Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HCC8

- GDPD2_HUMAN

UniProt

Q9HCC8 - GDPD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Glycerophosphoinositol inositolphosphodiesterase GDPD2

Gene

GDPD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Has glycerophosphoinositol inositolphosphodiesterase activity and specifically hydrolyzes glycerophosphoinositol, with no activity for other substrates such as glycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine, and glycerophosphoserine. Accelerates the program of osteoblast differentiation and growth. May play a role in remodeling of the actin cytoskeleton (By similarity).By similarity

Catalytic activityi

1-(sn-glycero-3-phospho)-1D-myo-inositol + H2O = glycerol + 1D-myo-inositol 1-phosphate.

Cofactori

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi256 – 2561Divalent metal cationSequence Analysis
Metal bindingi258 – 2581Divalent metal cationSequence Analysis
Metal bindingi271 – 2711Divalent metal cationSequence Analysis

GO - Molecular functioni

  1. glycerophosphodiester phosphodiesterase activity Source: InterPro
  2. glycerophosphoinositol inositolphosphodiesterase activity Source: UniProtKB-EC
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. glycerol metabolic process Source: InterPro
  2. lipid metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.46. 3474.

Names & Taxonomyi

Protein namesi
Recommended name:
Glycerophosphoinositol inositolphosphodiesterase GDPD2 (EC:3.1.4.43)
Alternative name(s):
Glycerophosphodiester phosphodiesterase 3
Glycerophosphodiester phosphodiesterase domain-containing protein 2
Osteoblast differentiation promoting factor
Gene namesi
Name:GDPD2
Synonyms:GDE3, OBDPF
ORF Names:UNQ1935/PRO4418
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:25974. GDPD2.

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasmcytoskeleton By similarity
Note: Colocalizes with the actin cytoskeleton.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3838CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei39 – 5921HelicalSequence AnalysisAdd
BLAST
Topological domaini60 – 8526ExtracellularSequence AnalysisAdd
BLAST
Transmembranei86 – 10621HelicalSequence AnalysisAdd
BLAST
Topological domaini107 – 12115CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei122 – 14221HelicalSequence AnalysisAdd
BLAST
Topological domaini143 – 15412ExtracellularSequence AnalysisAdd
BLAST
Transmembranei155 – 17521HelicalSequence AnalysisAdd
BLAST
Topological domaini176 – 18813CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei189 – 20921HelicalSequence AnalysisAdd
BLAST
Topological domaini210 – 490281ExtracellularSequence AnalysisAdd
BLAST
Transmembranei491 – 51121HelicalSequence AnalysisAdd
BLAST
Topological domaini512 – 53928CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB-KW
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134907263.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 539539Glycerophosphoinositol inositolphosphodiesterase GDPD2PRO_0000251934Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi442 – 4421N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9HCC8.
PRIDEiQ9HCC8.

PTM databases

PhosphoSiteiQ9HCC8.

Expressioni

Gene expression databases

BgeeiQ9HCC8.
CleanExiHS_GDPD2.
GenevestigatoriQ9HCC8.

Organism-specific databases

HPAiHPA045026.

Interactioni

Protein-protein interaction databases

BioGridi120207. 4 interactions.
IntActiQ9HCC8. 41 interactions.
MINTiMINT-1426959.
STRINGi9606.ENSP00000363503.

Structurei

3D structure databases

ProteinModelPortaliQ9HCC8.
SMRiQ9HCC8. Positions 226-377.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini224 – 479256GP-PDEAdd
BLAST

Sequence similaritiesi

Contains 1 GP-PDE domain.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0584.
GeneTreeiENSGT00510000046457.
HOGENOMiHOG000232101.
HOVERGENiHBG081551.
InParanoidiQ9HCC8.
KOiK01124.
OMAiIKALHQD.
OrthoDBiEOG7F511B.
PhylomeDBiQ9HCC8.
TreeFamiTF313692.

Family and domain databases

Gene3Di3.20.20.190. 1 hit.
InterProiIPR004129. GlyceroP-diester-Pdiesterase.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
[Graphical view]
PANTHERiPTHR23344. PTHR23344. 1 hit.
SUPFAMiSSF51695. SSF51695. 1 hit.
PROSITEiPS51704. GP_PDE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HCC8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAESPGCCSV WARCLHCLYS CHWRKCPRER MQTSKCDCIW FGLLFLTFLL
60 70 80 90 100
SLSWLYIGLV LLNDLHNFNE FLFRRWGHWM DWSLAFLLVI SLLVTYASLL
110 120 130 140 150
LVLALLLRLC RQPLHLHSLH KVLLLLIMLL VAAGLVGLDI QWQQEWHSLR
160 170 180 190 200
VSLQATAPFL HIGAAAGIAL LAWPVADTFY RIHRRGPKIL LLLLFFGVVL
210 220 230 240 250
VIYLAPLCIS SPCIMEPRDL PPKPGLVGHR GAPMLAPENT LMSLRKTAEC
260 270 280 290 300
GATVFETDVM VSSDGVPFLM HDEHLSRTTN VASVFPTRIT AHSSDFSWTE
310 320 330 340 350
LKRLNAGSWF LERRPFWGAK PLAGPDQKEA ESQTVPALEE LLEEAAALNL
360 370 380 390 400
SIMFDLRRPP QNHTYYDTFV IQTLETVLNA RVPQAMVFWL PDEDRANVQR
410 420 430 440 450
RAPGMRQIYG RQGGNRTERP QFLNLPYQDL PLLDIKALHK DNVSVNLFVV
460 470 480 490 500
NKPWLFSLLW CAGVDSVTTN DCQLLQQMRY PIWLITPQTY LIIWVITNCV
510 520 530
STMLLLWTFL LQRRFVKKRG KTGLETAVLL TRINNFMME
Length:539
Mass (Da):61,729
Last modified:March 1, 2001 - v1
Checksum:i8271C3A74766D540
GO
Isoform 2 (identifier: Q9HCC8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-79: Missing.

Note: No experimental confirmation available.

Show »
Length:460
Mass (Da):52,186
Checksum:i16081E6BAB94B16A
GO
Isoform 3 (identifier: Q9HCC8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-436: K → KDRFLLPAQAGLKLLASSNLPASASQSAGITGLSHCPPQPPGYKHELSHLAM

Note: No experimental confirmation available.

Show »
Length:590
Mass (Da):66,991
Checksum:i1DC750F7411D9FDA
GO

Sequence cautioni

The sequence BAA91014.1 differs from that shown. Reason: Frameshift at position 397. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti418 – 4181E → G in BAA91014. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7979Missing in isoform 2. 1 PublicationVSP_042622Add
BLAST
Alternative sequencei436 – 4361K → KDRFLLPAQAGLKLLASSNL PASASQSAGITGLSHCPPQP PGYKHELSHLAM in isoform 3. 1 PublicationVSP_042623

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB048363 mRNA. Translation: BAB13350.1.
AY358986 mRNA. Translation: AAQ89345.1.
AK000214 mRNA. Translation: BAA91014.1. Frameshift.
AK299255 mRNA. Translation: BAG61286.1.
AK301025 mRNA. Translation: BAG62641.1.
AK316035 mRNA. Translation: BAH14406.1.
AL139398 Genomic DNA. Translation: CAI41020.1.
BC032009 mRNA. Translation: AAH32009.1.
CCDSiCCDS14402.1. [Q9HCC8-1]
CCDS55437.1. [Q9HCC8-3]
CCDS55438.1. [Q9HCC8-2]
RefSeqiNP_001164662.1. NM_001171191.1. [Q9HCC8-2]
NP_001164663.1. NM_001171192.1. [Q9HCC8-3]
NP_001164664.1. NM_001171193.1. [Q9HCC8-2]
NP_060181.2. NM_017711.3. [Q9HCC8-1]
UniGeneiHs.438712.

Genome annotation databases

EnsembliENST00000374382; ENSP00000363503; ENSG00000130055. [Q9HCC8-1]
ENST00000453994; ENSP00000414019; ENSG00000130055. [Q9HCC8-3]
ENST00000536730; ENSP00000445982; ENSG00000130055. [Q9HCC8-2]
ENST00000538649; ENSP00000444601; ENSG00000130055. [Q9HCC8-2]
GeneIDi54857.
KEGGihsa:54857.
UCSCiuc004dyh.3. human. [Q9HCC8-1]
uc011mpk.2. human. [Q9HCC8-3]

Polymorphism databases

DMDMi74752794.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB048363 mRNA. Translation: BAB13350.1 .
AY358986 mRNA. Translation: AAQ89345.1 .
AK000214 mRNA. Translation: BAA91014.1 . Frameshift.
AK299255 mRNA. Translation: BAG61286.1 .
AK301025 mRNA. Translation: BAG62641.1 .
AK316035 mRNA. Translation: BAH14406.1 .
AL139398 Genomic DNA. Translation: CAI41020.1 .
BC032009 mRNA. Translation: AAH32009.1 .
CCDSi CCDS14402.1. [Q9HCC8-1 ]
CCDS55437.1. [Q9HCC8-3 ]
CCDS55438.1. [Q9HCC8-2 ]
RefSeqi NP_001164662.1. NM_001171191.1. [Q9HCC8-2 ]
NP_001164663.1. NM_001171192.1. [Q9HCC8-3 ]
NP_001164664.1. NM_001171193.1. [Q9HCC8-2 ]
NP_060181.2. NM_017711.3. [Q9HCC8-1 ]
UniGenei Hs.438712.

3D structure databases

ProteinModelPortali Q9HCC8.
SMRi Q9HCC8. Positions 226-377.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120207. 4 interactions.
IntActi Q9HCC8. 41 interactions.
MINTi MINT-1426959.
STRINGi 9606.ENSP00000363503.

PTM databases

PhosphoSitei Q9HCC8.

Polymorphism databases

DMDMi 74752794.

Proteomic databases

PaxDbi Q9HCC8.
PRIDEi Q9HCC8.

Protocols and materials databases

DNASUi 54857.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000374382 ; ENSP00000363503 ; ENSG00000130055 . [Q9HCC8-1 ]
ENST00000453994 ; ENSP00000414019 ; ENSG00000130055 . [Q9HCC8-3 ]
ENST00000536730 ; ENSP00000445982 ; ENSG00000130055 . [Q9HCC8-2 ]
ENST00000538649 ; ENSP00000444601 ; ENSG00000130055 . [Q9HCC8-2 ]
GeneIDi 54857.
KEGGi hsa:54857.
UCSCi uc004dyh.3. human. [Q9HCC8-1 ]
uc011mpk.2. human. [Q9HCC8-3 ]

Organism-specific databases

CTDi 54857.
GeneCardsi GC0XP069642.
HGNCi HGNC:25974. GDPD2.
HPAi HPA045026.
neXtProti NX_Q9HCC8.
PharmGKBi PA134907263.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0584.
GeneTreei ENSGT00510000046457.
HOGENOMi HOG000232101.
HOVERGENi HBG081551.
InParanoidi Q9HCC8.
KOi K01124.
OMAi IKALHQD.
OrthoDBi EOG7F511B.
PhylomeDBi Q9HCC8.
TreeFami TF313692.

Enzyme and pathway databases

BRENDAi 3.1.4.46. 3474.

Miscellaneous databases

GenomeRNAii 54857.
NextBioi 57728.
PROi Q9HCC8.

Gene expression databases

Bgeei Q9HCC8.
CleanExi HS_GDPD2.
Genevestigatori Q9HCC8.

Family and domain databases

Gene3Di 3.20.20.190. 1 hit.
InterProi IPR004129. GlyceroP-diester-Pdiesterase.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
[Graphical view ]
PANTHERi PTHR23344. PTHR23344. 1 hit.
SUPFAMi SSF51695. SSF51695. 1 hit.
PROSITEi PS51704. GP_PDE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Novel membrane protein containing glycerophosphodiester phosphodiesterase motif is transiently expressed during osteoblast differentiation."
    Yanaka N., Imai Y., Kawai E., Akatsuka H., Wakimoto K., Nogusa Y., Kato N., Chiba H., Kotani E., Omori K., Sakurai N.
    J. Biol. Chem. 278:43595-43602(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Spleen.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Caudate nucleus, Colon mucosa and Spleen.
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin.

Entry informationi

Entry nameiGDPD2_HUMAN
AccessioniPrimary (citable) accession number: Q9HCC8
Secondary accession number(s): B4DRH4, B4DVC9, Q9NXJ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 1, 2001
Last modified: November 26, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3