEPTTL
60 70 80 90 100
NCKAEGRPTP TIEWYKDGER VETDKDDPRS HRMLLPSGSL FFLRIVHGRR
110 120 130 140 150
SKPDEGSYVC VARNYLGEAV SRNASLEVAL LRDDFRQNPT DVVVAAGEPA
160 170 180 190 200
ILECQPPRGH PEPTIYWKKD KVRIDDKEER ISIRGGKLMI SNTRKSDAGM
210 220 230 240 250
YTCVGTNMVG ERDSDPAELT VFERPTFLRR PINQVVLEEE AVEFRCQVQG
260 270 280 290 300
DPQPTVRWKK DDADLPRGRY DIKDDYTLRI KKTMSTDEGT YMCIAENRVG
310 320 330 340 350
KMEASATLTV RAPPQFVVRP RDQIVAQGRT VTFPCETKGN PQPAVFWQKE
360 370 380 390 400
GSQNLLFPNQ PQQPNSRCSV SPTGDLTITN IQRSDAGYYI CQALTVAGSI
410 420 430 440 450
LAKAQLEVTD VLTDRPPPII LQGPANQTLA VDGTALLKCK ATGDPLPVIS
460 470 480 490 500
WLKEGFTFPG RDPRATIQEQ GTLQIKNLRI SDTGTYTCVA TSSSGETSWS
510 520 530 540 550
AVLDVTESGA TISKNYDLSD LPGPPSKPQV TDVTKNSVTL SWQPGTPGTL
560 570 580 590 600
PASAYIIEAF SQSVSNSWQT VANHVKTTLY TVRGLRPNTI YLFMVRAINP
610 620 630 640 650
QGLSDPSPMS DPVRTQDISP PAQGVDHRQV QKELGDVLVR LHNPVVLTPT
660 670 680 690 700
TVQVTWTVDR QPQFIQGYRV MYRQTSGLQA TSSWQNLDAK VPTERSAVLV
710 720 730 740 750
NLKKGVTYEI KVRPYFNEFQ GMDSESKTVR TTEEAPSAPP QSVTVLTVGS
760 770 780 790 800
YNSTSISVSW DPPPPDHQNG IIQEYKIWCL GNETRFHINK TVDAAIRSVI
810 820 830 840 850
IGGLFPGIQY RVEVAASTSA GVGVKSEPQP IIIGRRNEVV ITENNNSITE
860 870 880 890 900
QITDVVKQPA FIAGIGGACW VILMGFSIWL YWRRKKRKGL SNYAVTFQRG
910 920 930 940 950
DGGLMSNGSR PGLLNAGDPS YPWLADSWPA TSLPVNNSNS GPNEIGNFGR
960 970 980 990 1000
GDVLPPVPGQ GDKTATMLSD GAIYSSIDFT TKTSYNSSSQ ITQATPYATT
1010 1020 1030 1040 1050
QILHSNSIHE LAVDLPDPQW KSSIQQKTDL MGFGYSLPDQ NKGNNGGKGG
1060 1070 1080 1090 1100
KKKKNKNSSK PQKNNGSTWA NVPLPPPPVQ PLPGTELEHY AVEQQENGYD
1110 1120 1130 1140 1150
SDSWCPPLPV QTYLHQGLED ELEEDDDRVP TPPVRGVASS PAISFGQQST
1160 1170 1180 1190 1200
ATLTPSPREE MQPMLQAHLD ELTRAYQFDI AKQTWHIQSN NQPPQPPVPP
1210 1220 1230 1240 1250
LGYVSGALIS DLETDVADDD ADDEEEALEI PRPLRALDQT PGSSMDNLDS
1260 1270 1280 1290 1300
SVTGKAFTSS QRPRPTSPFS TDSNTSAALS QSQRPRPTKK HKGGRMDQQP
1310 1320 1330 1340 1350
ALPHRREGMT DEEALVPYSK PSFPSPGGHS SSGTASSKGS TGPRKTEVLR
1360 1370
AGHQRNASDL LDIGYMGSNS QGQFTGEL
Length:1,378
Mass (Da):151,200
Last modified:June 21, 2004 - v2
Checksum:i60F7CE3E53622B50
GO
Isoform 2 (identifier: Q9HCK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1186-1378: Missing.

Show »
Length:1,185
Mass (Da):130,669
Checksum:i5A6ABDBD4A2111A3
GO
Isoform 3 (identifier: Q9HCK4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MSLLMFTQLLLCGFLYVRVD → MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQ

Note: No experimental confirmation available.

Show »
Length:1,394
Mass (Da):153,120
Checksum:i860FFDE4892D51B7
GO

Sequence cautioni

The sequence AAC39576.1 differs from that shown. Reason: Frameshift at position 601. Curated
The sequence BAB13394.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti497 – 4971T → A (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti945 – 9451I → T in VUR2. 1 Publication
VAR_032960
Natural varianti1236 – 12361A → T in VUR2. 1 Publication
VAR_032961

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2020MSLLM…YVRVD → MARRHERVTRRMWTWAPGLL MMTVVFWGHQGNGQGQ in isoform 3. 1 PublicationVSP_043394Add
BLAST
Alternative sequencei1186 – 1378193Missing in isoform 2. 1 PublicationVSP_010647Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ533874 mRNA. Translation: ABF83431.1.
AB046788 mRNA. Translation: BAB13394.1. Different initiation.
DQ533873 mRNA. Translation: ABF83430.1.
AC016942 Genomic DNA. No translation available.
AC016952 Genomic DNA. No translation available.
AC024256 Genomic DNA. No translation available.
AC026877 Genomic DNA. No translation available.
AC067717 Genomic DNA. No translation available.
AC117514 Genomic DNA. No translation available.
AC117515 Genomic DNA. No translation available.
AC117516 Genomic DNA. No translation available.
AC126467 Genomic DNA. No translation available.
AC130004 Genomic DNA. No translation available.
AC131005 Genomic DNA. No translation available.
AC131154 Genomic DNA. No translation available.
AC133040 Genomic DNA. No translation available.
AC138974 Genomic DNA. No translation available.
BC064374 mRNA. Translation: AAH64374.1.
BC146772 mRNA. Translation: AAI46773.1.
AF040991 mRNA. Translation: AAC39576.1. Frameshift.
CCDSiCCDS43109.1. [Q9HCK4-1]
CCDS54609.1. [Q9HCK4-3]
RefSeqiNP_001122401.1. NM_001128929.3. [Q9HCK4-3]
NP_001276968.1. NM_001290039.1.
NP_001276969.1. NM_001290040.1.
NP_001276994.1. NM_001290065.1.
NP_002933.1. NM_002942.4. [Q9HCK4-1]
UniGeneiHs.13305.

Genome annotation databases

EnsembliENST00000461745; ENSP00000417164; ENSG00000185008. [Q9HCK4-1]
ENST00000487694; ENSP00000417335; ENSG00000185008. [Q9HCK4-3]
GeneIDi6092.
KEGGihsa:6092.
UCSCiuc003dpy.4. human. [Q9HCK4-1]
uc021xat.1. human. [Q9HCK4-3]

Polymorphism and mutation databases

BioMutaiROBO2.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ533874 mRNA. Translation: ABF83431.1.
AB046788 mRNA. Translation: BAB13394.1. Different initiation.
DQ533873 mRNA. Translation: ABF83430.1.
AC016942 Genomic DNA. No translation available.
AC016952 Genomic DNA. No translation available.
AC024256 Genomic DNA. No translation available.
AC026877 Genomic DNA. No translation available.
AC067717 Genomic DNA. No translation available.
AC117514 Genomic DNA. No translation available.
AC117515 Genomic DNA. No translation available.
AC117516 Genomic DNA. No translation available.
AC126467 Genomic DNA. No translation available.
AC130004 Genomic DNA. No translation available.
AC131005 Genomic DNA. No translation available.
AC131154 Genomic DNA. No translation available.
AC133040 Genomic DNA. No translation available.
AC138974 Genomic DNA. No translation available.
BC064374 mRNA. Translation: AAH64374.1.
BC146772 mRNA. Translation: AAI46773.1.
AF040991 mRNA. Translation: AAC39576.1. Frameshift.
CCDSiCCDS43109.1. [Q9HCK4-1]
CCDS54609.1. [Q9HCK4-3]
RefSeqiNP_001122401.1. NM_001128929.3. [Q9HCK4-3]
NP_001276968.1. NM_001290039.1.
NP_001276969.1. NM_001290040.1.
NP_001276994.1. NM_001290065.1.
NP_002933.1. NM_002942.4. [Q9HCK4-1]
UniGeneiHs.13305.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1UEMNMR-A514-617[»]
1UJTNMR-A628-734[»]
2EDJNMR-A417-509[»]
ProteinModelPortaliQ9HCK4.
SMRiQ9HCK4. Positions 24-831.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112019. 13 interactions.
IntActiQ9HCK4. 17 interactions.
MINTiMINT-1418118.
STRINGi9606.ENSP00000417164.

PTM databases

PhosphoSiteiQ9HCK4.

Polymorphism and mutation databases

BioMutaiROBO2.
DMDMi49036496.

Proteomic databases

MaxQBiQ9HCK4.
PaxDbiQ9HCK4.
PRIDEiQ9HCK4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000461745; ENSP00000417164; ENSG00000185008. [Q9HCK4-1]
ENST00000487694; ENSP00000417335; ENSG00000185008. [Q9HCK4-3]
GeneIDi6092.
KEGGihsa:6092.
UCSCiuc003dpy.4. human. [Q9HCK4-1]
uc021xat.1. human. [Q9HCK4-3]

Organism-specific databases

CTDi6092.
GeneCardsiGC03P075955.
HGNCiHGNC:10250. ROBO2.
HPAiHPA013371.
MIMi602431. gene.
610878. phenotype.
neXtProtiNX_Q9HCK4.
Orphaneti289365. Familial vesicoureteral reflux.
PharmGKBiPA34621.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG238978.
GeneTreeiENSGT00780000121850.
HOGENOMiHOG000010267.
HOVERGENiHBG073476.
InParanoidiQ9HCK4.
KOiK06754.
PhylomeDBiQ9HCK4.
TreeFamiTF351053.

Enzyme and pathway databases

ReactomeiREACT_19376. Regulation of Commissural axon pathfinding by Slit and Robo.

Miscellaneous databases

ChiTaRSiROBO2. human.
EvolutionaryTraceiQ9HCK4.
GeneWikiiROBO2.
GenomeRNAii6092.
NextBioi23691.
PROiQ9HCK4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9HCK4.
CleanExiHS_ROBO2.
ExpressionAtlasiQ9HCK4. baseline and differential.
GenevestigatoriQ9HCK4.

Family and domain databases

Gene3Di2.60.40.10. 9 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF00041. fn3. 3 hits.
PF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00060. FN3. 3 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 3 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and differential expression of two isoforms of the ROBO2/Robo2 axon guidance receptor gene in humans and mice."
    Yue Y., Grossmann B., Galetzka D., Zechner U., Haaf T.
    Genomics 88:772-778(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
  2. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. Yue Y., Grossmann B., Galetzka D., Zechner U., Haaf T.
    Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 845-1378 (ISOFORM 2).
    Tissue: Ovary.
  6. "Roundabout controls axon crossing of the CNS midline and defines a novel subfamily of evolutionarily conserved guidance receptors."
    Kidd T., Brose K., Mitchell K.J., Fetter R.D., Tessier-Lavigne M., Goodman C.S., Tear G.
    Cell 92:205-215(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 323-607.
  7. "Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance."
    Brose K., Bland K.S., Wang K.H., Arnott D., Henzel W., Goodman C.S., Tessier-Lavigne M., Kidd T.
    Cell 96:795-806(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SLIT2.
  8. "Diversity and specificity of actions of Slit2 proteolytic fragments in axon guidance."
    Nguyen-Ba-Charvet K.T., Brose K., Ma L., Wang K.H., Marillat V., Sotelo C., Tessier-Lavigne M., Chedotal A.
    J. Neurosci. 21:4281-4289(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SLIT2.
  9. "Solution structure of the fifth Ig-like domain and of first and second fibronectin type III domain from human roundabout homolog 2."
    RIKEN structural genomics initiative (RSGI)
    Submitted (AUG-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 417-734.
  10. Cited for: VARIANTS VUR2 THR-945 AND THR-1236, CHROMOSOMAL TRANSLOCATION WITH PCDH11Y.

Entry informationi

Entry nameiROBO2_HUMAN
AccessioniPrimary (citable) accession number: Q9HCK4
Secondary accession number(s): O43608, Q19AB4, Q19AB5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: April 29, 2015
This is version 135 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.