Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 SUMO-protein ligase KIAA1586

Gene

KIAA1586

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

E3 SUMO-protein ligase; facilitates UBE2I/UBC9-mediated SUMO2 modification of target proteins (PubMed:26524493).

Pathwayi: protein sumoylation

This protein is involved in the pathway protein sumoylation, which is part of Protein modification.1 Publication
View all proteins of this organism that are known to be involved in the pathway protein sumoylation and in Protein modification.

GO - Molecular functioni

  • ligase activity Source: UniProtKB-KW
  • nucleic acid binding Source: InterPro
  • SUMO ligase activity Source: UniProtKB

GO - Biological processi

  • protein sumoylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00886.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 SUMO-protein ligase KIAA1586Curated (EC:6.3.2.-1 Publication)
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21360. KIAA1586.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134963244.

Polymorphism and mutation databases

BioMutaiKIAA1586.
DMDMi172045931.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 787787E3 SUMO-protein ligase KIAA1586PRO_0000320680Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki85 – 85Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ9HCI6.
PaxDbiQ9HCI6.
PeptideAtlasiQ9HCI6.
PRIDEiQ9HCI6.

PTM databases

iPTMnetiQ9HCI6.
PhosphoSiteiQ9HCI6.

Expressioni

Gene expression databases

BgeeiENSG00000168116.
CleanExiHS_KIAA1586.
ExpressionAtlasiQ9HCI6. baseline and differential.
GenevisibleiQ9HCI6. HS.

Organism-specific databases

HPAiHPA036370.
HPA042026.

Interactioni

Subunit structurei

Interacts with UBE2I/UBC9 and SUMO2.1 Publication

Protein-protein interaction databases

BioGridi121717. 3 interactions.
STRINGi9606.ENSP00000359768.

Structurei

3D structure databases

ProteinModelPortaliQ9HCI6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 223223Sufficient for E3 SUMO-protein ligase activityCuratedAdd
BLAST
Regioni30 – 378Interaction with SUMO2 1By similarity
Regioni42 – 509Interaction with SUMO2 2By similarity

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi38 – 414PSRPCurated

Domaini

Binds UBE2I/UBC9 and two SUMO2 molecules via its N-terminus. The most N-terminal region interacts with the SUMO2 chain that is covalently bound to the UBE2I/UBC9 active site, while the second region interacts with another SUMO2 that is non-covalently associated with the same UBE2I/UBC9 chain.By similarity1 Publication

Phylogenomic databases

eggNOGiENOG410IJ0S. Eukaryota.
ENOG410ZI9G. LUCA.
GeneTreeiENSGT00530000064154.
HOGENOMiHOG000113169.
HOVERGENiHBG102546.
InParanoidiQ9HCI6.
OMAiTYHSDIL.
OrthoDBiEOG091G0D2W.
PhylomeDBiQ9HCI6.
TreeFamiTF343259.

Family and domain databases

InterProiIPR026613. KRAB_dom_C2H2_Znf_fam.
IPR012337. RNaseH-like_dom.
[Graphical view]
PANTHERiPTHR23232. PTHR23232. 1 hit.
SUPFAMiSSF53098. SSF53098. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HCI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDPGSEIIE SVPPAGPEAS ESTTDENEDD IQFVSEGPSR PVLEYIDLVC
60 70 80 90 100
GDDENPSAYY SDILFPKMPK RQGDFLHFLN VKKVKTDTEN NEVSKNHCRL
110 120 130 140 150
SKAKEPHFEY IEQPIIEEKP SLSSKKEIDN LVLPDCWNEK QAFMFTEQYK
160 170 180 190 200
WLEIKEGKLG CKDCSAVRHL GSKAEKHVHV SKEWIAYLVT PNGSNKTTRQ
210 220 230 240 250
ASLRKKIREH DVSKAHGKIQ DLLKESTNDS ICNLVHKQNN KNIDATVKVF
260 270 280 290 300
NTVYSLVKHN RPLSDIEGAR ELQEKNGEVN CLNTRYSATR IAEHIAKEMK
310 320 330 340 350
MKIFKNIIEE NAKICIIIDE ASTVSKKTTL VIYLQCTIQS APAPVMLFVA
360 370 380 390 400
LKELVSTIAE CIVNTLLTTL NDCGFTNEYL KANLIAFCSD GANTILGRKS
410 420 430 440 450
GVATKLLENF PEIIIWNCLN HRLQLSLDDS ISEIKQINHL KIFIDKIYSI
460 470 480 490 500
YHQPNKNQTK LLGTVAKELE TEIIKIGRVM GPRWAACSLQ AATAVWHAYP
510 520 530 540 550
ILYMHFSHSY SGLAKRLANI NFLQDLALMI DILEEFSVLS TALQSRSTNI
560 570 580 590 600
KKAQKLIKRT IRALENLKIG TGKYESQIED LIKSDKFKDI PFNKNNKFNA
610 620 630 640 650
LPRSILLDNI IQHMNLRLLS DRNHEDIFNY FDLLEPSTWP YEEITSPWIA
660 670 680 690 700
GEKTLFHLCK ILKYEVDLND FREFVNNNIK SNNVSIPTTI YKAKKIVSTI
710 720 730 740 750
AINSAEAERG FNLMNIICTR VRNSLTIDHV SDLMTINLLG KELADWDATP
760 770 780
FVKSWSNCNH RLATDTRVRQ KSTKVFHENQ LAIWNLK
Length:787
Mass (Da):89,673
Last modified:February 26, 2008 - v2
Checksum:iECBFB636C2F7959E
GO
Isoform 2 (identifier: Q9HCI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPSRPVLEYIDLVCGDDENPSAYYSD → MNFTYICKIIFQ

Show »
Length:737
Mass (Da):84,557
Checksum:i210A170F1167888E
GO

Sequence cautioni

The sequence BAB13412 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751F → L.
Corresponds to variant rs36113897 [ dbSNP | Ensembl ].
VAR_039276
Natural varianti81 – 811V → M.
Corresponds to variant rs6926980 [ dbSNP | Ensembl ].
VAR_039277

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6262MGDPG…AYYSD → MNFTYICKIIFQ in isoform 2. 1 PublicationVSP_031740Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046806 mRNA. Translation: BAB13412.1. Different initiation.
AL450489 Genomic DNA. Translation: CAH71219.1.
BC041125 mRNA. Translation: AAH41125.1.
AK290988 mRNA. Translation: BAF83677.1.
CCDSiCCDS34480.1. [Q9HCI6-1]
RefSeqiNP_001273203.1. NM_001286274.1.
NP_001273204.1. NM_001286275.1.
NP_001273205.1. NM_001286276.1.
NP_065982.1. NM_020931.3. [Q9HCI6-1]
UniGeneiHs.709521.

Genome annotation databases

EnsembliENST00000370733; ENSP00000359768; ENSG00000168116. [Q9HCI6-1]
GeneIDi57691.
KEGGihsa:57691.
UCSCiuc003pdj.5. human. [Q9HCI6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046806 mRNA. Translation: BAB13412.1. Different initiation.
AL450489 Genomic DNA. Translation: CAH71219.1.
BC041125 mRNA. Translation: AAH41125.1.
AK290988 mRNA. Translation: BAF83677.1.
CCDSiCCDS34480.1. [Q9HCI6-1]
RefSeqiNP_001273203.1. NM_001286274.1.
NP_001273204.1. NM_001286275.1.
NP_001273205.1. NM_001286276.1.
NP_065982.1. NM_020931.3. [Q9HCI6-1]
UniGeneiHs.709521.

3D structure databases

ProteinModelPortaliQ9HCI6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121717. 3 interactions.
STRINGi9606.ENSP00000359768.

PTM databases

iPTMnetiQ9HCI6.
PhosphoSiteiQ9HCI6.

Polymorphism and mutation databases

BioMutaiKIAA1586.
DMDMi172045931.

Proteomic databases

MaxQBiQ9HCI6.
PaxDbiQ9HCI6.
PeptideAtlasiQ9HCI6.
PRIDEiQ9HCI6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370733; ENSP00000359768; ENSG00000168116. [Q9HCI6-1]
GeneIDi57691.
KEGGihsa:57691.
UCSCiuc003pdj.5. human. [Q9HCI6-1]

Organism-specific databases

CTDi57691.
GeneCardsiKIAA1586.
HGNCiHGNC:21360. KIAA1586.
HPAiHPA036370.
HPA042026.
neXtProtiNX_Q9HCI6.
PharmGKBiPA134963244.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ0S. Eukaryota.
ENOG410ZI9G. LUCA.
GeneTreeiENSGT00530000064154.
HOGENOMiHOG000113169.
HOVERGENiHBG102546.
InParanoidiQ9HCI6.
OMAiTYHSDIL.
OrthoDBiEOG091G0D2W.
PhylomeDBiQ9HCI6.
TreeFamiTF343259.

Enzyme and pathway databases

UniPathwayiUPA00886.

Miscellaneous databases

GenomeRNAii57691.
PROiQ9HCI6.

Gene expression databases

BgeeiENSG00000168116.
CleanExiHS_KIAA1586.
ExpressionAtlasiQ9HCI6. baseline and differential.
GenevisibleiQ9HCI6. HS.

Family and domain databases

InterProiIPR026613. KRAB_dom_C2H2_Znf_fam.
IPR012337. RNaseH-like_dom.
[Graphical view]
PANTHERiPTHR23232. PTHR23232. 1 hit.
SUPFAMiSSF53098. SSF53098. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiK1586_HUMAN
AccessioniPrimary (citable) accession number: Q9HCI6
Secondary accession number(s): A8K4M3, Q8IW25
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: September 7, 2016
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.