Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lateral signaling target protein 2 homolog

Gene

ZFYVE28

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Negative regulator of epidermal growth factor receptor (EGFR) signaling. Acts by promoting EGFR degradation in endosomes when not monoubiquitinated.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri817 – 87963FYVE-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • phosphatidylinositol-3-phosphate binding Source: UniProtKB

GO - Biological processi

  • negative regulation of epidermal growth factor-activated receptor activity Source: UniProtKB
  • negative regulation of epidermal growth factor receptor signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Lateral signaling target protein 2 homolog
Short name:
hLst2
Alternative name(s):
Zinc finger FYVE domain-containing protein 28
Gene namesi
Name:ZFYVE28
Synonyms:KIAA1643, LST2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:29334. ZFYVE28.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • early endosome membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi87 – 871K → R: Abolishes monoubiquitination and promotes localization to early endosomes. 1 Publication
Mutagenesisi823 – 8231C → A: Abolishes binding to phosphatidylinositol 3-phosphate (PI3P). 1 Publication

Organism-specific databases

PharmGKBiPA134904138.

Polymorphism and mutation databases

BioMutaiZFYVE28.
DMDMi251757462.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 887887Lateral signaling target protein 2 homologPRO_0000098722Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki87 – 87Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Modified residuei334 – 3341PhosphoserineCombined sources
Modified residuei516 – 5161PhosphothreonineCombined sources
Modified residuei586 – 5861Phosphoserine; by MAP2K1 Publication
Modified residuei870 – 8701Phosphothreonine; by MAP2K1 Publication

Post-translational modificationi

Monoubiquitination at Lys-87 prevents binding to phosphatidylinositol 3-phosphate (PI3P) and localization to early endosome membranes.

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ9HCC9.
PeptideAtlasiQ9HCC9.
PRIDEiQ9HCC9.

PTM databases

iPTMnetiQ9HCC9.
PhosphoSiteiQ9HCC9.

Expressioni

Gene expression databases

BgeeiQ9HCC9.
CleanExiHS_ZFYVE28.
ExpressionAtlasiQ9HCC9. baseline and differential.
GenevisibleiQ9HCC9. HS.

Organism-specific databases

HPAiHPA038175.
HPA057587.

Interactioni

Subunit structurei

Interacts with TRIM3.1 Publication

Protein-protein interaction databases

BioGridi121752. 7 interactions.
IntActiQ9HCC9. 1 interaction.
STRINGi9606.ENSP00000290974.

Structurei

3D structure databases

ProteinModelPortaliQ9HCC9.
SMRiQ9HCC9. Positions 763-873.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The FYVE-type zinc finger mediates the interaction with phosphatidylinositol 3-phosphate (PI3P) and localization to early endosome membranes when not monoubiquitinated at Lys-87.1 Publication

Sequence similaritiesi

Belongs to the lst-2 family.Curated
Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri817 – 87963FYVE-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG1819. Eukaryota.
ENOG410XNYQ. LUCA.
GeneTreeiENSGT00840000129741.
HOGENOMiHOG000185867.
InParanoidiQ9HCC9.
OMAiFGWAGST.
OrthoDBiEOG7RFTGP.
PhylomeDBiQ9HCC9.
TreeFamiTF320752.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR000306. Znf_FYVE.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF01363. FYVE. 1 hit.
[Graphical view]
SMARTiSM00064. FYVE. 1 hit.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 1 hit.
PROSITEiPS50178. ZF_FYVE. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HCC9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMNRFRKWLY KPKRSDPQLL ARFYYADEEL NQVAAELDSL DGRKDPQRCT
60 70 80 90 100
LLVSQFRSCQ DNVLNIINQI MDECIPQDRA PRDFCVKFPE EIRHDNLAGQ
110 120 130 140 150
LWFGAECLAA GSIIMNRELE SMAMRPLAKE LTRSLEDVRG ALRDQALRDL
160 170 180 190 200
NTYTEKMREA LRHFDVLFAE FELSYVSAMV PVKSPREYYV QQEVIVLFCE
210 220 230 240 250
TVERALDFGY LTQDMIDDYE PALMFSIPRL AIVCGLVVYA DGPLNLDRKV
260 270 280 290 300
EDMSELFRPF HTLLRKIRDL LQTLTEEELH TLERNLCISQ DVEFPIRADV
310 320 330 340 350
QGPAALAPAL SAPLPPEGPL SAKAKDPDAE LACSMQYDDQ ELEQLSRMVH
360 370 380 390 400
RAGDEMSSLL SPPIACQSPA HRPGAEGSPG GEASPGRPRL RSGSDEEERV
410 420 430 440 450
FFMDDVEGTA EALARPESPA GPFGWAGSTW ADPQEKGQGG PGGAAGISLP
460 470 480 490 500
ASEKEEDLSN NNLEAEGTDG ASLAGTSSCS CLDSRLHLDG WEVGADDAET
510 520 530 540 550
AEMIAHRTGG MKLSATVIFN PKSPTSLDSA VATQEAASEP VAEGMDGGPH
560 570 580 590 600
KLSTGATNCL LHSCVCCGSC GDSREDVVER LREKCSPGGV IGASYAAGLA
610 620 630 640 650
KASDRAPERQ EEAPPPSEDA SNGREPKAPT SDKCLPHTSG SQVDTASGLQ
660 670 680 690 700
GEAGVAGQQE PEARELHAGS PSAHEAPQAL SGSSSSTAGS CSSDKMGPEA
710 720 730 740 750
APAATHAAPQ ATREKIRSRF HGSHDLIHRL FVCISGVADQ LQTNYASDLR
760 770 780 790 800
SILKTLFEVM ATKPETDDKE KLRKVTQTLR SAALEDCALC QETLSSSELA
810 820 830 840 850
AKTRDGDFED PPEWVPDEAC GFCTACKAPF TVIRRKHHCR SCGKIFCSRC
860 870 880
SSHSAPLPRY GQVKPVRVCT HCYMFHVTPF YSDKAGL
Length:887
Mass (Da):96,490
Last modified:July 7, 2009 - v3
Checksum:iEAF3A26A50FF26F5
GO
Isoform 2 (identifier: Q9HCC9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-234: RALDFGYLTQDMIDDYEPALMFSIPRLAIVC → S

Note: No experimental confirmation available.
Show »
Length:857
Mass (Da):93,017
Checksum:iBC421651F2F690EF
GO
Isoform 3 (identifier: Q9HCC9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Note: No experimental confirmation available.
Show »
Length:817
Mass (Da):88,144
Checksum:iE37482D0F2C1797A
GO
Isoform 4 (identifier: Q9HCC9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     204-234: RALDFGYLTQDMIDDYEPALMFSIPRLAIVC → S

Note: No experimental confirmation available.
Show »
Length:787
Mass (Da):84,671
Checksum:i159ED7DEFBA6AD59
GO
Isoform 5 (identifier: Q9HCC9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.

Note: No experimental confirmation available.
Show »
Length:773
Mass (Da):83,198
Checksum:i18C28D3588B26C8D
GO
Isoform 6 (identifier: Q9HCC9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     235-287: GLVVYADGPL...ELHTLERNLC → PLLPAHPRTR...LLRPLPELPP
     288-887: Missing.

Note: No experimental confirmation available.
Show »
Length:287
Mass (Da):32,724
Checksum:i282C75F9AD623A41
GO
Isoform 7 (identifier: Q9HCC9-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-60: Missing.
     205-219: ALDFGYLTQDMIDDY → NGKGVLKFMWNCNGP
     220-887: Missing.

Note: No experimental confirmation available.
Show »
Length:172
Mass (Da):20,170
Checksum:i03C358A6528554EA
GO
Isoform 8 (identifier: Q9HCC9-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     234-887: Missing.

Note: No experimental confirmation available.
Show »
Length:163
Mass (Da):18,907
Checksum:iF7B967E97FEEC3C4
GO

Sequence cautioni

The sequence AAH53664.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB13469.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti157 – 1571M → I in BAG54362 (PubMed:14702039).Curated
Sequence conflicti306 – 3061L → P in BAH14855 (PubMed:14702039).Curated
Sequence conflicti335 – 3351M → I in BAH11855 (PubMed:14702039).Curated
Sequence conflicti341 – 3411E → G in BAG54362 (PubMed:14702039).Curated
Sequence conflicti453 – 4531E → D in BAH14855 (PubMed:14702039).Curated
Sequence conflicti679 – 6791A → G in BAG54362 (PubMed:14702039).Curated
Sequence conflicti700 – 7001A → P in BAH11855 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti603 – 6031S → N.1 Publication
Corresponds to variant rs17768776 [ dbSNP | Ensembl ].
VAR_052988
Natural varianti672 – 6721S → P.3 Publications
Corresponds to variant rs661301 [ dbSNP | Ensembl ].
VAR_052989

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 114114Missing in isoform 5. 1 PublicationVSP_037614Add
BLAST
Alternative sequencei1 – 7070Missing in isoform 3, isoform 4 and isoform 8. 2 PublicationsVSP_037615Add
BLAST
Alternative sequencei14 – 6047Missing in isoform 7. 1 PublicationVSP_046092Add
BLAST
Alternative sequencei204 – 23431RALDF…LAIVC → S in isoform 2 and isoform 4. 1 PublicationVSP_037616Add
BLAST
Alternative sequencei205 – 21915ALDFG…MIDDY → NGKGVLKFMWNCNGP in isoform 7. 1 PublicationVSP_046093Add
BLAST
Alternative sequencei220 – 887668Missing in isoform 7. 1 PublicationVSP_046094Add
BLAST
Alternative sequencei234 – 887654Missing in isoform 8. 1 PublicationVSP_046379Add
BLAST
Alternative sequencei235 – 28753GLVVY…ERNLC → PLLPAHPRTRAGATAHVACR MVAGSSSGALTHPPVSKQGV ISALLRPLPELPP in isoform 6. 1 PublicationVSP_045805Add
BLAST
Alternative sequencei288 – 887600Missing in isoform 6. 1 PublicationVSP_045806Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046863 mRNA. Translation: BAB13469.1. Different initiation.
AK126692 mRNA. Translation: BAG54362.1.
AK293775 mRNA. Translation: BAH11593.1.
AK294710 mRNA. Translation: BAH11855.1.
AK294874 mRNA. Translation: BAH11908.1.
AK316484 mRNA. Translation: BAH14855.1.
AL158068 Genomic DNA. No translation available.
AL645924 Genomic DNA. No translation available.
BC032605 mRNA. No translation available.
BC035793 mRNA. No translation available.
BC053664 mRNA. Translation: AAH53664.1. Different initiation.
BC137309 mRNA. Translation: AAI37310.1.
BC137310 mRNA. Translation: AAI37311.1.
CCDSiCCDS33942.1. [Q9HCC9-1]
CCDS54708.1. [Q9HCC9-3]
CCDS54709.1. [Q9HCC9-8]
CCDS54710.1. [Q9HCC9-7]
CCDS54711.1. [Q9HCC9-2]
CCDS54712.1. [Q9HCC9-6]
RefSeqiNP_001166127.1. NM_001172656.1. [Q9HCC9-2]
NP_001166128.1. NM_001172657.1. [Q9HCC9-6]
NP_001166129.1. NM_001172658.1. [Q9HCC9-7]
NP_001166130.1. NM_001172659.1. [Q9HCC9-3]
NP_001166131.1. NM_001172660.1. [Q9HCC9-8]
NP_066023.2. NM_020972.2. [Q9HCC9-1]
UniGeneiHs.292056.

Genome annotation databases

EnsembliENST00000290974; ENSP00000290974; ENSG00000159733. [Q9HCC9-1]
ENST00000503000; ENSP00000423694; ENSG00000159733. [Q9HCC9-6]
ENST00000509171; ENSP00000422638; ENSG00000159733. [Q9HCC9-7]
ENST00000511071; ENSP00000425706; ENSG00000159733. [Q9HCC9-2]
ENST00000515169; ENSP00000425766; ENSG00000159733. [Q9HCC9-8]
ENST00000515312; ENSP00000426299; ENSG00000159733. [Q9HCC9-3]
GeneIDi57732.
KEGGihsa:57732.
UCSCiuc003gex.3. human. [Q9HCC9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046863 mRNA. Translation: BAB13469.1. Different initiation.
AK126692 mRNA. Translation: BAG54362.1.
AK293775 mRNA. Translation: BAH11593.1.
AK294710 mRNA. Translation: BAH11855.1.
AK294874 mRNA. Translation: BAH11908.1.
AK316484 mRNA. Translation: BAH14855.1.
AL158068 Genomic DNA. No translation available.
AL645924 Genomic DNA. No translation available.
BC032605 mRNA. No translation available.
BC035793 mRNA. No translation available.
BC053664 mRNA. Translation: AAH53664.1. Different initiation.
BC137309 mRNA. Translation: AAI37310.1.
BC137310 mRNA. Translation: AAI37311.1.
CCDSiCCDS33942.1. [Q9HCC9-1]
CCDS54708.1. [Q9HCC9-3]
CCDS54709.1. [Q9HCC9-8]
CCDS54710.1. [Q9HCC9-7]
CCDS54711.1. [Q9HCC9-2]
CCDS54712.1. [Q9HCC9-6]
RefSeqiNP_001166127.1. NM_001172656.1. [Q9HCC9-2]
NP_001166128.1. NM_001172657.1. [Q9HCC9-6]
NP_001166129.1. NM_001172658.1. [Q9HCC9-7]
NP_001166130.1. NM_001172659.1. [Q9HCC9-3]
NP_001166131.1. NM_001172660.1. [Q9HCC9-8]
NP_066023.2. NM_020972.2. [Q9HCC9-1]
UniGeneiHs.292056.

3D structure databases

ProteinModelPortaliQ9HCC9.
SMRiQ9HCC9. Positions 763-873.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121752. 7 interactions.
IntActiQ9HCC9. 1 interaction.
STRINGi9606.ENSP00000290974.

PTM databases

iPTMnetiQ9HCC9.
PhosphoSiteiQ9HCC9.

Polymorphism and mutation databases

BioMutaiZFYVE28.
DMDMi251757462.

Proteomic databases

PaxDbiQ9HCC9.
PeptideAtlasiQ9HCC9.
PRIDEiQ9HCC9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000290974; ENSP00000290974; ENSG00000159733. [Q9HCC9-1]
ENST00000503000; ENSP00000423694; ENSG00000159733. [Q9HCC9-6]
ENST00000509171; ENSP00000422638; ENSG00000159733. [Q9HCC9-7]
ENST00000511071; ENSP00000425706; ENSG00000159733. [Q9HCC9-2]
ENST00000515169; ENSP00000425766; ENSG00000159733. [Q9HCC9-8]
ENST00000515312; ENSP00000426299; ENSG00000159733. [Q9HCC9-3]
GeneIDi57732.
KEGGihsa:57732.
UCSCiuc003gex.3. human. [Q9HCC9-1]

Organism-specific databases

CTDi57732.
GeneCardsiZFYVE28.
HGNCiHGNC:29334. ZFYVE28.
HPAiHPA038175.
HPA057587.
MIMi614176. gene.
neXtProtiNX_Q9HCC9.
PharmGKBiPA134904138.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1819. Eukaryota.
ENOG410XNYQ. LUCA.
GeneTreeiENSGT00840000129741.
HOGENOMiHOG000185867.
InParanoidiQ9HCC9.
OMAiFGWAGST.
OrthoDBiEOG7RFTGP.
PhylomeDBiQ9HCC9.
TreeFamiTF320752.

Miscellaneous databases

GenomeRNAii57732.
PROiQ9HCC9.
SOURCEiSearch...

Gene expression databases

BgeeiQ9HCC9.
CleanExiHS_ZFYVE28.
ExpressionAtlasiQ9HCC9. baseline and differential.
GenevisibleiQ9HCC9. HS.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR000306. Znf_FYVE.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF01363. FYVE. 1 hit.
[Graphical view]
SMARTiSM00064. FYVE. 1 hit.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 1 hit.
PROSITEiPS50178. ZF_FYVE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-672.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5), VARIANTS ASN-603 AND PRO-672.
    Tissue: Brain, Cerebellum and Thymus.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 6; 7 AND 8), VARIANT PRO-672.
    Tissue: Leiomyosarcoma, Ovary and Pancreas.
  5. "Monoubiquitinylation regulates endosomal localization of Lst2, a negative regulator of EGF receptor signaling."
    Mosesson Y., Chetrit D., Schley L., Berghoff J., Ziv T., Carvalho S., Milanezi F., Admon A., Schmitt F., Ehrlich M., Yarden Y.
    Dev. Cell 16:687-698(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, DOMAIN FYVE-TYPE ZINC-FINGER, INTERACTION WITH TRIM3, PHOSPHORYLATION AT SER-586 AND THR-870, UBIQUITINATION AT LYS-87, MUTAGENESIS OF LYS-87 AND CYS-823.
  6. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-334 AND THR-516, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Erythroleukemia.

Entry informationi

Entry nameiLST2_HUMAN
AccessioniPrimary (citable) accession number: Q9HCC9
Secondary accession number(s): B2RP83
, B3KX50, B7Z1Q7, B7Z2G9, B7Z2M2, B7ZB19, E9PB54, E9PB64, E9PG77, Q7Z6J3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: July 7, 2009
Last modified: July 6, 2016
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.