Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Relaxin receptor 1

Gene

RXFP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.

Caution

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi45Calcium; via carbonyl oxygen1
Metal bindingi48Calcium1
Metal bindingi50Calcium; via carbonyl oxygen1
Metal bindingi52Calcium1
Metal bindingi58Calcium1
Metal bindingi59Calcium1

GO - Molecular functioni

  • G-protein coupled receptor activity Source: MGI
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-418555 G alpha (s) signalling events
R-HSA-444821 Relaxin receptors
SIGNORiQ9HBX9

Names & Taxonomyi

Protein namesi
Recommended name:
Relaxin receptor 1
Alternative name(s):
Leucine-rich repeat-containing G-protein coupled receptor 7
Relaxin family peptide receptor 1
Gene namesi
Name:RXFP1
Synonyms:LGR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000171509.15
HGNCiHGNC:19718 RXFP1
MIMi606654 gene
neXtProtiNX_Q9HBX9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 409ExtracellularSequence analysisAdd BLAST409
Transmembranei410 – 430Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini431 – 443CytoplasmicSequence analysisAdd BLAST13
Transmembranei444 – 464Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini465 – 486ExtracellularSequence analysisAdd BLAST22
Transmembranei487 – 507Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini508 – 527CytoplasmicSequence analysisAdd BLAST20
Transmembranei528 – 548Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini549 – 577ExtracellularSequence analysisAdd BLAST29
Transmembranei578 – 598Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini599 – 629CytoplasmicSequence analysisAdd BLAST31
Transmembranei630 – 650Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini651ExtracellularSequence analysis1
Transmembranei652 – 672Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini673 – 757CytoplasmicSequence analysisAdd BLAST85

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi637D → Y: Leads to constitutive increase of basal cAMP. 1 Publication1

Organism-specific databases

DisGeNETi59350
OpenTargetsiENSG00000171509
PharmGKBiPA134868312

Chemistry databases

ChEMBLiCHEMBL1293316
GuidetoPHARMACOLOGYi351

Polymorphism and mutation databases

BioMutaiRXFP1
DMDMi166209887

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000697001 – 757Relaxin receptor 1Add BLAST757

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi27 ↔ 40
Disulfide bondi34 ↔ 53
Glycosylationi36N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi47 ↔ 62
Glycosylationi127N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi264N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi272N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi325N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi368N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi485 ↔ 563

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9HBX9
PaxDbiQ9HBX9
PeptideAtlasiQ9HBX9
PRIDEiQ9HBX9

PTM databases

iPTMnetiQ9HBX9
PhosphoSitePlusiQ9HBX9

Expressioni

Tissue specificityi

Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.1 Publication

Gene expression databases

BgeeiENSG00000171509
CleanExiHS_RXFP1
ExpressionAtlasiQ9HBX9 baseline and differential
GenevisibleiQ9HBX9 HS

Organism-specific databases

HPAiHPA027067

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
AKAP5P245882EBI-8088969,EBI-703640

Protein-protein interaction databases

BioGridi12189185 interactors.
CORUMiQ9HBX9
IntActiQ9HBX9 6 interactors.
MINTiQ9HBX9
STRINGi9606.ENSP00000303248

Chemistry databases

BindingDBiQ9HBX9

Structurei

Secondary structure

1757
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi31 – 33Combined sources3
Beta strandi35 – 38Combined sources4
Beta strandi40 – 42Combined sources3
Helixi43 – 45Combined sources3
Beta strandi53 – 55Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JM4NMR-A23-63[»]
2M7PNMR-A28-39[»]
ProteinModelPortaliQ9HBX9
SMRiQ9HBX9
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HBX9

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 63LDL-receptor class APROSITE-ProRule annotationAdd BLAST38
Domaini91 – 127LRRNTAdd BLAST37
Repeati151 – 172LRR 1Add BLAST22
Repeati175 – 196LRR 2Add BLAST22
Repeati199 – 220LRR 3Add BLAST22
Repeati223 – 244LRR 4Add BLAST22
Repeati248 – 269LRR 5Add BLAST22
Repeati272 – 293LRR 6Add BLAST22
Repeati296 – 317LRR 7Add BLAST22
Repeati320 – 341LRR 8Add BLAST22
Repeati344 – 365LRR 9Add BLAST22

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0619 Eukaryota
KOG2087 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00760000119088
HOGENOMiHOG000049056
HOVERGENiHBG026354
InParanoidiQ9HBX9
KOiK04306
PhylomeDBiQ9HBX9
TreeFamiTF326185

Family and domain databases

CDDicd00112 LDLa, 1 hit
Gene3Di3.80.10.102 hits
InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR002172 LDrepeatLR_classA_rpt
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR008112 Relaxin_rcpt
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PF00057 Ldl_recept_a, 1 hit
PF13855 LRR_8, 2 hits
PRINTSiPR00237 GPCRRHODOPSN
PR01739 RELAXINR
SMARTiView protein in SMART
SM00192 LDLa, 1 hit
SM00369 LRR_TYP, 9 hits
SUPFAMiSSF57424 SSF57424, 1 hit
PROSITEiView protein in PROSITE
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
PS01209 LDLRA_1, 1 hit
PS50068 LDLRA_2, 1 hit
PS51450 LRR, 10 hits

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HBX9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSGSVFFYI LIFGKYFSHG GGQDVKCSLG YFPCGNITKC LPQLLHCNGV
60 70 80 90 100
DDCGNQADED NCGDNNGWSL QFDKYFASYY KMTSQYPFEA ETPECLVGSV
110 120 130 140 150
PVQCLCQGLE LDCDETNLRA VPSVSSNVTA MSLQWNLIRK LPPDCFKNYH
160 170 180 190 200
DLQKLYLQNN KITSISIYAF RGLNSLTKLY LSHNRITFLK PGVFEDLHRL
210 220 230 240 250
EWLIIEDNHL SRISPPTFYG LNSLILLVLM NNVLTRLPDK PLCQHMPRLH
260 270 280 290 300
WLDLEGNHIH NLRNLTFISC SNLTVLVMRK NKINHLNENT FAPLQKLDEL
310 320 330 340 350
DLGSNKIENL PPLIFKDLKE LSQLNLSYNP IQKIQANQFD YLVKLKSLSL
360 370 380 390 400
EGIEISNIQQ RMFRPLMNLS HIYFKKFQYC GYAPHVRSCK PNTDGISSLE
410 420 430 440 450
NLLASIIQRV FVWVVSAVTC FGNIFVICMR PYIRSENKLY AMSIISLCCA
460 470 480 490 500
DCLMGIYLFV IGGFDLKFRG EYNKHAQLWM ESTHCQLVGS LAILSTEVSV
510 520 530 540 550
LLLTFLTLEK YICIVYPFRC VRPGKCRTIT VLILIWITGF IVAFIPLSNK
560 570 580 590 600
EFFKNYYGTN GVCFPLHSED TESIGAQIYS VAIFLGINLA AFIIIVFSYG
610 620 630 640 650
SMFYSVHQSA ITATEIRNQV KKEMILAKRF FFIVFTDALC WIPIFVVKFL
660 670 680 690 700
SLLQVEIPGT ITSWVVIFIL PINSALNPIL YTLTTRPFKE MIHRFWYNYR
710 720 730 740 750
QRKSMDSKGQ KTYAPSFIWV EMWPLQEMPP ELMKPDLFTY PCEMSLISQS

TRLNSYS
Length:757
Mass (Da):86,975
Last modified:December 4, 2007 - v2
Checksum:iB32DD71B1A5D5864
GO
Isoform 2 (identifier: Q9HBX9-2) [UniParc]FASTAAdd to basket
Also known as: LGR7.10

The sequence of this isoform differs from the canonical sequence as follows:
     63-96: GDNNGWSLQFDKYFASYYKMTSQYPFEAETPECL → V

Show »
Length:724
Mass (Da):83,060
Checksum:i10976FE385EFEAF8
GO
Isoform 3 (identifier: Q9HBX9-3) [UniParc]FASTAAdd to basket
Also known as: LGR7.1

The sequence of this isoform differs from the canonical sequence as follows:
     180-189: YLSHNRITFL → SRAVKDGSEK
     190-757: Missing.

Show »
Length:189
Mass (Da):21,112
Checksum:iB9B3EF4D3C62778F
GO
Isoform 4 (identifier: Q9HBX9-4) [UniParc]FASTAAdd to basket
Also known as: LGR7.2

The sequence of this isoform differs from the canonical sequence as follows:
     300-348: LDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSL → F

Show »
Length:709
Mass (Da):81,481
Checksum:i18F5684D7CF67595
GO
Isoform 5 (identifier: Q9HBX9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     252-275: Missing.

Note: No experimental confirmation available.
Show »
Length:652
Mass (Da):75,272
Checksum:i8E942E974CFBF545
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti70L → M in AAG17167 (PubMed:10935549).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0543751 – 81Missing in isoform 5. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_00198463 – 96GDNNG…TPECL → V in isoform 2. 3 PublicationsAdd BLAST34
Alternative sequenceiVSP_029877180 – 189YLSHNRITFL → SRAVKDGSEK in isoform 3. 1 Publication10
Alternative sequenceiVSP_029878190 – 757Missing in isoform 3. 1 PublicationAdd BLAST568
Alternative sequenceiVSP_054376252 – 275Missing in isoform 5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_029879300 – 348LDLGS…KLKSL → F in isoform 4. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190500 mRNA Translation: AAG17167.1
AY899848 mRNA Translation: AAX85196.1
AY899849 mRNA Translation: AAX85197.1
AY899850 mRNA Translation: AAX85198.1
AK295040 mRNA Translation: BAG58092.1
AK300379 mRNA Translation: BAG62114.1
AC019341 Genomic DNA No translation available.
AC107056 Genomic DNA No translation available.
AC107219 Genomic DNA No translation available.
AC108017 Genomic DNA No translation available.
AC121161 Genomic DNA No translation available.
AC125489 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04856.1
BC112142 mRNA Translation: AAI12143.1
BC113617 mRNA Translation: AAI13618.1
CCDSiCCDS43276.1 [Q9HBX9-1]
CCDS58929.1 [Q9HBX9-4]
CCDS58930.1 [Q9HBX9-2]
RefSeqiNP_001240657.1, NM_001253728.1 [Q9HBX9-2]
NP_001240658.1, NM_001253729.1 [Q9HBX9-4]
NP_067647.2, NM_021634.3 [Q9HBX9-1]
UniGeneiHs.591686

Genome annotation databases

EnsembliENST00000307765; ENSP00000303248; ENSG00000171509 [Q9HBX9-1]
ENST00000343542; ENSP00000345889; ENSG00000171509 [Q9HBX9-4]
ENST00000470033; ENSP00000420712; ENSG00000171509 [Q9HBX9-2]
ENST00000471616; ENSP00000434475; ENSG00000171509 [Q9HBX9-3]
GeneIDi59350
KEGGihsa:59350
UCSCiuc003ipz.4 human [Q9HBX9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRXFP1_HUMAN
AccessioniPrimary (citable) accession number: Q9HBX9
Secondary accession number(s): B4DHD1
, B4DTV2, Q2M215, Q3KU24, Q3KU25, Q3KU26
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: December 4, 2007
Last modified: March 28, 2018
This is version 158 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome