SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HCC8

- GDPD2_HUMAN

UniProt

Q9HCC8 - GDPD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Glycerophosphoinositol inositolphosphodiesterase GDPD2
Gene
GDPD2, GDE3, OBDPF, UNQ1935/PRO4418
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Has glycerophosphoinositol inositolphosphodiesterase activity and specifically hydrolyzes glycerophosphoinositol, with no activity for other substrates such as glycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine, and glycerophosphoserine. Accelerates the program of osteoblast differentiation and growth. May play a role in remodeling of the actin cytoskeleton By similarity.

Catalytic activityi

1-(sn-glycero-3-phospho)-1D-myo-inositol + H2O = glycerol + 1D-myo-inositol 1-phosphate.

Cofactori

Calcium.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi256 – 2561Divalent metal cation Reviewed prediction
Metal bindingi258 – 2581Divalent metal cation Reviewed prediction
Metal bindingi271 – 2711Divalent metal cation Reviewed prediction

GO - Molecular functioni

  1. glycerophosphodiester phosphodiesterase activity Source: InterPro
  2. glycerophosphoinositol inositolphosphodiesterase activity Source: UniProtKB-EC
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. glycerol metabolic process Source: InterPro
  2. lipid metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.46. 3474.

Names & Taxonomyi

Protein namesi
Recommended name:
Glycerophosphoinositol inositolphosphodiesterase GDPD2 (EC:3.1.4.43)
Alternative name(s):
Glycerophosphodiester phosphodiesterase 3
Glycerophosphodiester phosphodiesterase domain-containing protein 2
Osteoblast differentiation promoting factor
Gene namesi
Name:GDPD2
Synonyms:GDE3, OBDPF
ORF Names:UNQ1935/PRO4418
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:25974. GDPD2.

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasmcytoskeleton By similarity
Note: Colocalizes with the actin cytoskeleton By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3838Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei39 – 5921Helical; Reviewed prediction
Add
BLAST
Topological domaini60 – 8526Extracellular Reviewed prediction
Add
BLAST
Transmembranei86 – 10621Helical; Reviewed prediction
Add
BLAST
Topological domaini107 – 12115Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei122 – 14221Helical; Reviewed prediction
Add
BLAST
Topological domaini143 – 15412Extracellular Reviewed prediction
Add
BLAST
Transmembranei155 – 17521Helical; Reviewed prediction
Add
BLAST
Topological domaini176 – 18813Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei189 – 20921Helical; Reviewed prediction
Add
BLAST
Topological domaini210 – 490281Extracellular Reviewed prediction
Add
BLAST
Transmembranei491 – 51121Helical; Reviewed prediction
Add
BLAST
Topological domaini512 – 53928Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. cytoskeleton Source: UniProtKB-SubCell
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134907263.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 539539Glycerophosphoinositol inositolphosphodiesterase GDPD2
PRO_0000251934Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi442 – 4421N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9HCC8.
PRIDEiQ9HCC8.

PTM databases

PhosphoSiteiQ9HCC8.

Expressioni

Gene expression databases

BgeeiQ9HCC8.
CleanExiHS_GDPD2.
GenevestigatoriQ9HCC8.

Organism-specific databases

HPAiHPA045026.

Interactioni

Protein-protein interaction databases

BioGridi120207. 4 interactions.
IntActiQ9HCC8. 41 interactions.
MINTiMINT-1426959.
STRINGi9606.ENSP00000363503.

Structurei

3D structure databases

ProteinModelPortaliQ9HCC8.
SMRiQ9HCC8. Positions 226-377.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini224 – 479256GP-PDE
Add
BLAST

Sequence similaritiesi

Contains 1 GP-PDE domain.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0584.
HOGENOMiHOG000232101.
HOVERGENiHBG081551.
InParanoidiQ9HCC8.
KOiK01124.
OMAiIKALHQD.
OrthoDBiEOG7F511B.
PhylomeDBiQ9HCC8.
TreeFamiTF313692.

Family and domain databases

Gene3Di3.20.20.190. 1 hit.
InterProiIPR004129. GlyceroP-diester-Pdiesterase.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
[Graphical view]
PANTHERiPTHR23344. PTHR23344. 1 hit.
SUPFAMiSSF51695. SSF51695. 1 hit.
PROSITEiPS51704. GP_PDE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HCC8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAESPGCCSV WARCLHCLYS CHWRKCPRER MQTSKCDCIW FGLLFLTFLL    50
SLSWLYIGLV LLNDLHNFNE FLFRRWGHWM DWSLAFLLVI SLLVTYASLL 100
LVLALLLRLC RQPLHLHSLH KVLLLLIMLL VAAGLVGLDI QWQQEWHSLR 150
VSLQATAPFL HIGAAAGIAL LAWPVADTFY RIHRRGPKIL LLLLFFGVVL 200
VIYLAPLCIS SPCIMEPRDL PPKPGLVGHR GAPMLAPENT LMSLRKTAEC 250
GATVFETDVM VSSDGVPFLM HDEHLSRTTN VASVFPTRIT AHSSDFSWTE 300
LKRLNAGSWF LERRPFWGAK PLAGPDQKEA ESQTVPALEE LLEEAAALNL 350
SIMFDLRRPP QNHTYYDTFV IQTLETVLNA RVPQAMVFWL PDEDRANVQR 400
RAPGMRQIYG RQGGNRTERP QFLNLPYQDL PLLDIKALHK DNVSVNLFVV 450
NKPWLFSLLW CAGVDSVTTN DCQLLQQMRY PIWLITPQTY LIIWVITNCV 500
STMLLLWTFL LQRRFVKKRG KTGLETAVLL TRINNFMME 539
Length:539
Mass (Da):61,729
Last modified:March 1, 2001 - v1
Checksum:i8271C3A74766D540
GO
Isoform 2 (identifier: Q9HCC8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-79: Missing.

Note: No experimental confirmation available.

Show »
Length:460
Mass (Da):52,186
Checksum:i16081E6BAB94B16A
GO
Isoform 3 (identifier: Q9HCC8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-436: K → KDRFLLPAQAGLKLLASSNLPASASQSAGITGLSHCPPQPPGYKHELSHLAM

Note: No experimental confirmation available.

Show »
Length:590
Mass (Da):66,991
Checksum:i1DC750F7411D9FDA
GO

Sequence cautioni

The sequence BAA91014.1 differs from that shown. Reason: Frameshift at position 397.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7979Missing in isoform 2.
VSP_042622Add
BLAST
Alternative sequencei436 – 4361K → KDRFLLPAQAGLKLLASSNL PASASQSAGITGLSHCPPQP PGYKHELSHLAM in isoform 3.
VSP_042623

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti418 – 4181E → G in BAA91014. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB048363 mRNA. Translation: BAB13350.1.
AY358986 mRNA. Translation: AAQ89345.1.
AK000214 mRNA. Translation: BAA91014.1. Frameshift.
AK299255 mRNA. Translation: BAG61286.1.
AK301025 mRNA. Translation: BAG62641.1.
AK316035 mRNA. Translation: BAH14406.1.
AL139398 Genomic DNA. Translation: CAI41020.1.
BC032009 mRNA. Translation: AAH32009.1.
CCDSiCCDS14402.1. [Q9HCC8-1]
CCDS55437.1. [Q9HCC8-3]
CCDS55438.1. [Q9HCC8-2]
RefSeqiNP_001164662.1. NM_001171191.1. [Q9HCC8-2]
NP_001164663.1. NM_001171192.1. [Q9HCC8-3]
NP_001164664.1. NM_001171193.1. [Q9HCC8-2]
NP_060181.2. NM_017711.3. [Q9HCC8-1]
UniGeneiHs.438712.

Genome annotation databases

EnsembliENST00000374382; ENSP00000363503; ENSG00000130055. [Q9HCC8-1]
ENST00000453994; ENSP00000414019; ENSG00000130055. [Q9HCC8-3]
ENST00000536730; ENSP00000445982; ENSG00000130055. [Q9HCC8-2]
ENST00000538649; ENSP00000444601; ENSG00000130055. [Q9HCC8-2]
GeneIDi54857.
KEGGihsa:54857.
UCSCiuc004dyh.3. human. [Q9HCC8-1]
uc011mpk.2. human. [Q9HCC8-3]

Polymorphism databases

DMDMi74752794.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB048363 mRNA. Translation: BAB13350.1 .
AY358986 mRNA. Translation: AAQ89345.1 .
AK000214 mRNA. Translation: BAA91014.1 . Frameshift.
AK299255 mRNA. Translation: BAG61286.1 .
AK301025 mRNA. Translation: BAG62641.1 .
AK316035 mRNA. Translation: BAH14406.1 .
AL139398 Genomic DNA. Translation: CAI41020.1 .
BC032009 mRNA. Translation: AAH32009.1 .
CCDSi CCDS14402.1. [Q9HCC8-1 ]
CCDS55437.1. [Q9HCC8-3 ]
CCDS55438.1. [Q9HCC8-2 ]
RefSeqi NP_001164662.1. NM_001171191.1. [Q9HCC8-2 ]
NP_001164663.1. NM_001171192.1. [Q9HCC8-3 ]
NP_001164664.1. NM_001171193.1. [Q9HCC8-2 ]
NP_060181.2. NM_017711.3. [Q9HCC8-1 ]
UniGenei Hs.438712.

3D structure databases

ProteinModelPortali Q9HCC8.
SMRi Q9HCC8. Positions 226-377.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120207. 4 interactions.
IntActi Q9HCC8. 41 interactions.
MINTi MINT-1426959.
STRINGi 9606.ENSP00000363503.

PTM databases

PhosphoSitei Q9HCC8.

Polymorphism databases

DMDMi 74752794.

Proteomic databases

PaxDbi Q9HCC8.
PRIDEi Q9HCC8.

Protocols and materials databases

DNASUi 54857.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000374382 ; ENSP00000363503 ; ENSG00000130055 . [Q9HCC8-1 ]
ENST00000453994 ; ENSP00000414019 ; ENSG00000130055 . [Q9HCC8-3 ]
ENST00000536730 ; ENSP00000445982 ; ENSG00000130055 . [Q9HCC8-2 ]
ENST00000538649 ; ENSP00000444601 ; ENSG00000130055 . [Q9HCC8-2 ]
GeneIDi 54857.
KEGGi hsa:54857.
UCSCi uc004dyh.3. human. [Q9HCC8-1 ]
uc011mpk.2. human. [Q9HCC8-3 ]

Organism-specific databases

CTDi 54857.
GeneCardsi GC0XP069642.
HGNCi HGNC:25974. GDPD2.
HPAi HPA045026.
neXtProti NX_Q9HCC8.
PharmGKBi PA134907263.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0584.
HOGENOMi HOG000232101.
HOVERGENi HBG081551.
InParanoidi Q9HCC8.
KOi K01124.
OMAi IKALHQD.
OrthoDBi EOG7F511B.
PhylomeDBi Q9HCC8.
TreeFami TF313692.

Enzyme and pathway databases

BRENDAi 3.1.4.46. 3474.

Miscellaneous databases

GenomeRNAii 54857.
NextBioi 57728.
PROi Q9HCC8.

Gene expression databases

Bgeei Q9HCC8.
CleanExi HS_GDPD2.
Genevestigatori Q9HCC8.

Family and domain databases

Gene3Di 3.20.20.190. 1 hit.
InterProi IPR004129. GlyceroP-diester-Pdiesterase.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
[Graphical view ]
PANTHERi PTHR23344. PTHR23344. 1 hit.
SUPFAMi SSF51695. SSF51695. 1 hit.
PROSITEi PS51704. GP_PDE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Novel membrane protein containing glycerophosphodiester phosphodiesterase motif is transiently expressed during osteoblast differentiation."
    Yanaka N., Imai Y., Kawai E., Akatsuka H., Wakimoto K., Nogusa Y., Kato N., Chiba H., Kotani E., Omori K., Sakurai N.
    J. Biol. Chem. 278:43595-43602(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Spleen.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Caudate nucleus, Colon mucosa and Spleen.
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin.

Entry informationi

Entry nameiGDPD2_HUMAN
AccessioniPrimary (citable) accession number: Q9HCC8
Secondary accession number(s): B4DRH4, B4DVC9, Q9NXJ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 1, 2001
Last modified: September 3, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi