Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HBX9

- RXFP1_HUMAN

UniProt

Q9HBX9 - RXFP1_HUMAN

Protein

Relaxin receptor 1

Gene

RXFP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 127 (01 Oct 2014)
      Sequence version 2 (04 Dec 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi45 – 451Calcium; via carbonyl oxygen
    Metal bindingi48 – 481Calcium
    Metal bindingi50 – 501Calcium; via carbonyl oxygen
    Metal bindingi52 – 521Calcium
    Metal bindingi58 – 581Calcium
    Metal bindingi59 – 591Calcium

    GO - Molecular functioni

    1. G-protein coupled receptor activity Source: MGI
    2. hormone binding Source: Ensembl
    3. metal ion binding Source: UniProtKB-KW
    4. protein binding Source: IntAct

    GO - Biological processi

    1. adenylate cyclase-modulating G-protein coupled receptor signaling pathway Source: Ensembl
    2. cell differentiation Source: Ensembl
    3. extracellular matrix organization Source: Ensembl
    4. lung connective tissue development Source: Ensembl
    5. nipple morphogenesis Source: Ensembl
    6. parturition Source: Ensembl

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_19327. G alpha (s) signalling events.
    REACT_21314. Relaxin receptors.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Relaxin receptor 1
    Alternative name(s):
    Leucine-rich repeat-containing G-protein coupled receptor 7
    Relaxin family peptide receptor 1
    Gene namesi
    Name:RXFP1
    Synonyms:LGR7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:19718. RXFP1.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi637 – 6371D → Y: Leads to constitutive increase of basal cAMP. 1 Publication

    Organism-specific databases

    PharmGKBiPA134868312.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 757757Relaxin receptor 1PRO_0000069700Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi27 ↔ 40
    Disulfide bondi34 ↔ 53
    Glycosylationi36 – 361N-linked (GlcNAc...)1 Publication
    Disulfide bondi47 ↔ 62
    Glycosylationi127 – 1271N-linked (GlcNAc...)1 Publication
    Glycosylationi264 – 2641N-linked (GlcNAc...)1 Publication
    Glycosylationi272 – 2721N-linked (GlcNAc...)1 Publication
    Glycosylationi325 – 3251N-linked (GlcNAc...)1 Publication
    Glycosylationi368 – 3681N-linked (GlcNAc...)1 Publication
    Disulfide bondi485 ↔ 563

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9HBX9.
    PRIDEiQ9HBX9.

    PTM databases

    PhosphoSiteiQ9HBX9.

    Expressioni

    Tissue specificityi

    Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.1 Publication

    Gene expression databases

    ArrayExpressiQ9HBX9.
    BgeeiQ9HBX9.
    CleanExiHS_RXFP1.
    GenevestigatoriQ9HBX9.

    Organism-specific databases

    HPAiHPA027067.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    AKAP5P245882EBI-8088969,EBI-703640

    Protein-protein interaction databases

    BioGridi121891. 1 interaction.
    IntActiQ9HBX9. 5 interactions.
    MINTiMINT-231156.
    STRINGi9606.ENSP00000303248.

    Structurei

    Secondary structure

    1
    757
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi31 – 333
    Beta strandi35 – 384
    Beta strandi40 – 423
    Helixi43 – 453
    Beta strandi53 – 553

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2JM4NMR-A23-63[»]
    2M7PNMR-A28-39[»]
    ProteinModelPortaliQ9HBX9.
    SMRiQ9HBX9. Positions 21-63, 73-681.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9HBX9.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 409409ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini431 – 44313CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini465 – 48622ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini508 – 52720CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini549 – 57729ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini599 – 62931CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini651 – 6511ExtracellularSequence Analysis
    Topological domaini673 – 75785CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei410 – 43021Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei444 – 46421Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei487 – 50721Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei528 – 54821Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei578 – 59821Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei630 – 65021Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei652 – 67221Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini26 – 6338LDL-receptor class APROSITE-ProRule annotationAdd
    BLAST
    Domaini91 – 12737LRRNTAdd
    BLAST
    Repeati151 – 17222LRR 1Add
    BLAST
    Repeati175 – 19622LRR 2Add
    BLAST
    Repeati199 – 22022LRR 3Add
    BLAST
    Repeati223 – 24422LRR 4Add
    BLAST
    Repeati248 – 26922LRR 5Add
    BLAST
    Repeati272 – 29322LRR 6Add
    BLAST
    Repeati296 – 31722LRR 7Add
    BLAST
    Repeati320 – 34122LRR 8Add
    BLAST
    Repeati344 – 36522LRR 9Add
    BLAST

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation
    Contains 1 LDL-receptor class A domain.PROSITE-ProRule annotation
    Contains 9 LRR (leucine-rich) repeats.Curated
    Contains 1 LRRNT domain.Curated

    Keywords - Domaini

    Leucine-rich repeat, Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG4886.
    HOVERGENiHBG026354.
    InParanoidiQ9HBX9.
    KOiK04306.
    OMAiTRPFKEM.
    PhylomeDBiQ9HBX9.
    TreeFamiTF326185.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    4.10.400.10. 1 hit.
    InterProiIPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR023415. LDLR_class-A_CS.
    IPR002172. LDrepeatLR_classA_rpt.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR000372. LRR-contain_N.
    IPR008112. Relaxin_rcpt.
    [Graphical view]
    PfamiPF00001. 7tm_1. 1 hit.
    PF00057. Ldl_recept_a. 1 hit.
    PF13855. LRR_8. 2 hits.
    [Graphical view]
    PRINTSiPR00237. GPCRRHODOPSN.
    PR01739. RELAXINR.
    SMARTiSM00192. LDLa. 1 hit.
    SM00369. LRR_TYP. 2 hits.
    SM00013. LRRNT. 1 hit.
    [Graphical view]
    SUPFAMiSSF57424. SSF57424. 1 hit.
    PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    PS01209. LDLRA_1. 1 hit.
    PS50068. LDLRA_2. 1 hit.
    PS51450. LRR. 10 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HBX9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTSGSVFFYI LIFGKYFSHG GGQDVKCSLG YFPCGNITKC LPQLLHCNGV    50
    DDCGNQADED NCGDNNGWSL QFDKYFASYY KMTSQYPFEA ETPECLVGSV 100
    PVQCLCQGLE LDCDETNLRA VPSVSSNVTA MSLQWNLIRK LPPDCFKNYH 150
    DLQKLYLQNN KITSISIYAF RGLNSLTKLY LSHNRITFLK PGVFEDLHRL 200
    EWLIIEDNHL SRISPPTFYG LNSLILLVLM NNVLTRLPDK PLCQHMPRLH 250
    WLDLEGNHIH NLRNLTFISC SNLTVLVMRK NKINHLNENT FAPLQKLDEL 300
    DLGSNKIENL PPLIFKDLKE LSQLNLSYNP IQKIQANQFD YLVKLKSLSL 350
    EGIEISNIQQ RMFRPLMNLS HIYFKKFQYC GYAPHVRSCK PNTDGISSLE 400
    NLLASIIQRV FVWVVSAVTC FGNIFVICMR PYIRSENKLY AMSIISLCCA 450
    DCLMGIYLFV IGGFDLKFRG EYNKHAQLWM ESTHCQLVGS LAILSTEVSV 500
    LLLTFLTLEK YICIVYPFRC VRPGKCRTIT VLILIWITGF IVAFIPLSNK 550
    EFFKNYYGTN GVCFPLHSED TESIGAQIYS VAIFLGINLA AFIIIVFSYG 600
    SMFYSVHQSA ITATEIRNQV KKEMILAKRF FFIVFTDALC WIPIFVVKFL 650
    SLLQVEIPGT ITSWVVIFIL PINSALNPIL YTLTTRPFKE MIHRFWYNYR 700
    QRKSMDSKGQ KTYAPSFIWV EMWPLQEMPP ELMKPDLFTY PCEMSLISQS 750
    TRLNSYS 757
    Length:757
    Mass (Da):86,975
    Last modified:December 4, 2007 - v2
    Checksum:iB32DD71B1A5D5864
    GO
    Isoform 2 (identifier: Q9HBX9-2) [UniParc]FASTAAdd to Basket

    Also known as: LGR7.10

    The sequence of this isoform differs from the canonical sequence as follows:
         63-96: GDNNGWSLQFDKYFASYYKMTSQYPFEAETPECL → V

    Show »
    Length:724
    Mass (Da):83,060
    Checksum:i10976FE385EFEAF8
    GO
    Isoform 3 (identifier: Q9HBX9-3) [UniParc]FASTAAdd to Basket

    Also known as: LGR7.1

    The sequence of this isoform differs from the canonical sequence as follows:
         180-189: YLSHNRITFL → SRAVKDGSEK
         190-757: Missing.

    Show »
    Length:189
    Mass (Da):21,112
    Checksum:iB9B3EF4D3C62778F
    GO
    Isoform 4 (identifier: Q9HBX9-4) [UniParc]FASTAAdd to Basket

    Also known as: LGR7.2

    The sequence of this isoform differs from the canonical sequence as follows:
         300-348: LDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSL → F

    Show »
    Length:709
    Mass (Da):81,481
    Checksum:i18F5684D7CF67595
    GO
    Isoform 5 (identifier: Q9HBX9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-81: Missing.
         252-275: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:652
    Mass (Da):75,272
    Checksum:i8E942E974CFBF545
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti70 – 701L → M in AAG17167. (PubMed:10935549)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8181Missing in isoform 5. 1 PublicationVSP_054375Add
    BLAST
    Alternative sequencei63 – 9634GDNNG…TPECL → V in isoform 2. 3 PublicationsVSP_001984Add
    BLAST
    Alternative sequencei180 – 18910YLSHNRITFL → SRAVKDGSEK in isoform 3. 1 PublicationVSP_029877
    Alternative sequencei190 – 757568Missing in isoform 3. 1 PublicationVSP_029878Add
    BLAST
    Alternative sequencei252 – 27524Missing in isoform 5. 1 PublicationVSP_054376Add
    BLAST
    Alternative sequencei300 – 34849LDLGS…KLKSL → F in isoform 4. 1 PublicationVSP_029879Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF190500 mRNA. Translation: AAG17167.1.
    AY899848 mRNA. Translation: AAX85196.1.
    AY899849 mRNA. Translation: AAX85197.1.
    AY899850 mRNA. Translation: AAX85198.1.
    AK295040 mRNA. Translation: BAG58092.1.
    AK300379 mRNA. Translation: BAG62114.1.
    AC019341 Genomic DNA. No translation available.
    AC107056 Genomic DNA. No translation available.
    AC107219 Genomic DNA. No translation available.
    AC108017 Genomic DNA. No translation available.
    AC121161 Genomic DNA. No translation available.
    AC125489 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04856.1.
    BC112142 mRNA. Translation: AAI12143.1.
    BC113617 mRNA. Translation: AAI13618.1.
    CCDSiCCDS43276.1. [Q9HBX9-1]
    CCDS58929.1. [Q9HBX9-4]
    CCDS58930.1. [Q9HBX9-2]
    RefSeqiNP_001240657.1. NM_001253728.1. [Q9HBX9-2]
    NP_001240658.1. NM_001253729.1. [Q9HBX9-4]
    NP_067647.2. NM_021634.3. [Q9HBX9-1]
    UniGeneiHs.591686.

    Genome annotation databases

    EnsembliENST00000307765; ENSP00000303248; ENSG00000171509. [Q9HBX9-1]
    ENST00000343542; ENSP00000345889; ENSG00000171509. [Q9HBX9-4]
    ENST00000423548; ENSP00000405841; ENSG00000171509. [Q9HBX9-3]
    ENST00000448688; ENSP00000414885; ENSG00000171509. [Q9HBX9-5]
    ENST00000470033; ENSP00000420712; ENSG00000171509. [Q9HBX9-2]
    ENST00000471616; ENSP00000434475; ENSG00000171509. [Q9HBX9-3]
    GeneIDi59350.
    KEGGihsa:59350.
    UCSCiuc003ipz.3. human. [Q9HBX9-1]
    uc010iqm.3. human. [Q9HBX9-2]
    uc010iqo.3. human. [Q9HBX9-4]

    Polymorphism databases

    DMDMi166209887.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF190500 mRNA. Translation: AAG17167.1 .
    AY899848 mRNA. Translation: AAX85196.1 .
    AY899849 mRNA. Translation: AAX85197.1 .
    AY899850 mRNA. Translation: AAX85198.1 .
    AK295040 mRNA. Translation: BAG58092.1 .
    AK300379 mRNA. Translation: BAG62114.1 .
    AC019341 Genomic DNA. No translation available.
    AC107056 Genomic DNA. No translation available.
    AC107219 Genomic DNA. No translation available.
    AC108017 Genomic DNA. No translation available.
    AC121161 Genomic DNA. No translation available.
    AC125489 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04856.1 .
    BC112142 mRNA. Translation: AAI12143.1 .
    BC113617 mRNA. Translation: AAI13618.1 .
    CCDSi CCDS43276.1. [Q9HBX9-1 ]
    CCDS58929.1. [Q9HBX9-4 ]
    CCDS58930.1. [Q9HBX9-2 ]
    RefSeqi NP_001240657.1. NM_001253728.1. [Q9HBX9-2 ]
    NP_001240658.1. NM_001253729.1. [Q9HBX9-4 ]
    NP_067647.2. NM_021634.3. [Q9HBX9-1 ]
    UniGenei Hs.591686.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2JM4 NMR - A 23-63 [» ]
    2M7P NMR - A 28-39 [» ]
    ProteinModelPortali Q9HBX9.
    SMRi Q9HBX9. Positions 21-63, 73-681.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121891. 1 interaction.
    IntActi Q9HBX9. 5 interactions.
    MINTi MINT-231156.
    STRINGi 9606.ENSP00000303248.

    Chemistry

    ChEMBLi CHEMBL1293316.
    GuidetoPHARMACOLOGYi 351.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q9HBX9.

    Polymorphism databases

    DMDMi 166209887.

    Proteomic databases

    PaxDbi Q9HBX9.
    PRIDEi Q9HBX9.

    Protocols and materials databases

    DNASUi 59350.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000307765 ; ENSP00000303248 ; ENSG00000171509 . [Q9HBX9-1 ]
    ENST00000343542 ; ENSP00000345889 ; ENSG00000171509 . [Q9HBX9-4 ]
    ENST00000423548 ; ENSP00000405841 ; ENSG00000171509 . [Q9HBX9-3 ]
    ENST00000448688 ; ENSP00000414885 ; ENSG00000171509 . [Q9HBX9-5 ]
    ENST00000470033 ; ENSP00000420712 ; ENSG00000171509 . [Q9HBX9-2 ]
    ENST00000471616 ; ENSP00000434475 ; ENSG00000171509 . [Q9HBX9-3 ]
    GeneIDi 59350.
    KEGGi hsa:59350.
    UCSCi uc003ipz.3. human. [Q9HBX9-1 ]
    uc010iqm.3. human. [Q9HBX9-2 ]
    uc010iqo.3. human. [Q9HBX9-4 ]

    Organism-specific databases

    CTDi 59350.
    GeneCardsi GC04P159236.
    H-InvDB HIX0024561.
    HGNCi HGNC:19718. RXFP1.
    HPAi HPA027067.
    MIMi 606654. gene.
    neXtProti NX_Q9HBX9.
    PharmGKBi PA134868312.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG4886.
    HOVERGENi HBG026354.
    InParanoidi Q9HBX9.
    KOi K04306.
    OMAi TRPFKEM.
    PhylomeDBi Q9HBX9.
    TreeFami TF326185.

    Enzyme and pathway databases

    Reactomei REACT_19327. G alpha (s) signalling events.
    REACT_21314. Relaxin receptors.

    Miscellaneous databases

    EvolutionaryTracei Q9HBX9.
    GeneWikii Relaxin/insulin-like_family_peptide_receptor_1.
    GenomeRNAii 59350.
    NextBioi 35471982.
    PROi Q9HBX9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HBX9.
    Bgeei Q9HBX9.
    CleanExi HS_RXFP1.
    Genevestigatori Q9HBX9.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    4.10.400.10. 1 hit.
    InterProi IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR023415. LDLR_class-A_CS.
    IPR002172. LDrepeatLR_classA_rpt.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR000372. LRR-contain_N.
    IPR008112. Relaxin_rcpt.
    [Graphical view ]
    Pfami PF00001. 7tm_1. 1 hit.
    PF00057. Ldl_recept_a. 1 hit.
    PF13855. LRR_8. 2 hits.
    [Graphical view ]
    PRINTSi PR00237. GPCRRHODOPSN.
    PR01739. RELAXINR.
    SMARTi SM00192. LDLa. 1 hit.
    SM00369. LRR_TYP. 2 hits.
    SM00013. LRRNT. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57424. SSF57424. 1 hit.
    PROSITEi PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    PS01209. LDLRA_1. 1 hit.
    PS50068. LDLRA_2. 1 hit.
    PS51450. LRR. 10 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The three subfamilies of leucine-rich repeat-containing G protein-coupled receptors (LGR): identification of LGR6 and LGR7 and the signaling mechanism for LGR7."
      Hsu S.Y., Kudo M., Chen T., Nakabayashi K., Bhalla A., van der Spek P.J., van Duin M., Hsueh A.J.W.
      Mol. Endocrinol. 14:1257-1271(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), MUTAGENESIS OF ASP-637.
    2. "Splice variants of the relaxin and INSL3 receptors reveal unanticipated molecular complexity."
      Muda M., He C., Martini P.G.V., Ferraro T., Layfield S., Taylor D., Chevrier C., Schweickhardt R., Kelton C., Ryan P.L., Bathgate R.A.D.
      Mol. Hum. Reprod. 11:591-600(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
      Tissue: Brain and Placenta.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain cortex.
    7. "Relaxin signalling links tyrosine phosphorylation to phosphodiesterase and adenylyl cyclase activity."
      Bartsch O., Bartlick B., Ivell R.
      Mol. Hum. Reprod. 7:799-809(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    8. "H3 relaxin is a specific ligand for LGR7 and activates the receptor by interacting with both the ectodomain and the exoloop 2."
      Sudo S., Kumagai J., Nishi S., Layfield S., Ferraro T., Bathgate R.A.D., Hsueh A.J.W.
      J. Biol. Chem. 278:7855-7862(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH RLN3.
    9. "Identification of the N-linked glycosylation sites of the human relaxin receptor and effect of glycosylation on receptor function."
      Yan Y., Scott D.J., Wilkinson T.N., Ji J., Tregear G.W., Bathgate R.A.
      Biochemistry 47:6953-6968(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT ASN-36; ASN-127; ASN-264; ASN-272; ASN-325 AND ASN-368.
    10. "The NMR solution structure of the relaxin (RXFP1) receptor lipoprotein receptor class A module and identification of key residues in the N-terminal region of the module that mediate receptor activation."
      Hopkins E.J., Layfield S., Ferraro T., Bathgate R.A.D., Gooley P.R.
      J. Biol. Chem. 282:4172-4184(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 23-63 IN COMPLEX WITH CALCIUM IONS.

    Entry informationi

    Entry nameiRXFP1_HUMAN
    AccessioniPrimary (citable) accession number: Q9HBX9
    Secondary accession number(s): B4DHD1
    , B4DTV2, Q2M215, Q3KU24, Q3KU25, Q3KU26
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 6, 2002
    Last sequence update: December 4, 2007
    Last modified: October 1, 2014
    This is version 127 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3