Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Relaxin receptor 1

Gene

RXFP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi45Calcium; via carbonyl oxygen1
Metal bindingi48Calcium1
Metal bindingi50Calcium; via carbonyl oxygen1
Metal bindingi52Calcium1
Metal bindingi58Calcium1
Metal bindingi59Calcium1

GO - Molecular functioni

  • G-protein coupled receptor activity Source: MGI
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000171509-MONOMER.
ReactomeiR-HSA-418555. G alpha (s) signalling events.
R-HSA-444821. Relaxin receptors.
SIGNORiQ9HBX9.

Names & Taxonomyi

Protein namesi
Recommended name:
Relaxin receptor 1
Alternative name(s):
Leucine-rich repeat-containing G-protein coupled receptor 7
Relaxin family peptide receptor 1
Gene namesi
Name:RXFP1
Synonyms:LGR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:19718. RXFP1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 409ExtracellularSequence analysisAdd BLAST409
Transmembranei410 – 430Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini431 – 443CytoplasmicSequence analysisAdd BLAST13
Transmembranei444 – 464Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini465 – 486ExtracellularSequence analysisAdd BLAST22
Transmembranei487 – 507Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini508 – 527CytoplasmicSequence analysisAdd BLAST20
Transmembranei528 – 548Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini549 – 577ExtracellularSequence analysisAdd BLAST29
Transmembranei578 – 598Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini599 – 629CytoplasmicSequence analysisAdd BLAST31
Transmembranei630 – 650Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini651ExtracellularSequence analysis1
Transmembranei652 – 672Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini673 – 757CytoplasmicSequence analysisAdd BLAST85

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi637D → Y: Leads to constitutive increase of basal cAMP. 1 Publication1

Organism-specific databases

DisGeNETi59350.
OpenTargetsiENSG00000171509.
PharmGKBiPA134868312.

Chemistry databases

ChEMBLiCHEMBL1293316.
GuidetoPHARMACOLOGYi351.

Polymorphism and mutation databases

BioMutaiRXFP1.
DMDMi166209887.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000697001 – 757Relaxin receptor 1Add BLAST757

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi27 ↔ 40
Disulfide bondi34 ↔ 53
Glycosylationi36N-linked (GlcNAc...)1 Publication1
Disulfide bondi47 ↔ 62
Glycosylationi127N-linked (GlcNAc...)1 Publication1
Glycosylationi264N-linked (GlcNAc...)1 Publication1
Glycosylationi272N-linked (GlcNAc...)1 Publication1
Glycosylationi325N-linked (GlcNAc...)1 Publication1
Glycosylationi368N-linked (GlcNAc...)1 Publication1
Disulfide bondi485 ↔ 563

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9HBX9.
PaxDbiQ9HBX9.
PeptideAtlasiQ9HBX9.
PRIDEiQ9HBX9.

PTM databases

iPTMnetiQ9HBX9.
PhosphoSitePlusiQ9HBX9.

Expressioni

Tissue specificityi

Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.1 Publication

Gene expression databases

BgeeiENSG00000171509.
CleanExiHS_RXFP1.
ExpressionAtlasiQ9HBX9. baseline and differential.
GenevisibleiQ9HBX9. HS.

Organism-specific databases

HPAiHPA027067.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
AKAP5P245882EBI-8088969,EBI-703640

Protein-protein interaction databases

BioGridi121891. 2 interactors.
IntActiQ9HBX9. 5 interactors.
MINTiMINT-231156.
STRINGi9606.ENSP00000303248.

Chemistry databases

BindingDBiQ9HBX9.

Structurei

Secondary structure

1757
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi31 – 33Combined sources3
Beta strandi35 – 38Combined sources4
Beta strandi40 – 42Combined sources3
Helixi43 – 45Combined sources3
Beta strandi53 – 55Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JM4NMR-A23-63[»]
2M7PNMR-A28-39[»]
ProteinModelPortaliQ9HBX9.
SMRiQ9HBX9.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HBX9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 63LDL-receptor class APROSITE-ProRule annotationAdd BLAST38
Domaini91 – 127LRRNTAdd BLAST37
Repeati151 – 172LRR 1Add BLAST22
Repeati175 – 196LRR 2Add BLAST22
Repeati199 – 220LRR 3Add BLAST22
Repeati223 – 244LRR 4Add BLAST22
Repeati248 – 269LRR 5Add BLAST22
Repeati272 – 293LRR 6Add BLAST22
Repeati296 – 317LRR 7Add BLAST22
Repeati320 – 341LRR 8Add BLAST22
Repeati344 – 365LRR 9Add BLAST22

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation
Contains 1 LDL-receptor class A domain.PROSITE-ProRule annotation
Contains 9 LRR (leucine-rich) repeats.Curated
Contains 1 LRRNT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
KOG2087. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00760000119088.
HOGENOMiHOG000049056.
HOVERGENiHBG026354.
InParanoidiQ9HBX9.
KOiK04306.
PhylomeDBiQ9HBX9.
TreeFamiTF326185.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
4.10.400.10. 1 hit.
InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR032675. L_dom-like.
IPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR008112. Relaxin_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
PF00057. Ldl_recept_a. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01739. RELAXINR.
SMARTiSM00192. LDLa. 1 hit.
SM00369. LRR_TYP. 9 hits.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
SSF57424. SSF57424. 1 hit.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
PS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
PS51450. LRR. 10 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HBX9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSGSVFFYI LIFGKYFSHG GGQDVKCSLG YFPCGNITKC LPQLLHCNGV
60 70 80 90 100
DDCGNQADED NCGDNNGWSL QFDKYFASYY KMTSQYPFEA ETPECLVGSV
110 120 130 140 150
PVQCLCQGLE LDCDETNLRA VPSVSSNVTA MSLQWNLIRK LPPDCFKNYH
160 170 180 190 200
DLQKLYLQNN KITSISIYAF RGLNSLTKLY LSHNRITFLK PGVFEDLHRL
210 220 230 240 250
EWLIIEDNHL SRISPPTFYG LNSLILLVLM NNVLTRLPDK PLCQHMPRLH
260 270 280 290 300
WLDLEGNHIH NLRNLTFISC SNLTVLVMRK NKINHLNENT FAPLQKLDEL
310 320 330 340 350
DLGSNKIENL PPLIFKDLKE LSQLNLSYNP IQKIQANQFD YLVKLKSLSL
360 370 380 390 400
EGIEISNIQQ RMFRPLMNLS HIYFKKFQYC GYAPHVRSCK PNTDGISSLE
410 420 430 440 450
NLLASIIQRV FVWVVSAVTC FGNIFVICMR PYIRSENKLY AMSIISLCCA
460 470 480 490 500
DCLMGIYLFV IGGFDLKFRG EYNKHAQLWM ESTHCQLVGS LAILSTEVSV
510 520 530 540 550
LLLTFLTLEK YICIVYPFRC VRPGKCRTIT VLILIWITGF IVAFIPLSNK
560 570 580 590 600
EFFKNYYGTN GVCFPLHSED TESIGAQIYS VAIFLGINLA AFIIIVFSYG
610 620 630 640 650
SMFYSVHQSA ITATEIRNQV KKEMILAKRF FFIVFTDALC WIPIFVVKFL
660 670 680 690 700
SLLQVEIPGT ITSWVVIFIL PINSALNPIL YTLTTRPFKE MIHRFWYNYR
710 720 730 740 750
QRKSMDSKGQ KTYAPSFIWV EMWPLQEMPP ELMKPDLFTY PCEMSLISQS

TRLNSYS
Length:757
Mass (Da):86,975
Last modified:December 4, 2007 - v2
Checksum:iB32DD71B1A5D5864
GO
Isoform 2 (identifier: Q9HBX9-2) [UniParc]FASTAAdd to basket
Also known as: LGR7.10

The sequence of this isoform differs from the canonical sequence as follows:
     63-96: GDNNGWSLQFDKYFASYYKMTSQYPFEAETPECL → V

Show »
Length:724
Mass (Da):83,060
Checksum:i10976FE385EFEAF8
GO
Isoform 3 (identifier: Q9HBX9-3) [UniParc]FASTAAdd to basket
Also known as: LGR7.1

The sequence of this isoform differs from the canonical sequence as follows:
     180-189: YLSHNRITFL → SRAVKDGSEK
     190-757: Missing.

Show »
Length:189
Mass (Da):21,112
Checksum:iB9B3EF4D3C62778F
GO
Isoform 4 (identifier: Q9HBX9-4) [UniParc]FASTAAdd to basket
Also known as: LGR7.2

The sequence of this isoform differs from the canonical sequence as follows:
     300-348: LDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSL → F

Show »
Length:709
Mass (Da):81,481
Checksum:i18F5684D7CF67595
GO
Isoform 5 (identifier: Q9HBX9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     252-275: Missing.

Note: No experimental confirmation available.
Show »
Length:652
Mass (Da):75,272
Checksum:i8E942E974CFBF545
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti70L → M in AAG17167 (PubMed:10935549).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0543751 – 81Missing in isoform 5. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_00198463 – 96GDNNG…TPECL → V in isoform 2. 3 PublicationsAdd BLAST34
Alternative sequenceiVSP_029877180 – 189YLSHNRITFL → SRAVKDGSEK in isoform 3. 1 Publication10
Alternative sequenceiVSP_029878190 – 757Missing in isoform 3. 1 PublicationAdd BLAST568
Alternative sequenceiVSP_054376252 – 275Missing in isoform 5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_029879300 – 348LDLGS…KLKSL → F in isoform 4. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190500 mRNA. Translation: AAG17167.1.
AY899848 mRNA. Translation: AAX85196.1.
AY899849 mRNA. Translation: AAX85197.1.
AY899850 mRNA. Translation: AAX85198.1.
AK295040 mRNA. Translation: BAG58092.1.
AK300379 mRNA. Translation: BAG62114.1.
AC019341 Genomic DNA. No translation available.
AC107056 Genomic DNA. No translation available.
AC107219 Genomic DNA. No translation available.
AC108017 Genomic DNA. No translation available.
AC121161 Genomic DNA. No translation available.
AC125489 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04856.1.
BC112142 mRNA. Translation: AAI12143.1.
BC113617 mRNA. Translation: AAI13618.1.
CCDSiCCDS43276.1. [Q9HBX9-1]
CCDS58929.1. [Q9HBX9-4]
CCDS58930.1. [Q9HBX9-2]
RefSeqiNP_001240657.1. NM_001253728.1. [Q9HBX9-2]
NP_001240658.1. NM_001253729.1. [Q9HBX9-4]
NP_067647.2. NM_021634.3. [Q9HBX9-1]
UniGeneiHs.591686.

Genome annotation databases

EnsembliENST00000307765; ENSP00000303248; ENSG00000171509. [Q9HBX9-1]
ENST00000343542; ENSP00000345889; ENSG00000171509. [Q9HBX9-4]
ENST00000470033; ENSP00000420712; ENSG00000171509. [Q9HBX9-2]
ENST00000471616; ENSP00000434475; ENSG00000171509. [Q9HBX9-3]
GeneIDi59350.
KEGGihsa:59350.
UCSCiuc003ipz.4. human. [Q9HBX9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190500 mRNA. Translation: AAG17167.1.
AY899848 mRNA. Translation: AAX85196.1.
AY899849 mRNA. Translation: AAX85197.1.
AY899850 mRNA. Translation: AAX85198.1.
AK295040 mRNA. Translation: BAG58092.1.
AK300379 mRNA. Translation: BAG62114.1.
AC019341 Genomic DNA. No translation available.
AC107056 Genomic DNA. No translation available.
AC107219 Genomic DNA. No translation available.
AC108017 Genomic DNA. No translation available.
AC121161 Genomic DNA. No translation available.
AC125489 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04856.1.
BC112142 mRNA. Translation: AAI12143.1.
BC113617 mRNA. Translation: AAI13618.1.
CCDSiCCDS43276.1. [Q9HBX9-1]
CCDS58929.1. [Q9HBX9-4]
CCDS58930.1. [Q9HBX9-2]
RefSeqiNP_001240657.1. NM_001253728.1. [Q9HBX9-2]
NP_001240658.1. NM_001253729.1. [Q9HBX9-4]
NP_067647.2. NM_021634.3. [Q9HBX9-1]
UniGeneiHs.591686.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JM4NMR-A23-63[»]
2M7PNMR-A28-39[»]
ProteinModelPortaliQ9HBX9.
SMRiQ9HBX9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121891. 2 interactors.
IntActiQ9HBX9. 5 interactors.
MINTiMINT-231156.
STRINGi9606.ENSP00000303248.

Chemistry databases

BindingDBiQ9HBX9.
ChEMBLiCHEMBL1293316.
GuidetoPHARMACOLOGYi351.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiQ9HBX9.
PhosphoSitePlusiQ9HBX9.

Polymorphism and mutation databases

BioMutaiRXFP1.
DMDMi166209887.

Proteomic databases

MaxQBiQ9HBX9.
PaxDbiQ9HBX9.
PeptideAtlasiQ9HBX9.
PRIDEiQ9HBX9.

Protocols and materials databases

DNASUi59350.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307765; ENSP00000303248; ENSG00000171509. [Q9HBX9-1]
ENST00000343542; ENSP00000345889; ENSG00000171509. [Q9HBX9-4]
ENST00000470033; ENSP00000420712; ENSG00000171509. [Q9HBX9-2]
ENST00000471616; ENSP00000434475; ENSG00000171509. [Q9HBX9-3]
GeneIDi59350.
KEGGihsa:59350.
UCSCiuc003ipz.4. human. [Q9HBX9-1]

Organism-specific databases

CTDi59350.
DisGeNETi59350.
GeneCardsiRXFP1.
H-InvDBHIX0024561.
HGNCiHGNC:19718. RXFP1.
HPAiHPA027067.
MIMi606654. gene.
neXtProtiNX_Q9HBX9.
OpenTargetsiENSG00000171509.
PharmGKBiPA134868312.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
KOG2087. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00760000119088.
HOGENOMiHOG000049056.
HOVERGENiHBG026354.
InParanoidiQ9HBX9.
KOiK04306.
PhylomeDBiQ9HBX9.
TreeFamiTF326185.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000171509-MONOMER.
ReactomeiR-HSA-418555. G alpha (s) signalling events.
R-HSA-444821. Relaxin receptors.
SIGNORiQ9HBX9.

Miscellaneous databases

EvolutionaryTraceiQ9HBX9.
GeneWikiiRelaxin/insulin-like_family_peptide_receptor_1.
GenomeRNAii59350.
PROiQ9HBX9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171509.
CleanExiHS_RXFP1.
ExpressionAtlasiQ9HBX9. baseline and differential.
GenevisibleiQ9HBX9. HS.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
4.10.400.10. 1 hit.
InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR032675. L_dom-like.
IPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR008112. Relaxin_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
PF00057. Ldl_recept_a. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01739. RELAXINR.
SMARTiSM00192. LDLa. 1 hit.
SM00369. LRR_TYP. 9 hits.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
SSF57424. SSF57424. 1 hit.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
PS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
PS51450. LRR. 10 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRXFP1_HUMAN
AccessioniPrimary (citable) accession number: Q9HBX9
Secondary accession number(s): B4DHD1
, B4DTV2, Q2M215, Q3KU24, Q3KU25, Q3KU26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: December 4, 2007
Last modified: November 2, 2016
This is version 147 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.