Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

G-protein coupled receptor 35

Gene

GPR35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.1 Publication

GO - Molecular functioni

  • C-X-C chemokine receptor activity Source: UniProtKB
  • G-protein coupled receptor activity Source: UniProtKB

GO - Biological processi

  • chemokine-mediated signaling pathway Source: UniProtKB
  • G-protein coupled receptor signaling pathway Source: UniProtKB
  • negative regulation of voltage-gated calcium channel activity Source: UniProtKB
  • positive regulation of cytosolic calcium ion concentration Source: UniProtKB
  • positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway Source: GO_Central
  • positive regulation of Rho protein signal transduction Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000178623-MONOMER.

Protein family/group databases

TCDBi9.A.14.13.8. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
G-protein coupled receptor 35
Alternative name(s):
Kynurenic acid receptor
Short name:
KYNA receptor
Gene namesi
Name:GPR35
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:4492. GPR35.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 24ExtracellularSequence analysisAdd BLAST24
Transmembranei25 – 45Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini46 – 56CytoplasmicSequence analysisAdd BLAST11
Transmembranei57 – 77Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini78 – 90ExtracellularSequence analysisAdd BLAST13
Transmembranei91 – 112Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini113 – 135CytoplasmicSequence analysisAdd BLAST23
Transmembranei136 – 156Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini157 – 174ExtracellularSequence analysisAdd BLAST18
Transmembranei175 – 195Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini196 – 218CytoplasmicSequence analysisAdd BLAST23
Transmembranei219 – 239Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini240 – 258ExtracellularSequence analysisAdd BLAST19
Transmembranei259 – 279Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini280 – 309CytoplasmicSequence analysisAdd BLAST30

GO - Cellular componenti

  • integral component of plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi2859.
MalaCardsiGPR35.
OpenTargetsiENSG00000178623.
Orphaneti171. Primary sclerosing cholangitis.
PharmGKBiPA28880.

Chemistry databases

ChEMBLiCHEMBL1293267.
GuidetoPHARMACOLOGYi102.

Polymorphism and mutation databases

BioMutaiGPR35.
DMDMi68068087.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000695631 – 309G-protein coupled receptor 35Add BLAST309

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi2N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi89 ↔ 162PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9HC97.
PRIDEiQ9HC97.

PTM databases

iPTMnetiQ9HC97.
PhosphoSitePlusiQ9HC97.

Expressioni

Tissue specificityi

Predominantly expressed in immune and gastrointestinal tissues.1 Publication

Gene expression databases

BgeeiENSG00000178623.
CleanExiHS_GPR35.
GenevisibleiQ9HC97. HS.

Interactioni

Protein-protein interaction databases

BioGridi109117. 7 interactors.
STRINGi9606.ENSP00000415890.

Chemistry databases

BindingDBiQ9HC97.

Structurei

3D structure databases

ProteinModelPortaliQ9HC97.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IE2J. Eukaryota.
ENOG4111JSA. LUCA.
GeneTreeiENSGT00730000110768.
HOVERGENiHBG101122.
InParanoidiQ9HC97.
KOiK04276.
OMAiDANCCLD.
OrthoDBiEOG091G0JBB.
PhylomeDBiQ9HC97.
TreeFamiTF335578.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HC97-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGTYNTCGS SDLTWPPAIK LGFYAYLGVL LVLGLLLNSL ALWVFCCRMQ
60 70 80 90 100
QWTETRIYMT NLAVADLCLL CTLPFVLHSL RDTSDTPLCQ LSQGIYLTNR
110 120 130 140 150
YMSISLVTAI AVDRYVAVRH PLRARGLRSP RQAAAVCAVL WVLVIGSLVA
160 170 180 190 200
RWLLGIQEGG FCFRSTRHNF NSMAFPLLGF YLPLAVVVFC SLKVVTALAQ
210 220 230 240 250
RPPTDVGQAE ATRKAARMVW ANLLVFVVCF LPLHVGLTVR LAVGWNACAL
260 270 280 290 300
LETIRRALYI TSKLSDANCC LDAICYYYMA KEFQEASALA VAPSAKAHKS

QDSLCVTLA
Length:309
Mass (Da):34,072
Last modified:June 21, 2005 - v4
Checksum:i97734FB7231B26F0
GO
Isoform 2 (identifier: Q9HC97-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGSRAVPTPHRGSEELLKYMLHSPCVSLTM

Note: No experimental confirmation available.Curated
Show »
Length:340
Mass (Da):37,452
Checksum:i197A24A76F52BEF8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti174A → R in AAC52028 (PubMed:9479505).Curated1
Isoform 2 (identifier: Q9HC97-2)
Sequence conflicti13R → H in AK172786 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01360125A → T.1 PublicationCorresponds to variant rs35146537dbSNPEnsembl.1
Natural variantiVAR_01360229V → I.1 PublicationCorresponds to variant rs139197368dbSNPEnsembl.1
Natural variantiVAR_03346776V → M.Corresponds to variant rs13387859dbSNPEnsembl.1
Natural variantiVAR_013603108T → M.1 PublicationCorresponds to variant rs3749171dbSNPEnsembl.1
Natural variantiVAR_013604125R → S.1 PublicationCorresponds to variant rs34778053dbSNPEnsembl.1
Natural variantiVAR_013605253T → M.1 PublicationCorresponds to variant rs12468485dbSNPEnsembl.1
Natural variantiVAR_013606294S → R.4 PublicationsCorresponds to variant rs3749172dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0458711M → MLSGSRAVPTPHRGSEELLK YMLHSPCVSLTM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027957 Genomic DNA. Translation: AAC52028.1.
AF089087 mRNA. Translation: AAG17965.1.
AY275467 Genomic DNA. Translation: AAP32299.1.
AK172786 mRNA. No translation available.
CR541765 mRNA. Translation: CAG46564.1.
AC124862 Genomic DNA. Translation: AAX88945.1.
BC095500 mRNA. Translation: AAH95500.1.
BC117453 mRNA. Translation: AAI17454.2.
BC117455 mRNA. Translation: AAI17456.2.
CCDSiCCDS2541.1. [Q9HC97-1]
CCDS56174.1. [Q9HC97-2]
RefSeqiNP_001182310.1. NM_001195381.1. [Q9HC97-2]
NP_001182311.1. NM_001195382.1. [Q9HC97-2]
NP_005292.2. NM_005301.3. [Q9HC97-1]
UniGeneiHs.112218.

Genome annotation databases

EnsembliENST00000319838; ENSP00000322731; ENSG00000178623. [Q9HC97-1]
ENST00000403859; ENSP00000385140; ENSG00000178623. [Q9HC97-1]
ENST00000407714; ENSP00000384263; ENSG00000178623. [Q9HC97-1]
ENST00000430267; ENSP00000411788; ENSG00000178623. [Q9HC97-2]
ENST00000438013; ENSP00000415890; ENSG00000178623. [Q9HC97-1]
GeneIDi2859.
KEGGihsa:2859.
UCSCiuc002vzs.4. human. [Q9HC97-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027957 Genomic DNA. Translation: AAC52028.1.
AF089087 mRNA. Translation: AAG17965.1.
AY275467 Genomic DNA. Translation: AAP32299.1.
AK172786 mRNA. No translation available.
CR541765 mRNA. Translation: CAG46564.1.
AC124862 Genomic DNA. Translation: AAX88945.1.
BC095500 mRNA. Translation: AAH95500.1.
BC117453 mRNA. Translation: AAI17454.2.
BC117455 mRNA. Translation: AAI17456.2.
CCDSiCCDS2541.1. [Q9HC97-1]
CCDS56174.1. [Q9HC97-2]
RefSeqiNP_001182310.1. NM_001195381.1. [Q9HC97-2]
NP_001182311.1. NM_001195382.1. [Q9HC97-2]
NP_005292.2. NM_005301.3. [Q9HC97-1]
UniGeneiHs.112218.

3D structure databases

ProteinModelPortaliQ9HC97.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109117. 7 interactors.
STRINGi9606.ENSP00000415890.

Chemistry databases

BindingDBiQ9HC97.
ChEMBLiCHEMBL1293267.
GuidetoPHARMACOLOGYi102.

Protein family/group databases

TCDBi9.A.14.13.8. the g-protein-coupled receptor (gpcr) family.
GPCRDBiSearch...

PTM databases

iPTMnetiQ9HC97.
PhosphoSitePlusiQ9HC97.

Polymorphism and mutation databases

BioMutaiGPR35.
DMDMi68068087.

Proteomic databases

PaxDbiQ9HC97.
PRIDEiQ9HC97.

Protocols and materials databases

DNASUi2859.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000319838; ENSP00000322731; ENSG00000178623. [Q9HC97-1]
ENST00000403859; ENSP00000385140; ENSG00000178623. [Q9HC97-1]
ENST00000407714; ENSP00000384263; ENSG00000178623. [Q9HC97-1]
ENST00000430267; ENSP00000411788; ENSG00000178623. [Q9HC97-2]
ENST00000438013; ENSP00000415890; ENSG00000178623. [Q9HC97-1]
GeneIDi2859.
KEGGihsa:2859.
UCSCiuc002vzs.4. human. [Q9HC97-1]

Organism-specific databases

CTDi2859.
DisGeNETi2859.
GeneCardsiGPR35.
H-InvDBHIX0077670.
HGNCiHGNC:4492. GPR35.
MalaCardsiGPR35.
MIMi602646. gene.
neXtProtiNX_Q9HC97.
OpenTargetsiENSG00000178623.
Orphaneti171. Primary sclerosing cholangitis.
PharmGKBiPA28880.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE2J. Eukaryota.
ENOG4111JSA. LUCA.
GeneTreeiENSGT00730000110768.
HOVERGENiHBG101122.
InParanoidiQ9HC97.
KOiK04276.
OMAiDANCCLD.
OrthoDBiEOG091G0JBB.
PhylomeDBiQ9HC97.
TreeFamiTF335578.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000178623-MONOMER.

Miscellaneous databases

GenomeRNAii2859.
PROiQ9HC97.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000178623.
CleanExiHS_GPR35.
GenevisibleiQ9HC97. HS.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGPR35_HUMAN
AccessioniPrimary (citable) accession number: Q9HC97
Secondary accession number(s): J3KR30
, O43495, Q17R58, Q4VBN5, Q4ZFV2, Q6FHI8, Q86UH4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 14, 2001
Last sequence update: June 21, 2005
Last modified: November 30, 2016
This is version 131 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.