Q9HCC8 (GDPD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glycerophosphoinositol inositolphosphodiesterase GDPD2 EC=3.1.4.43 Alternative name(s): Glycerophosphodiester phosphodiesterase 3 Glycerophosphodiester phosphodiesterase domain-containing protein 2 Osteoblast differentiation promoting factor | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 539 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Has glycerophosphoinositol inositolphosphodiesterase activity and specifically hydrolyzes glycerophosphoinositol, with no activity for other substrates such as glycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine, and glycerophosphoserine. Accelerates the program of osteoblast differentiation and growth. May play a role in remodeling of the actin cytoskeleton By similarity. |
| Catalytic activity | 1-(sn-glycero-3-phospho)-1D-myo-inositol + H2O = glycerol + 1D-myo-inositol 1-phosphate. |
| Cofactor | Calcium. |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm › cytoskeleton By similarity. Note: Colocalizes with the actin cytoskeleton By similarity. |
| Sequence similarities | Belongs to the glycerophosphoryl diester phosphodiesterase family. Contains 1 GDPD domain. |
| Caution | The catalytic domain of GDPD2 is oriented extracellularly; Glycerophosphoinositol is hydrolyzed in the medium of cells overexpressing Gdpd2, whereas intracellular levels of glycerophosphoinositol is not affected. |
| Sequence caution | The sequence BAA91014.1 differs from that shown. Reason: Frameshift at position 397. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HCC8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HCC8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-79: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9HCC8-3) The sequence of this isoform differs from the canonical sequence as follows: 436-436: K → KDRFLLPAQAGLKLLASSNLPASASQSAGITGLSHCPPQPPGYKHELSHLAM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 539 | 539 | Glycerophosphoinositol inositolphosphodiesterase GDPD2 | PRO_0000251934 | |||||
Regions | |||||||||
| Topological domain | 1 – 38 | 38 | Cytoplasmic Potential | ||||||
| Transmembrane | 39 – 59 | 21 | Helical; Potential | ||||||
| Topological domain | 60 – 85 | 26 | Extracellular Potential | ||||||
| Transmembrane | 86 – 106 | 21 | Helical; Potential | ||||||
| Topological domain | 107 – 121 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 122 – 142 | 21 | Helical; Potential | ||||||
| Topological domain | 143 – 154 | 12 | Extracellular Potential | ||||||
| Transmembrane | 155 – 175 | 21 | Helical; Potential | ||||||
| Topological domain | 176 – 188 | 13 | Cytoplasmic Potential | ||||||
| Transmembrane | 189 – 209 | 21 | Helical; Potential | ||||||
| Topological domain | 210 – 490 | 281 | Extracellular Potential | ||||||
| Transmembrane | 491 – 511 | 21 | Helical; Potential | ||||||
| Topological domain | 512 – 539 | 28 | Cytoplasmic Potential | ||||||
| Domain | 229 – 474 | 246 | GDPD | ||||||
Sites | |||||||||
| Metal binding | 256 | 1 | Divalent metal cation Potential | ||||||
| Metal binding | 258 | 1 | Divalent metal cation Potential | ||||||
| Metal binding | 271 | 1 | Divalent metal cation Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 442 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 79 | 79 | Missing in isoform 2. | VSP_042622 | |||||
| Alternative sequence | 436 | 1 | K → KDRFLLPAQAGLKLLASSNL PASASQSAGITGLSHCPPQP PGYKHELSHLAM in isoform 3. | VSP_042623 | |||||
Experimental info | |||||||||
| Sequence conflict | 418 | 1 | E → G in BAA91014. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Novel membrane protein containing glycerophosphodiester phosphodiesterase motif is transiently expressed during osteoblast differentiation." Yanaka N., Imai Y., Kawai E., Akatsuka H., Wakimoto K., Nogusa Y., Kato N., Chiba H., Kotani E., Omori K., Sakurai N. J. Biol. Chem. 278:43595-43602(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Spleen. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Caudate nucleus, Colon mucosa and Spleen. |
| [4] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB048363 mRNA. Translation: BAB13350.1. AY358986 mRNA. Translation: AAQ89345.1. AK000214 mRNA. Translation: BAA91014.1. Frameshift. AK299255 mRNA. Translation: BAG61286.1. AK301025 mRNA. Translation: BAG62641.1. AK316035 mRNA. Translation: BAH14406.1. AL139398 Genomic DNA. Translation: CAI41020.1. BC032009 mRNA. Translation: AAH32009.1. |
| IPI | IPI00102275. IPI00911110. IPI00954842. |
| RefSeq | NP_001164662.1. NM_001171191.1. NP_001164663.1. NM_001171192.1. NP_001164664.1. NM_001171193.1. NP_060181.2. NM_017711.3. |
| UniGene | Hs.438712. |
3D structure databases | |
| ProteinModelPortal | Q9HCC8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9HCC8. 41 interactions. |
| MINT | MINT-1426959. |
| STRING | 9606.ENSP00000363503. |
PTM databases | |
| PhosphoSite | Q9HCC8. |
Polymorphism databases | |
| DMDM | 74752794. |
Proteomic databases | |
| PaxDb | Q9HCC8. |
| PRIDE | Q9HCC8. |
Protocols and materials databases | |
| DNASU | 54857. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000374382; ENSP00000363503; ENSG00000130055. ENST00000453994; ENSP00000414019; ENSG00000130055. ENST00000536730; ENSP00000445982; ENSG00000130055. ENST00000538649; ENSP00000444601; ENSG00000130055. |
| GeneID | 54857. |
| KEGG | hsa:54857. |
| UCSC | uc004dyh.3. human. |
Organism-specific databases | |
| CTD | 54857. |
| GeneCards | GC0XP069642. |
| HGNC | HGNC:25974. GDPD2. |
| HPA | HPA045026. |
| neXtProt | NX_Q9HCC8. |
| PharmGKB | PA134907263. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0584. |
| HOGENOM | HOG000232101. |
| HOVERGEN | HBG081551. |
| InParanoid | Q9HCC8. |
| KO | K01124. |
| OMA | IKALHQD. |
| OrthoDB | EOG42V8G2. |
| PhylomeDB | Q9HCC8. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.46. 3474. |
Gene expression databases | |
| Bgee | Q9HCC8. |
| CleanEx | HS_GDPD2. |
| Genevestigator | Q9HCC8. |
| GermOnline | ENSG00000130055. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.20.20.190. 1 hit. |
| InterPro | IPR004129. GlyceroP-diester-Pdiesterase. IPR017946. PLC-like_Pdiesterase_TIM-brl. [Graphical view] |
| PANTHER | PTHR23344. PTHR23344. 1 hit. |
| Pfam | PF03009. GDPD. 1 hit. [Graphical view] |
| SUPFAM | SSF51695. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 54857. |
| NextBio | 57728. |
Entry information
| Entry name | GDPD2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HCC8 Secondary accession number(s): B4DRH4, B4DVC9, Q9NXJ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
