Q9HBX9 (RXFP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Relaxin receptor 1 Alternative name(s): Leucine-rich repeat-containing G-protein coupled receptor 7 Relaxin family peptide receptor 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 757 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP. |
| Subcellular location | |
| Tissue specificity | Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen. Ref.2 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. Contains 1 LDL-receptor class A domain. Contains 9 LRR (leucine-rich) repeats. Contains 1 LRRNT domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HBX9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HBX9-2) Also known as: LGR7.10; The sequence of this isoform differs from the canonical sequence as follows: 63-96: GDNNGWSLQFDKYFASYYKMTSQYPFEAETPECL → V | ||||||
| Isoform 3 (identifier: Q9HBX9-3) Also known as: LGR7.1; The sequence of this isoform differs from the canonical sequence as follows: 180-189: YLSHNRITFL → SRAVKDGSEK 190-757: Missing. | ||||||
| Isoform 4 (identifier: Q9HBX9-4) Also known as: LGR7.2; The sequence of this isoform differs from the canonical sequence as follows: 300-348: LDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSL → F |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||
Molecule processing | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 757 | 757 | Relaxin receptor 1 | PRO_0000069700 | ||||||||||||||
Regions | ||||||||||||||||||
| Topological domain | 1 – 409 | 409 | Extracellular Potential | |||||||||||||||
| Transmembrane | 410 – 430 | 21 | Helical; Name=1; Potential | |||||||||||||||
| Topological domain | 431 – 443 | 13 | Cytoplasmic Potential | |||||||||||||||
| Transmembrane | 444 – 464 | 21 | Helical; Name=2; Potential | |||||||||||||||
| Topological domain | 465 – 486 | 22 | Extracellular Potential | |||||||||||||||
| Transmembrane | 487 – 507 | 21 | Helical; Name=3; Potential | |||||||||||||||
| Topological domain | 508 – 527 | 20 | Cytoplasmic Potential | |||||||||||||||
| Transmembrane | 528 – 548 | 21 | Helical; Name=4; Potential | |||||||||||||||
| Topological domain | 549 – 577 | 29 | Extracellular Potential | |||||||||||||||
| Transmembrane | 578 – 598 | 21 | Helical; Name=5; Potential | |||||||||||||||
| Topological domain | 599 – 629 | 31 | Cytoplasmic Potential | |||||||||||||||
| Transmembrane | 630 – 650 | 21 | Helical; Name=6; Potential | |||||||||||||||
| Topological domain | 651 | 1 | Extracellular Potential | |||||||||||||||
| Transmembrane | 652 – 672 | 21 | Helical; Name=7; Potential | |||||||||||||||
| Topological domain | 673 – 757 | 85 | Cytoplasmic Potential | |||||||||||||||
| Domain | 26 – 63 | 38 | LDL-receptor class A | |||||||||||||||
| Domain | 91 – 127 | 37 | LRRNT | |||||||||||||||
| Repeat | 151 – 172 | 22 | LRR 1 | |||||||||||||||
| Repeat | 175 – 196 | 22 | LRR 2 | |||||||||||||||
| Repeat | 199 – 220 | 22 | LRR 3 | |||||||||||||||
| Repeat | 223 – 244 | 22 | LRR 4 | |||||||||||||||
| Repeat | 248 – 269 | 22 | LRR 5 | |||||||||||||||
| Repeat | 272 – 293 | 22 | LRR 6 | |||||||||||||||
| Repeat | 296 – 317 | 22 | LRR 7 | |||||||||||||||
| Repeat | 320 – 341 | 22 | LRR 8 | |||||||||||||||
| Repeat | 344 – 365 | 22 | LRR 9 | |||||||||||||||
Sites | ||||||||||||||||||
| Metal binding | 45 | 1 | Calcium; via carbonyl oxygen | |||||||||||||||
| Metal binding | 48 | 1 | Calcium | |||||||||||||||
| Metal binding | 50 | 1 | Calcium; via carbonyl oxygen | |||||||||||||||
| Metal binding | 52 | 1 | Calcium | |||||||||||||||
| Metal binding | 58 | 1 | Calcium | |||||||||||||||
| Metal binding | 59 | 1 | Calcium | |||||||||||||||
Amino acid modifications | ||||||||||||||||||
| Glycosylation | 36 | 1 | N-linked (GlcNAc...) Ref.8 | |||||||||||||||
| Glycosylation | 127 | 1 | N-linked (GlcNAc...) Ref.8 | |||||||||||||||
| Glycosylation | 264 | 1 | N-linked (GlcNAc...) Ref.8 | |||||||||||||||
| Glycosylation | 272 | 1 | N-linked (GlcNAc...) Ref.8 | |||||||||||||||
| Glycosylation | 325 | 1 | N-linked (GlcNAc...) Ref.8 | |||||||||||||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Ref.8 | |||||||||||||||
| Disulfide bond | 27 ↔ 40 | |||||||||||||||||
| Disulfide bond | 34 ↔ 53 | |||||||||||||||||
| Disulfide bond | 47 ↔ 62 | |||||||||||||||||
| Disulfide bond | 485 ↔ 563 | |||||||||||||||||
Natural variations | ||||||||||||||||||
| Alternative sequence | 63 – 96 | 34 | GDNNG…TPECL → V in isoform 2. | VSP_001984 | ||||||||||||||
| Alternative sequence | 180 – 189 | 10 | YLSHNRITFL → SRAVKDGSEK in isoform 3. | VSP_029877 | ||||||||||||||
| Alternative sequence | 190 – 757 | 568 | Missing in isoform 3. | VSP_029878 | ||||||||||||||
| Alternative sequence | 300 – 348 | 49 | LDLGS…KLKSL → F in isoform 4. | VSP_029879 | ||||||||||||||
Experimental info | ||||||||||||||||||
| Mutagenesis | 637 | 1 | D → Y: Leads to constitutive increase of basal cAMP. Ref.1 | |||||||||||||||
| Sequence conflict | 70 | 1 | L → M in AAG17167. Ref.1 | |||||||||||||||
Secondary structure | ||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||
| Beta strand | 31 – 33 | 3 | ||||||||||||||||
| Beta strand | 35 – 38 | 4 | ||||||||||||||||
| Beta strand | 40 – 42 | 3 | ||||||||||||||||
| Helix | 43 – 45 | 3 | ||||||||||||||||
| Beta strand | 53 – 55 | 3 | ||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The three subfamilies of leucine-rich repeat-containing G protein-coupled receptors (LGR): identification of LGR6 and LGR7 and the signaling mechanism for LGR7." Hsu S.Y., Kudo M., Chen T., Nakabayashi K., Bhalla A., van der Spek P.J., van Duin M., Hsueh A.J.W. Mol. Endocrinol. 14:1257-1271(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), MUTAGENESIS OF ASP-637. |
| [2] | "Splice variants of the relaxin and INSL3 receptors reveal unanticipated molecular complexity." Muda M., He C., Martini P.G.V., Ferraro T., Layfield S., Taylor D., Chevrier C., Schweickhardt R., Kelton C., Ryan P.L., Bathgate R.A.D. Mol. Hum. Reprod. 11:591-600(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain cortex. |
| [6] | "Relaxin signalling links tyrosine phosphorylation to phosphodiesterase and adenylyl cyclase activity." Bartsch O., Bartlick B., Ivell R. Mol. Hum. Reprod. 7:799-809(2001) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION. |
| [7] | "H3 relaxin is a specific ligand for LGR7 and activates the receptor by interacting with both the ectodomain and the exoloop 2." Sudo S., Kumagai J., Nishi S., Layfield S., Ferraro T., Bathgate R.A.D., Hsueh A.J.W. J. Biol. Chem. 278:7855-7862(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RLN3. |
| [8] | "Identification of the N-linked glycosylation sites of the human relaxin receptor and effect of glycosylation on receptor function." Yan Y., Scott D.J., Wilkinson T.N., Ji J., Tregear G.W., Bathgate R.A. Biochemistry 47:6953-6968(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-36; ASN-127; ASN-264; ASN-272; ASN-325 AND ASN-368. |
| [9] | "The NMR solution structure of the relaxin (RXFP1) receptor lipoprotein receptor class A module and identification of key residues in the N-terminal region of the module that mediate receptor activation." Hopkins E.J., Layfield S., Ferraro T., Bathgate R.A.D., Gooley P.R. J. Biol. Chem. 282:4172-4184(2007) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 23-63 IN COMPLEX WITH CALCIUM IONS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF190500 mRNA. Translation: AAG17167.1. AY899848 mRNA. Translation: AAX85196.1. AY899849 mRNA. Translation: AAX85197.1. AY899850 mRNA. Translation: AAX85198.1. AK300379 mRNA. Translation: BAG62114.1. CH471056 Genomic DNA. Translation: EAX04856.1. BC112142 mRNA. Translation: AAI12143.1. BC113617 mRNA. Translation: AAI13618.1. | ||||||||||||
| IPI | IPI00012456. IPI00219888. IPI00654878. IPI00876893. | ||||||||||||
| RefSeq | NP_001240657.1. NM_001253728.1. NP_001240658.1. NM_001253729.1. NP_067647.2. NM_021634.3. | ||||||||||||
| UniGene | Hs.591686. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9HBX9. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| MINT | MINT-231156. | ||||||||||||
| STRING | 9606.ENSP00000303248. | ||||||||||||
Protein family/group databases | |||||||||||||
| GPCRDB | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9HBX9. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 166209887. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9HBX9. | ||||||||||||
| PRIDE | Q9HBX9. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 59350. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000307765; ENSP00000303248; ENSG00000171509. ENST00000343542; ENSP00000345889; ENSG00000171509. ENST00000423548; ENSP00000405841; ENSG00000171509. ENST00000470033; ENSP00000420712; ENSG00000171509. ENST00000471616; ENSP00000434475; ENSG00000171509. | ||||||||||||
| GeneID | 59350. | ||||||||||||
| KEGG | hsa:59350. | ||||||||||||
| UCSC | uc003ipz.3. human. uc010iqm.3. human. uc010iqo.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 59350. | ||||||||||||
| GeneCards | GC04P159236. | ||||||||||||
| H-InvDB | HIX0024561. | ||||||||||||
| HGNC | HGNC:19718. RXFP1. | ||||||||||||
| HPA | HPA027067. | ||||||||||||
| MIM | 606654. gene. | ||||||||||||
| neXtProt | NX_Q9HBX9. | ||||||||||||
| PharmGKB | PA134868312. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG4886. | ||||||||||||
| HOVERGEN | HBG026354. | ||||||||||||
| InParanoid | Q9HBX9. | ||||||||||||
| KO | K04306. | ||||||||||||
| OMA | YTLTTRP. | ||||||||||||
| PhylomeDB | Q9HBX9. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9HBX9. | ||||||||||||
| Bgee | Q9HBX9. | ||||||||||||
| CleanEx | HS_RXFP1. | ||||||||||||
| Genevestigator | Q9HBX9. | ||||||||||||
| GermOnline | ENSG00000171509. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 4.10.400.10. 1 hit. | ||||||||||||
| InterPro | IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. IPR023415. LDLR_class-A_CS. IPR002172. LDrepeatLR_classA_rpt. IPR001611. Leu-rich_rpt. IPR003591. Leu-rich_rpt_typical-subtyp. IPR000372. LRR-contain_N. IPR008112. Relaxin_rcpt. [Graphical view] | ||||||||||||
| Pfam | PF00001. 7tm_1. 1 hit. PF00057. Ldl_recept_a. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00237. GPCRRHODOPSN. PR01739. RELAXINR. | ||||||||||||
| SMART | SM00192. LDLa. 1 hit. SM00369. LRR_TYP. 2 hits. SM00013. LRRNT. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF57424. LDL_rcpt_classA_cys-rich. 1 hit. | ||||||||||||
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. False negative. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. PS01209. LDLRA_1. 1 hit. PS50068. LDLRA_2. 1 hit. PS51450. LRR. 10 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChEMBL | CHEMBL1293316. | ||||||||||||
| EvolutionaryTrace | Q9HBX9. | ||||||||||||
| GenomeRNAi | 59350. | ||||||||||||
| NextBio | 65261. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RXFP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HBX9 Secondary accession number(s): B4DTV2 Q3KU26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
