Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HBX9

- RXFP1_HUMAN

UniProt

Q9HBX9 - RXFP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Relaxin receptor 1

Gene

RXFP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi45 – 451Calcium; via carbonyl oxygen
Metal bindingi48 – 481Calcium
Metal bindingi50 – 501Calcium; via carbonyl oxygen
Metal bindingi52 – 521Calcium
Metal bindingi58 – 581Calcium
Metal bindingi59 – 591Calcium

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: MGI
  2. hormone binding Source: Ensembl
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. adenylate cyclase-modulating G-protein coupled receptor signaling pathway Source: Ensembl
  2. cell differentiation Source: Ensembl
  3. extracellular matrix organization Source: Ensembl
  4. lung connective tissue development Source: Ensembl
  5. nipple morphogenesis Source: Ensembl
  6. parturition Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_19327. G alpha (s) signalling events.
REACT_21314. Relaxin receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Relaxin receptor 1
Alternative name(s):
Leucine-rich repeat-containing G-protein coupled receptor 7
Relaxin family peptide receptor 1
Gene namesi
Name:RXFP1
Synonyms:LGR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:19718. RXFP1.

Subcellular locationi

Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 409409ExtracellularSequence AnalysisAdd
BLAST
Transmembranei410 – 43021Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini431 – 44313CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei444 – 46421Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini465 – 48622ExtracellularSequence AnalysisAdd
BLAST
Transmembranei487 – 50721Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini508 – 52720CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei528 – 54821Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini549 – 57729ExtracellularSequence AnalysisAdd
BLAST
Transmembranei578 – 59821Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini599 – 62931CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei630 – 65021Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini651 – 6511ExtracellularSequence Analysis
Transmembranei652 – 67221Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini673 – 75785CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi637 – 6371D → Y: Leads to constitutive increase of basal cAMP. 1 Publication

Organism-specific databases

PharmGKBiPA134868312.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 757757Relaxin receptor 1PRO_0000069700Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi27 ↔ 40
Disulfide bondi34 ↔ 53
Glycosylationi36 – 361N-linked (GlcNAc...)1 Publication
Disulfide bondi47 ↔ 62
Glycosylationi127 – 1271N-linked (GlcNAc...)1 Publication
Glycosylationi264 – 2641N-linked (GlcNAc...)1 Publication
Glycosylationi272 – 2721N-linked (GlcNAc...)1 Publication
Glycosylationi325 – 3251N-linked (GlcNAc...)1 Publication
Glycosylationi368 – 3681N-linked (GlcNAc...)1 Publication
Disulfide bondi485 ↔ 563

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9HBX9.
PaxDbiQ9HBX9.
PRIDEiQ9HBX9.

PTM databases

PhosphoSiteiQ9HBX9.

Expressioni

Tissue specificityi

Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.1 Publication

Gene expression databases

BgeeiQ9HBX9.
CleanExiHS_RXFP1.
ExpressionAtlasiQ9HBX9. baseline and differential.
GenevestigatoriQ9HBX9.

Organism-specific databases

HPAiHPA027067.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
AKAP5P245882EBI-8088969,EBI-703640

Protein-protein interaction databases

BioGridi121891. 1 interaction.
IntActiQ9HBX9. 5 interactions.
MINTiMINT-231156.
STRINGi9606.ENSP00000303248.

Structurei

Secondary structure

1
757
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi31 – 333Combined sources
Beta strandi35 – 384Combined sources
Beta strandi40 – 423Combined sources
Helixi43 – 453Combined sources
Beta strandi53 – 553Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2JM4NMR-A23-63[»]
2M7PNMR-A28-39[»]
ProteinModelPortaliQ9HBX9.
SMRiQ9HBX9. Positions 21-63, 73-681.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HBX9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini26 – 6338LDL-receptor class APROSITE-ProRule annotationAdd
BLAST
Domaini91 – 12737LRRNTAdd
BLAST
Repeati151 – 17222LRR 1Add
BLAST
Repeati175 – 19622LRR 2Add
BLAST
Repeati199 – 22022LRR 3Add
BLAST
Repeati223 – 24422LRR 4Add
BLAST
Repeati248 – 26922LRR 5Add
BLAST
Repeati272 – 29322LRR 6Add
BLAST
Repeati296 – 31722LRR 7Add
BLAST
Repeati320 – 34122LRR 8Add
BLAST
Repeati344 – 36522LRR 9Add
BLAST

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation
Contains 1 LDL-receptor class A domain.PROSITE-ProRule annotation
Contains 9 LRR (leucine-rich) repeats.Curated
Contains 1 LRRNT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4886.
GeneTreeiENSGT00760000119088.
HOVERGENiHBG026354.
InParanoidiQ9HBX9.
KOiK04306.
OMAiTRPFKEM.
PhylomeDBiQ9HBX9.
TreeFamiTF326185.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
4.10.400.10. 1 hit.
InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR000372. LRR-contain_N.
IPR008112. Relaxin_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
PF00057. Ldl_recept_a. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01739. RELAXINR.
SMARTiSM00192. LDLa. 1 hit.
SM00369. LRR_TYP. 2 hits.
SM00013. LRRNT. 1 hit.
[Graphical view]
SUPFAMiSSF57424. SSF57424. 1 hit.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
PS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
PS51450. LRR. 10 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HBX9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSGSVFFYI LIFGKYFSHG GGQDVKCSLG YFPCGNITKC LPQLLHCNGV
60 70 80 90 100
DDCGNQADED NCGDNNGWSL QFDKYFASYY KMTSQYPFEA ETPECLVGSV
110 120 130 140 150
PVQCLCQGLE LDCDETNLRA VPSVSSNVTA MSLQWNLIRK LPPDCFKNYH
160 170 180 190 200
DLQKLYLQNN KITSISIYAF RGLNSLTKLY LSHNRITFLK PGVFEDLHRL
210 220 230 240 250
EWLIIEDNHL SRISPPTFYG LNSLILLVLM NNVLTRLPDK PLCQHMPRLH
260 270 280 290 300
WLDLEGNHIH NLRNLTFISC SNLTVLVMRK NKINHLNENT FAPLQKLDEL
310 320 330 340 350
DLGSNKIENL PPLIFKDLKE LSQLNLSYNP IQKIQANQFD YLVKLKSLSL
360 370 380 390 400
EGIEISNIQQ RMFRPLMNLS HIYFKKFQYC GYAPHVRSCK PNTDGISSLE
410 420 430 440 450
NLLASIIQRV FVWVVSAVTC FGNIFVICMR PYIRSENKLY AMSIISLCCA
460 470 480 490 500
DCLMGIYLFV IGGFDLKFRG EYNKHAQLWM ESTHCQLVGS LAILSTEVSV
510 520 530 540 550
LLLTFLTLEK YICIVYPFRC VRPGKCRTIT VLILIWITGF IVAFIPLSNK
560 570 580 590 600
EFFKNYYGTN GVCFPLHSED TESIGAQIYS VAIFLGINLA AFIIIVFSYG
610 620 630 640 650
SMFYSVHQSA ITATEIRNQV KKEMILAKRF FFIVFTDALC WIPIFVVKFL
660 670 680 690 700
SLLQVEIPGT ITSWVVIFIL PINSALNPIL YTLTTRPFKE MIHRFWYNYR
710 720 730 740 750
QRKSMDSKGQ KTYAPSFIWV EMWPLQEMPP ELMKPDLFTY PCEMSLISQS

TRLNSYS
Length:757
Mass (Da):86,975
Last modified:December 4, 2007 - v2
Checksum:iB32DD71B1A5D5864
GO
Isoform 2 (identifier: Q9HBX9-2) [UniParc]FASTAAdd to Basket

Also known as: LGR7.10

The sequence of this isoform differs from the canonical sequence as follows:
     63-96: GDNNGWSLQFDKYFASYYKMTSQYPFEAETPECL → V

Show »
Length:724
Mass (Da):83,060
Checksum:i10976FE385EFEAF8
GO
Isoform 3 (identifier: Q9HBX9-3) [UniParc]FASTAAdd to Basket

Also known as: LGR7.1

The sequence of this isoform differs from the canonical sequence as follows:
     180-189: YLSHNRITFL → SRAVKDGSEK
     190-757: Missing.

Show »
Length:189
Mass (Da):21,112
Checksum:iB9B3EF4D3C62778F
GO
Isoform 4 (identifier: Q9HBX9-4) [UniParc]FASTAAdd to Basket

Also known as: LGR7.2

The sequence of this isoform differs from the canonical sequence as follows:
     300-348: LDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSL → F

Show »
Length:709
Mass (Da):81,481
Checksum:i18F5684D7CF67595
GO
Isoform 5 (identifier: Q9HBX9-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     252-275: Missing.

Note: No experimental confirmation available.

Show »
Length:652
Mass (Da):75,272
Checksum:i8E942E974CFBF545
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti70 – 701L → M in AAG17167. (PubMed:10935549)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8181Missing in isoform 5. 1 PublicationVSP_054375Add
BLAST
Alternative sequencei63 – 9634GDNNG…TPECL → V in isoform 2. 3 PublicationsVSP_001984Add
BLAST
Alternative sequencei180 – 18910YLSHNRITFL → SRAVKDGSEK in isoform 3. 1 PublicationVSP_029877
Alternative sequencei190 – 757568Missing in isoform 3. 1 PublicationVSP_029878Add
BLAST
Alternative sequencei252 – 27524Missing in isoform 5. 1 PublicationVSP_054376Add
BLAST
Alternative sequencei300 – 34849LDLGS…KLKSL → F in isoform 4. 1 PublicationVSP_029879Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190500 mRNA. Translation: AAG17167.1.
AY899848 mRNA. Translation: AAX85196.1.
AY899849 mRNA. Translation: AAX85197.1.
AY899850 mRNA. Translation: AAX85198.1.
AK295040 mRNA. Translation: BAG58092.1.
AK300379 mRNA. Translation: BAG62114.1.
AC019341 Genomic DNA. No translation available.
AC107056 Genomic DNA. No translation available.
AC107219 Genomic DNA. No translation available.
AC108017 Genomic DNA. No translation available.
AC121161 Genomic DNA. No translation available.
AC125489 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04856.1.
BC112142 mRNA. Translation: AAI12143.1.
BC113617 mRNA. Translation: AAI13618.1.
CCDSiCCDS43276.1. [Q9HBX9-1]
CCDS58929.1. [Q9HBX9-4]
CCDS58930.1. [Q9HBX9-2]
RefSeqiNP_001240657.1. NM_001253728.1. [Q9HBX9-2]
NP_001240658.1. NM_001253729.1. [Q9HBX9-4]
NP_067647.2. NM_021634.3. [Q9HBX9-1]
UniGeneiHs.591686.

Genome annotation databases

EnsembliENST00000307765; ENSP00000303248; ENSG00000171509. [Q9HBX9-1]
ENST00000343542; ENSP00000345889; ENSG00000171509. [Q9HBX9-4]
ENST00000470033; ENSP00000420712; ENSG00000171509. [Q9HBX9-2]
ENST00000471616; ENSP00000434475; ENSG00000171509. [Q9HBX9-3]
GeneIDi59350.
KEGGihsa:59350.
UCSCiuc003ipz.3. human. [Q9HBX9-1]
uc010iqm.3. human. [Q9HBX9-2]
uc010iqo.3. human. [Q9HBX9-4]

Polymorphism databases

DMDMi166209887.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190500 mRNA. Translation: AAG17167.1 .
AY899848 mRNA. Translation: AAX85196.1 .
AY899849 mRNA. Translation: AAX85197.1 .
AY899850 mRNA. Translation: AAX85198.1 .
AK295040 mRNA. Translation: BAG58092.1 .
AK300379 mRNA. Translation: BAG62114.1 .
AC019341 Genomic DNA. No translation available.
AC107056 Genomic DNA. No translation available.
AC107219 Genomic DNA. No translation available.
AC108017 Genomic DNA. No translation available.
AC121161 Genomic DNA. No translation available.
AC125489 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04856.1 .
BC112142 mRNA. Translation: AAI12143.1 .
BC113617 mRNA. Translation: AAI13618.1 .
CCDSi CCDS43276.1. [Q9HBX9-1 ]
CCDS58929.1. [Q9HBX9-4 ]
CCDS58930.1. [Q9HBX9-2 ]
RefSeqi NP_001240657.1. NM_001253728.1. [Q9HBX9-2 ]
NP_001240658.1. NM_001253729.1. [Q9HBX9-4 ]
NP_067647.2. NM_021634.3. [Q9HBX9-1 ]
UniGenei Hs.591686.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2JM4 NMR - A 23-63 [» ]
2M7P NMR - A 28-39 [» ]
ProteinModelPortali Q9HBX9.
SMRi Q9HBX9. Positions 21-63, 73-681.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121891. 1 interaction.
IntActi Q9HBX9. 5 interactions.
MINTi MINT-231156.
STRINGi 9606.ENSP00000303248.

Chemistry

BindingDBi Q9HBX9.
ChEMBLi CHEMBL1293316.
GuidetoPHARMACOLOGYi 351.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei Q9HBX9.

Polymorphism databases

DMDMi 166209887.

Proteomic databases

MaxQBi Q9HBX9.
PaxDbi Q9HBX9.
PRIDEi Q9HBX9.

Protocols and materials databases

DNASUi 59350.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000307765 ; ENSP00000303248 ; ENSG00000171509 . [Q9HBX9-1 ]
ENST00000343542 ; ENSP00000345889 ; ENSG00000171509 . [Q9HBX9-4 ]
ENST00000470033 ; ENSP00000420712 ; ENSG00000171509 . [Q9HBX9-2 ]
ENST00000471616 ; ENSP00000434475 ; ENSG00000171509 . [Q9HBX9-3 ]
GeneIDi 59350.
KEGGi hsa:59350.
UCSCi uc003ipz.3. human. [Q9HBX9-1 ]
uc010iqm.3. human. [Q9HBX9-2 ]
uc010iqo.3. human. [Q9HBX9-4 ]

Organism-specific databases

CTDi 59350.
GeneCardsi GC04P159236.
H-InvDB HIX0024561.
HGNCi HGNC:19718. RXFP1.
HPAi HPA027067.
MIMi 606654. gene.
neXtProti NX_Q9HBX9.
PharmGKBi PA134868312.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4886.
GeneTreei ENSGT00760000119088.
HOVERGENi HBG026354.
InParanoidi Q9HBX9.
KOi K04306.
OMAi TRPFKEM.
PhylomeDBi Q9HBX9.
TreeFami TF326185.

Enzyme and pathway databases

Reactomei REACT_19327. G alpha (s) signalling events.
REACT_21314. Relaxin receptors.

Miscellaneous databases

EvolutionaryTracei Q9HBX9.
GeneWikii Relaxin/insulin-like_family_peptide_receptor_1.
GenomeRNAii 59350.
NextBioi 35471982.
PROi Q9HBX9.
SOURCEi Search...

Gene expression databases

Bgeei Q9HBX9.
CleanExi HS_RXFP1.
ExpressionAtlasi Q9HBX9. baseline and differential.
Genevestigatori Q9HBX9.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
4.10.400.10. 1 hit.
InterProi IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR023415. LDLR_class-A_CS.
IPR002172. LDrepeatLR_classA_rpt.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR000372. LRR-contain_N.
IPR008112. Relaxin_rcpt.
[Graphical view ]
Pfami PF00001. 7tm_1. 1 hit.
PF00057. Ldl_recept_a. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view ]
PRINTSi PR00237. GPCRRHODOPSN.
PR01739. RELAXINR.
SMARTi SM00192. LDLa. 1 hit.
SM00369. LRR_TYP. 2 hits.
SM00013. LRRNT. 1 hit.
[Graphical view ]
SUPFAMi SSF57424. SSF57424. 1 hit.
PROSITEi PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
PS01209. LDLRA_1. 1 hit.
PS50068. LDLRA_2. 1 hit.
PS51450. LRR. 10 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The three subfamilies of leucine-rich repeat-containing G protein-coupled receptors (LGR): identification of LGR6 and LGR7 and the signaling mechanism for LGR7."
    Hsu S.Y., Kudo M., Chen T., Nakabayashi K., Bhalla A., van der Spek P.J., van Duin M., Hsueh A.J.W.
    Mol. Endocrinol. 14:1257-1271(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), MUTAGENESIS OF ASP-637.
  2. "Splice variants of the relaxin and INSL3 receptors reveal unanticipated molecular complexity."
    Muda M., He C., Martini P.G.V., Ferraro T., Layfield S., Taylor D., Chevrier C., Schweickhardt R., Kelton C., Ryan P.L., Bathgate R.A.D.
    Mol. Hum. Reprod. 11:591-600(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
    Tissue: Brain and Placenta.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain cortex.
  7. "Relaxin signalling links tyrosine phosphorylation to phosphodiesterase and adenylyl cyclase activity."
    Bartsch O., Bartlick B., Ivell R.
    Mol. Hum. Reprod. 7:799-809(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  8. "H3 relaxin is a specific ligand for LGR7 and activates the receptor by interacting with both the ectodomain and the exoloop 2."
    Sudo S., Kumagai J., Nishi S., Layfield S., Ferraro T., Bathgate R.A.D., Hsueh A.J.W.
    J. Biol. Chem. 278:7855-7862(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RLN3.
  9. "Identification of the N-linked glycosylation sites of the human relaxin receptor and effect of glycosylation on receptor function."
    Yan Y., Scott D.J., Wilkinson T.N., Ji J., Tregear G.W., Bathgate R.A.
    Biochemistry 47:6953-6968(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT ASN-36; ASN-127; ASN-264; ASN-272; ASN-325 AND ASN-368.
  10. "The NMR solution structure of the relaxin (RXFP1) receptor lipoprotein receptor class A module and identification of key residues in the N-terminal region of the module that mediate receptor activation."
    Hopkins E.J., Layfield S., Ferraro T., Bathgate R.A.D., Gooley P.R.
    J. Biol. Chem. 282:4172-4184(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 23-63 IN COMPLEX WITH CALCIUM IONS.

Entry informationi

Entry nameiRXFP1_HUMAN
AccessioniPrimary (citable) accession number: Q9HBX9
Secondary accession number(s): B4DHD1
, B4DTV2, Q2M215, Q3KU24, Q3KU25, Q3KU26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: December 4, 2007
Last modified: November 26, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3