Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HCC8

- GDPD2_HUMAN

UniProt

Q9HCC8 - GDPD2_HUMAN

Protein

Glycerophosphoinositol inositolphosphodiesterase GDPD2

Gene

GDPD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has glycerophosphoinositol inositolphosphodiesterase activity and specifically hydrolyzes glycerophosphoinositol, with no activity for other substrates such as glycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine, and glycerophosphoserine. Accelerates the program of osteoblast differentiation and growth. May play a role in remodeling of the actin cytoskeleton By similarity.By similarity

    Catalytic activityi

    1-(sn-glycero-3-phospho)-1D-myo-inositol + H2O = glycerol + 1D-myo-inositol 1-phosphate.

    Cofactori

    Calcium.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi256 – 2561Divalent metal cationSequence Analysis
    Metal bindingi258 – 2581Divalent metal cationSequence Analysis
    Metal bindingi271 – 2711Divalent metal cationSequence Analysis

    GO - Molecular functioni

    1. glycerophosphodiester phosphodiesterase activity Source: InterPro
    2. glycerophosphoinositol inositolphosphodiesterase activity Source: UniProtKB-EC
    3. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. glycerol metabolic process Source: InterPro
    2. lipid metabolic process Source: InterPro

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    Metal-binding

    Enzyme and pathway databases

    BRENDAi3.1.4.46. 3474.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Glycerophosphoinositol inositolphosphodiesterase GDPD2 (EC:3.1.4.43)
    Alternative name(s):
    Glycerophosphodiester phosphodiesterase 3
    Glycerophosphodiester phosphodiesterase domain-containing protein 2
    Osteoblast differentiation promoting factor
    Gene namesi
    Name:GDPD2
    Synonyms:GDE3, OBDPF
    ORF Names:UNQ1935/PRO4418
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:25974. GDPD2.

    Subcellular locationi

    Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasmcytoskeleton By similarity
    Note: Colocalizes with the actin cytoskeleton.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. cytoskeleton Source: UniProtKB-SubCell
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134907263.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 539539Glycerophosphoinositol inositolphosphodiesterase GDPD2PRO_0000251934Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi442 – 4421N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9HCC8.
    PRIDEiQ9HCC8.

    PTM databases

    PhosphoSiteiQ9HCC8.

    Expressioni

    Gene expression databases

    BgeeiQ9HCC8.
    CleanExiHS_GDPD2.
    GenevestigatoriQ9HCC8.

    Organism-specific databases

    HPAiHPA045026.

    Interactioni

    Protein-protein interaction databases

    BioGridi120207. 4 interactions.
    IntActiQ9HCC8. 41 interactions.
    MINTiMINT-1426959.
    STRINGi9606.ENSP00000363503.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9HCC8.
    SMRiQ9HCC8. Positions 226-377.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3838CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini60 – 8526ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini107 – 12115CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini143 – 15412ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini176 – 18813CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini210 – 490281ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini512 – 53928CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei39 – 5921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei86 – 10621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei122 – 14221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei155 – 17521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei189 – 20921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei491 – 51121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini224 – 479256GP-PDEAdd
    BLAST

    Sequence similaritiesi

    Contains 1 GP-PDE domain.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0584.
    HOGENOMiHOG000232101.
    HOVERGENiHBG081551.
    InParanoidiQ9HCC8.
    KOiK01124.
    OMAiIKALHQD.
    OrthoDBiEOG7F511B.
    PhylomeDBiQ9HCC8.
    TreeFamiTF313692.

    Family and domain databases

    Gene3Di3.20.20.190. 1 hit.
    InterProiIPR004129. GlyceroP-diester-Pdiesterase.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    [Graphical view]
    PANTHERiPTHR23344. PTHR23344. 1 hit.
    SUPFAMiSSF51695. SSF51695. 1 hit.
    PROSITEiPS51704. GP_PDE. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HCC8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAESPGCCSV WARCLHCLYS CHWRKCPRER MQTSKCDCIW FGLLFLTFLL    50
    SLSWLYIGLV LLNDLHNFNE FLFRRWGHWM DWSLAFLLVI SLLVTYASLL 100
    LVLALLLRLC RQPLHLHSLH KVLLLLIMLL VAAGLVGLDI QWQQEWHSLR 150
    VSLQATAPFL HIGAAAGIAL LAWPVADTFY RIHRRGPKIL LLLLFFGVVL 200
    VIYLAPLCIS SPCIMEPRDL PPKPGLVGHR GAPMLAPENT LMSLRKTAEC 250
    GATVFETDVM VSSDGVPFLM HDEHLSRTTN VASVFPTRIT AHSSDFSWTE 300
    LKRLNAGSWF LERRPFWGAK PLAGPDQKEA ESQTVPALEE LLEEAAALNL 350
    SIMFDLRRPP QNHTYYDTFV IQTLETVLNA RVPQAMVFWL PDEDRANVQR 400
    RAPGMRQIYG RQGGNRTERP QFLNLPYQDL PLLDIKALHK DNVSVNLFVV 450
    NKPWLFSLLW CAGVDSVTTN DCQLLQQMRY PIWLITPQTY LIIWVITNCV 500
    STMLLLWTFL LQRRFVKKRG KTGLETAVLL TRINNFMME 539
    Length:539
    Mass (Da):61,729
    Last modified:March 1, 2001 - v1
    Checksum:i8271C3A74766D540
    GO
    Isoform 2 (identifier: Q9HCC8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-79: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:460
    Mass (Da):52,186
    Checksum:i16081E6BAB94B16A
    GO
    Isoform 3 (identifier: Q9HCC8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         436-436: K → KDRFLLPAQAGLKLLASSNLPASASQSAGITGLSHCPPQPPGYKHELSHLAM

    Note: No experimental confirmation available.

    Show »
    Length:590
    Mass (Da):66,991
    Checksum:i1DC750F7411D9FDA
    GO

    Sequence cautioni

    The sequence BAA91014.1 differs from that shown. Reason: Frameshift at position 397.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti418 – 4181E → G in BAA91014. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7979Missing in isoform 2. 1 PublicationVSP_042622Add
    BLAST
    Alternative sequencei436 – 4361K → KDRFLLPAQAGLKLLASSNL PASASQSAGITGLSHCPPQP PGYKHELSHLAM in isoform 3. 1 PublicationVSP_042623

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB048363 mRNA. Translation: BAB13350.1.
    AY358986 mRNA. Translation: AAQ89345.1.
    AK000214 mRNA. Translation: BAA91014.1. Frameshift.
    AK299255 mRNA. Translation: BAG61286.1.
    AK301025 mRNA. Translation: BAG62641.1.
    AK316035 mRNA. Translation: BAH14406.1.
    AL139398 Genomic DNA. Translation: CAI41020.1.
    BC032009 mRNA. Translation: AAH32009.1.
    CCDSiCCDS14402.1. [Q9HCC8-1]
    CCDS55437.1. [Q9HCC8-3]
    CCDS55438.1. [Q9HCC8-2]
    RefSeqiNP_001164662.1. NM_001171191.1. [Q9HCC8-2]
    NP_001164663.1. NM_001171192.1. [Q9HCC8-3]
    NP_001164664.1. NM_001171193.1. [Q9HCC8-2]
    NP_060181.2. NM_017711.3. [Q9HCC8-1]
    UniGeneiHs.438712.

    Genome annotation databases

    EnsembliENST00000374382; ENSP00000363503; ENSG00000130055. [Q9HCC8-1]
    ENST00000453994; ENSP00000414019; ENSG00000130055. [Q9HCC8-3]
    ENST00000536730; ENSP00000445982; ENSG00000130055. [Q9HCC8-2]
    ENST00000538649; ENSP00000444601; ENSG00000130055. [Q9HCC8-2]
    GeneIDi54857.
    KEGGihsa:54857.
    UCSCiuc004dyh.3. human. [Q9HCC8-1]
    uc011mpk.2. human. [Q9HCC8-3]

    Polymorphism databases

    DMDMi74752794.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB048363 mRNA. Translation: BAB13350.1 .
    AY358986 mRNA. Translation: AAQ89345.1 .
    AK000214 mRNA. Translation: BAA91014.1 . Frameshift.
    AK299255 mRNA. Translation: BAG61286.1 .
    AK301025 mRNA. Translation: BAG62641.1 .
    AK316035 mRNA. Translation: BAH14406.1 .
    AL139398 Genomic DNA. Translation: CAI41020.1 .
    BC032009 mRNA. Translation: AAH32009.1 .
    CCDSi CCDS14402.1. [Q9HCC8-1 ]
    CCDS55437.1. [Q9HCC8-3 ]
    CCDS55438.1. [Q9HCC8-2 ]
    RefSeqi NP_001164662.1. NM_001171191.1. [Q9HCC8-2 ]
    NP_001164663.1. NM_001171192.1. [Q9HCC8-3 ]
    NP_001164664.1. NM_001171193.1. [Q9HCC8-2 ]
    NP_060181.2. NM_017711.3. [Q9HCC8-1 ]
    UniGenei Hs.438712.

    3D structure databases

    ProteinModelPortali Q9HCC8.
    SMRi Q9HCC8. Positions 226-377.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120207. 4 interactions.
    IntActi Q9HCC8. 41 interactions.
    MINTi MINT-1426959.
    STRINGi 9606.ENSP00000363503.

    PTM databases

    PhosphoSitei Q9HCC8.

    Polymorphism databases

    DMDMi 74752794.

    Proteomic databases

    PaxDbi Q9HCC8.
    PRIDEi Q9HCC8.

    Protocols and materials databases

    DNASUi 54857.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000374382 ; ENSP00000363503 ; ENSG00000130055 . [Q9HCC8-1 ]
    ENST00000453994 ; ENSP00000414019 ; ENSG00000130055 . [Q9HCC8-3 ]
    ENST00000536730 ; ENSP00000445982 ; ENSG00000130055 . [Q9HCC8-2 ]
    ENST00000538649 ; ENSP00000444601 ; ENSG00000130055 . [Q9HCC8-2 ]
    GeneIDi 54857.
    KEGGi hsa:54857.
    UCSCi uc004dyh.3. human. [Q9HCC8-1 ]
    uc011mpk.2. human. [Q9HCC8-3 ]

    Organism-specific databases

    CTDi 54857.
    GeneCardsi GC0XP069642.
    HGNCi HGNC:25974. GDPD2.
    HPAi HPA045026.
    neXtProti NX_Q9HCC8.
    PharmGKBi PA134907263.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0584.
    HOGENOMi HOG000232101.
    HOVERGENi HBG081551.
    InParanoidi Q9HCC8.
    KOi K01124.
    OMAi IKALHQD.
    OrthoDBi EOG7F511B.
    PhylomeDBi Q9HCC8.
    TreeFami TF313692.

    Enzyme and pathway databases

    BRENDAi 3.1.4.46. 3474.

    Miscellaneous databases

    GenomeRNAii 54857.
    NextBioi 57728.
    PROi Q9HCC8.

    Gene expression databases

    Bgeei Q9HCC8.
    CleanExi HS_GDPD2.
    Genevestigatori Q9HCC8.

    Family and domain databases

    Gene3Di 3.20.20.190. 1 hit.
    InterProi IPR004129. GlyceroP-diester-Pdiesterase.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    [Graphical view ]
    PANTHERi PTHR23344. PTHR23344. 1 hit.
    SUPFAMi SSF51695. SSF51695. 1 hit.
    PROSITEi PS51704. GP_PDE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Novel membrane protein containing glycerophosphodiester phosphodiesterase motif is transiently expressed during osteoblast differentiation."
      Yanaka N., Imai Y., Kawai E., Akatsuka H., Wakimoto K., Nogusa Y., Kato N., Chiba H., Kotani E., Omori K., Sakurai N.
      J. Biol. Chem. 278:43595-43602(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Spleen.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Caudate nucleus, Colon mucosa and Spleen.
    4. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Skin.

    Entry informationi

    Entry nameiGDPD2_HUMAN
    AccessioniPrimary (citable) accession number: Q9HCC8
    Secondary accession number(s): B4DRH4, B4DVC9, Q9NXJ6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 3, 2006
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 112 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3