Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trinucleotide repeat-containing gene 6C protein

Gene

TNRC6C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in RNA-mediated gene silencing by micro-RNAs (miRNAs). Required for miRNA-dependent translational repression of complementary mRNAs by argonaute family proteins. As scaffoldng protein associates with argonaute proteins bound to partially complementary mRNAs and simultaneously can recruit CCR4-NOT and PAN deadenylase complexes.4 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

RNA-mediated gene silencing, Translation regulation

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-1257604. PIP3 activates AKT signaling.
R-HSA-1912408. Pre-NOTCH Transcription and Translation.
R-HSA-2559580. Oxidative Stress Induced Senescence.
R-HSA-2559585. Oncogene Induced Senescence.
R-HSA-4086398. Ca2+ pathway.
R-HSA-426496. Post-transcriptional silencing by small RNAs.
R-HSA-5628897. TP53 Regulates Metabolic Genes.
R-HSA-5687128. MAPK6/MAPK4 signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Trinucleotide repeat-containing gene 6C protein
Gene namesi
Name:TNRC6C
Synonyms:KIAA1582
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:29318. TNRC6C.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1294 – 13007QSRLPQW → AAAAPAA: Abolishes association with CCR4-NOT complex.
Mutagenesisi1388 – 13892EF → AA: Abolishes interaction with PABPC1, impairs interaction with PAN2, no effect on interaction with CCR4-NOT complex, reduces RNA deadenylation rate; when associated with 1395-A-A-1396.
Mutagenesisi1395 – 13962WK → AA: Abolishes interaction with PABPC1, impairs interaction with PAN2, no effect on interaction with CCR4-NOT complex, reduces RNA deadenylation rate; when associated with 1388-A-A-1389.
Mutagenesisi1445 – 14451W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1487, A-1494, A-1504, A-1515, A-1605 and A-1648. 1 Publication
Mutagenesisi1487 – 14871W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1494, A-1504, A-1515, A-1605 and A-1648. 1 Publication
Mutagenesisi1494 – 14941W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1504, A-1515, A-1605 and A-1648. 1 Publication
Mutagenesisi1504 – 15041W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1515, A-1605 and A-1648. 1 Publication
Mutagenesisi1515 – 15151W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1504, A-1605 and A-1648. 1 Publication
Mutagenesisi1537 – 15371H → A: Strongly reduced ability to repress translation of target mRNAs. 1 Publication
Mutagenesisi1543 – 15431F → A: Weakly reduced ability to repress translation of target mRNAs. 1 Publication
Mutagenesisi1556 – 15561Y → A: Strongly reduced ability to repress translation of target mRNAs. 1 Publication
Mutagenesisi1605 – 16051W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1504, A-1515 and A-1648. 1 Publication
Mutagenesisi1647 – 16493LWG → AAA: Impairs interaction with the CCR4-NOT complex, no effect on interaction with PABPC1; when asscoiated with 1658-A-A-1660.
Mutagenesisi1648 – 16481W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1504, A-1515 and A-1605. 1 Publication
Mutagenesisi1658 – 16603LWG → AAA: Impairs interaction with the CCR4-NOT complex, no effect on interaction with PABPC1; when asscoiated with 1647-A-A-1649.

Organism-specific databases

PharmGKBiPA134880671.

Polymorphism and mutation databases

BioMutaiTNRC6C.
DMDMi126253813.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16901690Trinucleotide repeat-containing gene 6C proteinPRO_0000278526Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei465 – 4651PhosphoserineBy similarity
Modified residuei714 – 7141PhosphoserineCombined sources
Modified residuei777 – 7771PhosphothreonineCombined sources
Modified residuei1011 – 10111PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9HCJ0.
MaxQBiQ9HCJ0.
PaxDbiQ9HCJ0.
PeptideAtlasiQ9HCJ0.
PRIDEiQ9HCJ0.

PTM databases

iPTMnetiQ9HCJ0.
PhosphoSiteiQ9HCJ0.

Expressioni

Gene expression databases

BgeeiENSG00000078687.
CleanExiHS_TNRC6C.
ExpressionAtlasiQ9HCJ0. baseline and differential.
GenevisibleiQ9HCJ0. HS.

Organism-specific databases

HPAiHPA022007.
HPA062051.

Interactioni

Subunit structurei

Interacts with one or more of the argonaute family proteins AGO1, AGO2, AGO3 and AGO4. Interacts with PABPC1 and EIF4G1. Interacts with CNOT1; the interaction is direct and mediates the association with the CCR4-NOT complex. Interacts with PAN3; the interaction mediates the association with the PAN complex.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
AGO2Q9UKV83EBI-6507625,EBI-528269
CNOT1A5YKK66EBI-6507625,EBI-1222758
CNOT2Q9NZN83EBI-6507625,EBI-743033
CNOT6Q9ULM62EBI-6507625,EBI-2104530
pAbpP211875EBI-6507625,EBI-103658From a different organism.
PABPC1P1194017EBI-6507625,EBI-81531
PAN3Q58A454EBI-6507625,EBI-2513054

Protein-protein interaction databases

BioGridi121716. 30 interactions.
DIPiDIP-48569N.
IntActiQ9HCJ0. 26 interactions.
MINTiMINT-2818544.
STRINGi9606.ENSP00000336783.

Structurei

Secondary structure

1
1690
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi936 – 95015Combined sources
Helixi954 – 96310Combined sources
Helixi968 – 9769Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DKLNMR-A927-998[»]
2X04X-ray1.49C/D1382-1399[»]
3KTPX-ray1.50B1380-1401[»]
ProteinModelPortaliQ9HCJ0.
SMRiQ9HCJ0. Positions 928-998, 1513-1593.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HCJ0.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini933 – 97846UBAPROSITE-ProRule annotationAdd
BLAST
Domaini1565 – 163268RRMAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 926926Sufficient for interaction with argonaute family proteinsAdd
BLAST
Regioni1260 – 1690431Silencing domain; interaction with CNOT1 and PAN3Add
BLAST
Regioni1371 – 1690320Sufficient for translational repression when tethered to a target mRNAAdd
BLAST
Regioni1371 – 141747Required for interaction with PABPC1Add
BLAST
Regioni1381 – 139919PABPC1-interacting motif-2 (PAM2)Add
BLAST
Regioni1596 – 169095Interaction with the CCR4-NOT complexAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1156 – 121459Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi204 – 430227Gly-richAdd
BLAST
Compositional biasi549 – 5524Poly-Ala
Compositional biasi756 – 77722Thr-richAdd
BLAST
Compositional biasi1215 – 124834Pro-richAdd
BLAST

Domaini

The silencing domain, also known as C-terminal effector domain (CED), can act in autonomous repression, including both translational inhibition and mRNA degradation.

Sequence similaritiesi

Belongs to the GW182 family.Curated
Contains 1 UBA domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFAU. Eukaryota.
ENOG41110AX. LUCA.
GeneTreeiENSGT00410000025966.
HOGENOMiHOG000049171.
HOVERGENiHBG062594.
InParanoidiQ9HCJ0.
KOiK18412.
OMAiHMNSWAK.
OrthoDBiEOG091G00G6.
PhylomeDBiQ9HCJ0.
TreeFamiTF329702.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR019486. Argonaute_hook_dom.
IPR026805. GW182_M_dom.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR032226. TNRC6_PABC-bd.
IPR033499. TNRC6C.
IPR015940. UBA.
IPR009060. UBA-like.
[Graphical view]
PANTHERiPTHR13020:SF9. PTHR13020:SF9. 3 hits.
PfamiPF10427. Ago_hook. 1 hit.
PF12938. M_domain. 1 hit.
PF00076. RRM_1. 1 hit.
PF16608. TNRC6-PABC_bdg. 2 hits.
PF00627. UBA. 1 hit.
[Graphical view]
SMARTiSM00165. UBA. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
SSF54928. SSF54928. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HCJ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATGSAQGNF TGHTKKTNGN NGTNGALVQS PSNQSALGAG GANSNGSAAR
60 70 80 90 100
VWGVATGSSS GLAHCSVSGG DGKMDTMIGD GRSQNCWGAS NSNAGINLNL
110 120 130 140 150
NPNANPAAWP VLGHEGTVAT GNPSSICSPV SAIGQNMGNQ NGNPTGTLGA
160 170 180 190 200
WGNLLPQEST EPQTSTSQNV SFSAQPQNLN TDGPNNTNPM NSSPNPINAM
210 220 230 240 250
QTNGLPNWGM AVGMGAIIPP HLQGLPGANG SSVSQVSGGS AEGISNSVWG
260 270 280 290 300
LSPGNPATGN SNSGFSQGNG DTVNSALSAK QNGSSSAVQK EGSGGNAWDS
310 320 330 340 350
GPPAGPGILA WGRGSGNNGV GNIHSGAWGH PSRSTSNGVN GEWGKPPNQH
360 370 380 390 400
SNSDINGKGS TGWESPSVTS QNPTVQPGGE HMNSWAKAAS SGTTASEGSS
410 420 430 440 450
DGSGNHNEGS TGREGTGEGR RRDKGIIDQG HIQLPRNDLD PRVLSNTGWG
460 470 480 490 500
QTPVKQNTAW EFEESPRSER KNDNGTEAWG CAATQASNSG GKNDGSIMNS
510 520 530 540 550
TNTSSVSGWV NAPPAAVPAN TGWGDSNNKA PSGPGVWGDS ISSTAVSTAA
560 570 580 590 600
AAKSGHAWSG AANQEDKSPT WGEPPKPKSQ HWGDGQRSNP AWSAGGGDWA
610 620 630 640 650
DSSSVLGHLG DGKKNGSGWD ADSNRSGSGW NDTTRSGNSG WGNSTNTKAN
660 670 680 690 700
PGTNWGETLK PGPQQNWASK PQDNNVSNWG GAASVKQTGT GWIGGPVPVK
710 720 730 740 750
QKDSSEATGW EEPSPPSIRR KMEIDDGTSA WGDPSNYNNK TVNMWDRNNP
760 770 780 790 800
VIQSSTTTNT TTTTTTTTSN TTHRVETPPP HQAGTQLNRS PLLGPGRKVS
810 820 830 840 850
SGWGEMPNVH SKTENSWGEP SSPSTLVDNG TAAWGKPPSS GSGWGDHPAE
860 870 880 890 900
PPVAFGRAGA PVAASALCKP ASKSMQEGWG SGGDEMNLST SQWEDEEGDV
910 920 930 940 950
WNNAASQEST SSCSSWGNAP KKGLQKGMKT SGKQDEAWIM SRLIKQLTDM
960 970 980 990 1000
GFPREPAEEA LKSNNMNLDQ AMSALLEKKV DVDKRGLGVT DHNGMAAKPL
1010 1020 1030 1040 1050
GCRPPISKES SVDRPTFLDK DGGLVEEPTP SPFLPSPSLK LPLSHSALPS
1060 1070 1080 1090 1100
QALGGIASGL GMQNLNSSRQ IPSGNLGMFG NSGAAQARTM QQPPQPPVQP
1110 1120 1130 1140 1150
LNSSQPSLRA QVPQFLSPQV QAQLLQFAAK NIGLNPALLT SPINPQHMTM
1160 1170 1180 1190 1200
LNQLYQLQLA YQRLQIQQQM LQAQRNVSGS MRQQEQQVAR TITNLQQQIQ
1210 1220 1230 1240 1250
QHQRQLAQAL LVKQPPPPPP PPHLSLHPSA GKSAMDSFPS HPQTPGLPDL
1260 1270 1280 1290 1300
QTKEQQSSPN TFAPYPLAGL NPNMNVNSMD MTGGLSVKDP SQSQSRLPQW
1310 1320 1330 1340 1350
THPNSMDNLP SAASPLEQNP SKHGAIPGGL SIGPPGKSSI DDSYGRYDLI
1360 1370 1380 1390 1400
QNSESPASPP VAVPHSWSRA KSDSDKISNG SSINWPPEFH PGVPWKGLQN
1410 1420 1430 1440 1450
IDPENDPDVT PGSVPTGPTI NTTIQDVNRY LLKSGGKLSD IKSTWSSGPT
1460 1470 1480 1490 1500
SHTQASLSHE LWKVPRNSTA PTRPPPGLTN PKPSSTWGAS PLGWTSSYSS
1510 1520 1530 1540 1550
GSAWSTDTSG RTSSWLVLRN LTPQIDGSTL RTLCLQHGPL ITFHLNLTQG
1560 1570 1580 1590 1600
NAVVRYSSKE EAAKAQKSLH MCVLGNTTIL AEFAGEEEVN RFLAQGQALP
1610 1620 1630 1640 1650
PTSSWQSSSA SSQPRLSAAG SSHGLVRSDA GHWNAPCLGG KGSSELLWGG
1660 1670 1680 1690
VPQYSSSLWG PPSADDSRVI GSPTPLTTLL PGDLLSGESL
Length:1,690
Mass (Da):175,964
Last modified:February 20, 2007 - v3
Checksum:iC8230D65BFB1DA0B
GO
Isoform 2 (identifier: Q9HCJ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     796-798: Missing.
     1435-1435: G → GGSSPPSSQNATLPSSSAWPLSASGYSSSFSSIASAPSVA

Show »
Length:1,726
Mass (Da):179,321
Checksum:iE1C90F44281A7B52
GO

Sequence cautioni

The sequence BAB13408 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB71179 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti728 – 7281T → S in AAH45631 (PubMed:15489334).Curated
Sequence conflicti1231 – 12311G → C in AAH45631 (PubMed:15489334).Curated
Sequence conflicti1555 – 15551R → P in AAH45631 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti820 – 8201P → R.
Corresponds to variant rs34293811 [ dbSNP | Ensembl ].
VAR_052237

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei796 – 7983Missing in isoform 2. 2 PublicationsVSP_054230
Alternative sequencei1435 – 14351G → GGSSPPSSQNATLPSSSAWP LSASGYSSSFSSIASAPSVA in isoform 2. 2 PublicationsVSP_023322

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046802 mRNA. Translation: BAB13408.2. Different initiation.
AC021593 Genomic DNA. No translation available.
AC015804 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89480.1.
AL834429 mRNA. Translation: CAD39090.1.
BC045631 mRNA. Translation: AAH45631.1.
AK056421 mRNA. Translation: BAB71179.1. Different initiation.
CCDSiCCDS45798.1. [Q9HCJ0-1]
CCDS45799.1. [Q9HCJ0-2]
RefSeqiNP_001136112.1. NM_001142640.1. [Q9HCJ0-2]
NP_061869.2. NM_018996.3. [Q9HCJ0-1]
UniGeneiHs.569831.

Genome annotation databases

EnsembliENST00000301624; ENSP00000301624; ENSG00000078687. [Q9HCJ0-1]
ENST00000335749; ENSP00000336783; ENSG00000078687. [Q9HCJ0-2]
ENST00000588061; ENSP00000468647; ENSG00000078687. [Q9HCJ0-1]
ENST00000588847; ENSP00000467154; ENSG00000078687. [Q9HCJ0-2]
GeneIDi57690.
KEGGihsa:57690.
UCSCiuc002juc.3. human. [Q9HCJ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046802 mRNA. Translation: BAB13408.2. Different initiation.
AC021593 Genomic DNA. No translation available.
AC015804 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89480.1.
AL834429 mRNA. Translation: CAD39090.1.
BC045631 mRNA. Translation: AAH45631.1.
AK056421 mRNA. Translation: BAB71179.1. Different initiation.
CCDSiCCDS45798.1. [Q9HCJ0-1]
CCDS45799.1. [Q9HCJ0-2]
RefSeqiNP_001136112.1. NM_001142640.1. [Q9HCJ0-2]
NP_061869.2. NM_018996.3. [Q9HCJ0-1]
UniGeneiHs.569831.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DKLNMR-A927-998[»]
2X04X-ray1.49C/D1382-1399[»]
3KTPX-ray1.50B1380-1401[»]
ProteinModelPortaliQ9HCJ0.
SMRiQ9HCJ0. Positions 928-998, 1513-1593.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121716. 30 interactions.
DIPiDIP-48569N.
IntActiQ9HCJ0. 26 interactions.
MINTiMINT-2818544.
STRINGi9606.ENSP00000336783.

PTM databases

iPTMnetiQ9HCJ0.
PhosphoSiteiQ9HCJ0.

Polymorphism and mutation databases

BioMutaiTNRC6C.
DMDMi126253813.

Proteomic databases

EPDiQ9HCJ0.
MaxQBiQ9HCJ0.
PaxDbiQ9HCJ0.
PeptideAtlasiQ9HCJ0.
PRIDEiQ9HCJ0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301624; ENSP00000301624; ENSG00000078687. [Q9HCJ0-1]
ENST00000335749; ENSP00000336783; ENSG00000078687. [Q9HCJ0-2]
ENST00000588061; ENSP00000468647; ENSG00000078687. [Q9HCJ0-1]
ENST00000588847; ENSP00000467154; ENSG00000078687. [Q9HCJ0-2]
GeneIDi57690.
KEGGihsa:57690.
UCSCiuc002juc.3. human. [Q9HCJ0-1]

Organism-specific databases

CTDi57690.
GeneCardsiTNRC6C.
H-InvDBHIX0014215.
HGNCiHGNC:29318. TNRC6C.
HPAiHPA022007.
HPA062051.
MIMi610741. gene.
neXtProtiNX_Q9HCJ0.
PharmGKBiPA134880671.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFAU. Eukaryota.
ENOG41110AX. LUCA.
GeneTreeiENSGT00410000025966.
HOGENOMiHOG000049171.
HOVERGENiHBG062594.
InParanoidiQ9HCJ0.
KOiK18412.
OMAiHMNSWAK.
OrthoDBiEOG091G00G6.
PhylomeDBiQ9HCJ0.
TreeFamiTF329702.

Enzyme and pathway databases

ReactomeiR-HSA-1257604. PIP3 activates AKT signaling.
R-HSA-1912408. Pre-NOTCH Transcription and Translation.
R-HSA-2559580. Oxidative Stress Induced Senescence.
R-HSA-2559585. Oncogene Induced Senescence.
R-HSA-4086398. Ca2+ pathway.
R-HSA-426496. Post-transcriptional silencing by small RNAs.
R-HSA-5628897. TP53 Regulates Metabolic Genes.
R-HSA-5687128. MAPK6/MAPK4 signaling.

Miscellaneous databases

ChiTaRSiTNRC6C. human.
EvolutionaryTraceiQ9HCJ0.
GenomeRNAii57690.
PROiQ9HCJ0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000078687.
CleanExiHS_TNRC6C.
ExpressionAtlasiQ9HCJ0. baseline and differential.
GenevisibleiQ9HCJ0. HS.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR019486. Argonaute_hook_dom.
IPR026805. GW182_M_dom.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR032226. TNRC6_PABC-bd.
IPR033499. TNRC6C.
IPR015940. UBA.
IPR009060. UBA-like.
[Graphical view]
PANTHERiPTHR13020:SF9. PTHR13020:SF9. 3 hits.
PfamiPF10427. Ago_hook. 1 hit.
PF12938. M_domain. 1 hit.
PF00076. RRM_1. 1 hit.
PF16608. TNRC6-PABC_bdg. 2 hits.
PF00627. UBA. 1 hit.
[Graphical view]
SMARTiSM00165. UBA. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
SSF54928. SSF54928. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTNR6C_HUMAN
AccessioniPrimary (citable) accession number: Q9HCJ0
Secondary accession number(s): G3XAB8
, Q86UE5, Q8N3D8, Q96MU9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: February 20, 2007
Last modified: September 7, 2016
This is version 118 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.