Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tensin-1

Gene

TNS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.1 Publication

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000079308-MONOMER.
SignaLinkiQ9HBL0.

Names & Taxonomyi

Protein namesi
Recommended name:
Tensin-1
Gene namesi
Name:TNS1
Synonyms:TNS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:11973. TNS1.

Subcellular locationi

GO - Cellular componenti

  • cell surface Source: UniProtKB-SubCell
  • cytoplasm Source: UniProtKB-KW
  • cytoskeleton Source: UniProtKB-SubCell
  • focal adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi7145.
OpenTargetsiENSG00000079308.
PharmGKBiPA36660.

Polymorphism and mutation databases

BioMutaiTNS1.
DMDMi212276466.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002159001 – 1735Tensin-1Add BLAST1735

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei338PhosphoserineCombined sources1
Modified residuei364PhosphoserineCombined sources1
Modified residuei366PhosphotyrosineCombined sources1
Modified residuei378PhosphoserineCombined sources1
Modified residuei379PhosphothreonineCombined sources1
Modified residuei433PhosphoserineCombined sources1
Modified residuei621PhosphoserineCombined sources1
Modified residuei701PhosphoserineCombined sources1
Modified residuei764PhosphoserineCombined sources1
Modified residuei769PhosphoserineCombined sources1
Modified residuei794PhosphoserineCombined sources1
Modified residuei860PhosphothreonineCombined sources1
Modified residuei899PhosphoserineCombined sources1
Modified residuei903PhosphotyrosineCombined sources1
Modified residuei907PhosphoserineCombined sources1
Modified residuei963PhosphoserineCombined sources1
Modified residuei967PhosphoserineCombined sources1
Modified residuei1124PhosphoserineCombined sources1
Modified residuei1177PhosphoserineCombined sources1 Publication1
Modified residuei1189PhosphothreonineCombined sources1
Modified residuei1192PhosphoserineCombined sources1
Modified residuei1266PhosphothreonineCombined sources1
Modified residuei1269PhosphoserineCombined sources1
Modified residuei1294PhosphoserineCombined sources1
Modified residuei1309PhosphoserineCombined sources1
Modified residuei1314PhosphoserineCombined sources1
Modified residuei1381PhosphoserineCombined sources1
Modified residuei1393PhosphoserineCombined sources1
Modified residuei1400PhosphoserineCombined sources1
Modified residuei1446PhosphoserineCombined sources1
Modified residuei1588PhosphoserineCombined sources1

Post-translational modificationi

Rapidly cleaved by calpain II.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9HBL0.
MaxQBiQ9HBL0.
PaxDbiQ9HBL0.
PeptideAtlasiQ9HBL0.
PRIDEiQ9HBL0.

PTM databases

DEPODiQ9HBL0.
iPTMnetiQ9HBL0.
PhosphoSitePlusiQ9HBL0.

Miscellaneous databases

PMAP-CutDBQ9HBL0.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000079308.
CleanExiHS_TNS1.
ExpressionAtlasiQ9HBL0. baseline and differential.
GenevisibleiQ9HBL0. HS.

Organism-specific databases

HPAiCAB018774.
HPA036089.
HPA036090.

Interactioni

Subunit structurei

Binds to actin filaments and interacts with phosphotyrosine-containing proteins. Interacts with STARD8.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ARP102753EBI-3389814,EBI-608057
KITP107212EBI-3389814,EBI-1379503
METP085812EBI-3389814,EBI-1039152

Protein-protein interaction databases

BioGridi112999. 7 interactors.
DIPiDIP-60948N.
IntActiQ9HBL0. 10 interactors.
STRINGi9606.ENSP00000171887.

Structurei

3D structure databases

ProteinModelPortaliQ9HBL0.
SMRiQ9HBL0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 176Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST173
Domaini181 – 307C2 tensin-typePROSITE-ProRule annotationAdd BLAST127
Domaini1463 – 1572SH2PROSITE-ProRule annotationAdd BLAST110

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi651 – 667Gln-richAdd BLAST17
Compositional biasi1069 – 1160Ser-richAdd BLAST92

Sequence similaritiesi

Contains 1 C2 tensin-type domain.PROSITE-ProRule annotation
Contains 1 phosphatase tensin-type domain.PROSITE-ProRule annotation
Contains 1 SH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiKOG1930. Eukaryota.
KOG2283. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000119113.
HOGENOMiHOG000006936.
HOVERGENiHBG060186.
InParanoidiQ9HBL0.
KOiK18080.
OMAiMDHLENG.
OrthoDBiEOG091G0G8Y.
PhylomeDBiQ9HBL0.
TreeFamiTF315996.

Family and domain databases

CDDicd01213. PTB_tensin. 1 hit.
Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR011993. PH_dom-like.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
IPR033929. Tensin_PTB.
IPR003595. Tyr_Pase_cat.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM01326. PTEN_C2. 1 hit.
SM00404. PTPc_motif. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HBL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVSRTMEDS CELDLVYVTE RIIAVSFPST ANEENFRSNL REVAQMLKSK
60 70 80 90 100
HGGNYLLFNL SERRPDITKL HAKVLEFGWP DLHTPALEKI CSICKAMDTW
110 120 130 140 150
LNADPHNVVV LHNKGNRGRI GVVIAAYMHY SNISASADQA LDRFAMKRFY
160 170 180 190 200
EDKIVPIGQP SQRRYVHYFS GLLSGSIKMN NKPLFLHHVI MHGIPNFESK
210 220 230 240 250
GGCRPFLRIY QAMQPVYTSG IYNIPGDSQT SVCITIEPGL LLKGDILLKC
260 270 280 290 300
YHKKFRSPAR DVIFRVQFHT CAIHDLGVVF GKEDLDDAFK DDRFPEYGKV
310 320 330 340 350
EFVFSYGPEK IQGMEHLENG PSVSVDYNTS DPLIRWDSYD NFSGHRDDGM
360 370 380 390 400
EEVVGHTQGP LDGSLYAKVK KKDSLHGSTG AVNATRPTLS ATPNHVEHTL
410 420 430 440 450
SVSSDSGNST ASTKTDKTDE PVPGASSATA ALSPQEKREL DRLLSGFGLE
460 470 480 490 500
REKQGAMYHT QHLRSRPAGG SAVPSSGRHV VPAQVHVNGG ALASERETDI
510 520 530 540 550
LDDELPNQDG HSAGSMGTLS SLDGVTNTSE GGYPEALSPL TNGLDKSYPM
560 570 580 590 600
EPMVNGGGYP YESASRAGPA HAGHTAPMRP SYSAQEGLAG YQREGPHPAW
610 620 630 640 650
PQPVTTSHYA HDPSGMFRSQ SFSEAEPQLP PAPVRGGSSR EAVQRGLNSW
660 670 680 690 700
QQQQQQQQQP RPPPRQQERA HLESLVASRP SPQPLAETPI PSLPEFPRAA
710 720 730 740 750
SQQEIEQSIE TLNMLMLDLE PASAAAPLHK SQSVPGAWPG ASPLSSQPLS
760 770 780 790 800
GSSRQSHPLT QSRSGYIPSG HSLGTPEPAP RASLESVPPG RSYSPYDYQP
810 820 830 840 850
CLAGPNQDFH SKSPASSSLP AFLPTTHSPP GPQQPPASLP GLTAQPLLSP
860 870 880 890 900
KEATSDPSRT PEEEPLNLEG LVAHRVAGVQ AREKQPAEPP APLRRRAASD
910 920 930 940 950
GQYENQSPEA TSPRSPGVRS PVQCVSPELA LTIALNPGGR PKEPHLHSYK
960 970 980 990 1000
EAFEEMEGTS PSSPPPSGVR SPPGLAKTPL SALGLKPHNP ADILLHPTGV
1010 1020 1030 1040 1050
TRRRIQPEED EGKVVVRLSE EPRSYVESVA RTAVAGPRAQ DSEPKSFSAP
1060 1070 1080 1090 1100
ATQAYGHEIP LRNGTLGGSF VSPSPLSTSS PILSADSTSV GSFPSGESSD
1110 1120 1130 1140 1150
QGPRTPTQPL LESGFRSGSL GQPSPSAQRN YQSSSPLPTV GSSYSSPDYS
1160 1170 1180 1190 1200
LQHFSSSPES QARAQFSVAG VHTVPGSPQA RHRTVGTNTP PSPGFGWRAI
1210 1220 1230 1240 1250
NPSMAAPSSP SLSHHQMMGP PGTGFHGSTV SSPQSSAATT PGSPSLCRHP
1260 1270 1280 1290 1300
AGVYQVSGLH NKVATTPGSP SLGRHPGAHQ GNLASGLHSN AIASPGSPSL
1310 1320 1330 1340 1350
GRHLGGSGSV VPGSPCLDRH VAYGGYSTPE DRRPTLSRQS SASGYQAPST
1360 1370 1380 1390 1400
PSFPVSPAYY PGLSSPATSP SPDSAAFRQG SPTPALPEKR RMSVGDRAGS
1410 1420 1430 1440 1450
LPNYATINGK VSSPVASGMS SPSGGSTVSF SHTLPDFSKY SMPDNSPETR
1460 1470 1480 1490 1500
AKVKFVQDTS KYWYKPEISR EQAIALLKDQ EPGAFIIRDS HSFRGAYGLA
1510 1520 1530 1540 1550
MKVSSPPPTI MQQNKKGDMT HELVRHFLIE TGPRGVKLKG CPNEPNFGSL
1560 1570 1580 1590 1600
SALVYQHSII PLALPCKLVI PNRDPTDESK DSSGPANSTA DLLKQGAACN
1610 1620 1630 1640 1650
VLFVNSVDME SLTGPQAISK ATSETLAADP TPAATIVHFK VSAQGITLTD
1660 1670 1680 1690 1700
NQRKLFFRRH YPLNTVTFCD LDPQERKWMK TEGGAPAKLF GFVARKQGST
1710 1720 1730
TDNACHLFAE LDPNQPASAI VNFVSKVMLN AGQKR
Length:1,735
Mass (Da):185,701
Last modified:November 4, 2008 - v2
Checksum:i90C173D5E371EF3E
GO
Isoform 2 (identifier: Q9HBL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVPFQQRKDCVLEGSTRVTPSVQPHLQPIRNM
     352-385: EVVGHTQGPLDGSLYAKVKKKDSLHGSTGAVNAT → DGNKQNTNSQSIGSISGGLEDQYTWPDTHWPSQS
     386-1735: Missing.

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):47,240
Checksum:i372FC64F2304C63E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti179M → I in AAG33700 (PubMed:11023826).Curated1
Sequence conflicti1412S → A in AAG33700 (PubMed:11023826).Curated1
Sequence conflicti1416A → P in AAG33700 (PubMed:11023826).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_047066311I → M.Corresponds to variant rs11680854dbSNPEnsembl.1
Natural variantiVAR_047067466R → C.Corresponds to variant rs3815849dbSNPEnsembl.1
Natural variantiVAR_047068528T → I.Corresponds to variant rs3796033dbSNPEnsembl.1
Natural variantiVAR_0470691004R → W.Corresponds to variant rs3796028dbSNPEnsembl.1
Natural variantiVAR_0480041093F → L in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0470701197W → R.Combined sources1 PublicationCorresponds to variant rs2571445dbSNPEnsembl.1
Natural variantiVAR_0470711604V → I.1 PublicationCorresponds to variant rs918949dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0563351M → MVPFQQRKDCVLEGSTRVTP SVQPHLQPIRNM in isoform 2. 1 Publication1
Alternative sequenceiVSP_056336352 – 385EVVGH…AVNAT → DGNKQNTNSQSIGSISGGLE DQYTWPDTHWPSQS in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_056337386 – 1735Missing in isoform 2. 1 PublicationAdd BLAST1350

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF225896 mRNA. Translation: AAG33700.1.
AC009469 Genomic DNA. Translation: AAX88952.1.
AC010136 Genomic DNA. No translation available.
BC071905 mRNA. Translation: AAH71905.1.
CCDSiCCDS2407.1. [Q9HBL0-1]
RefSeqiNP_001294951.1. NM_001308022.1.
NP_072174.3. NM_022648.5. [Q9HBL0-1]
UniGeneiHs.471381.

Genome annotation databases

EnsembliENST00000171887; ENSP00000171887; ENSG00000079308. [Q9HBL0-1]
ENST00000310858; ENSP00000308321; ENSG00000079308. [Q9HBL0-2]
GeneIDi7145.
KEGGihsa:7145.
UCSCiuc002vgt.3. human. [Q9HBL0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF225896 mRNA. Translation: AAG33700.1.
AC009469 Genomic DNA. Translation: AAX88952.1.
AC010136 Genomic DNA. No translation available.
BC071905 mRNA. Translation: AAH71905.1.
CCDSiCCDS2407.1. [Q9HBL0-1]
RefSeqiNP_001294951.1. NM_001308022.1.
NP_072174.3. NM_022648.5. [Q9HBL0-1]
UniGeneiHs.471381.

3D structure databases

ProteinModelPortaliQ9HBL0.
SMRiQ9HBL0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112999. 7 interactors.
DIPiDIP-60948N.
IntActiQ9HBL0. 10 interactors.
STRINGi9606.ENSP00000171887.

PTM databases

DEPODiQ9HBL0.
iPTMnetiQ9HBL0.
PhosphoSitePlusiQ9HBL0.

Polymorphism and mutation databases

BioMutaiTNS1.
DMDMi212276466.

Proteomic databases

EPDiQ9HBL0.
MaxQBiQ9HBL0.
PaxDbiQ9HBL0.
PeptideAtlasiQ9HBL0.
PRIDEiQ9HBL0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000171887; ENSP00000171887; ENSG00000079308. [Q9HBL0-1]
ENST00000310858; ENSP00000308321; ENSG00000079308. [Q9HBL0-2]
GeneIDi7145.
KEGGihsa:7145.
UCSCiuc002vgt.3. human. [Q9HBL0-1]

Organism-specific databases

CTDi7145.
DisGeNETi7145.
GeneCardsiTNS1.
H-InvDBHIX0002818.
HGNCiHGNC:11973. TNS1.
HPAiCAB018774.
HPA036089.
HPA036090.
MIMi600076. gene.
neXtProtiNX_Q9HBL0.
OpenTargetsiENSG00000079308.
PharmGKBiPA36660.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1930. Eukaryota.
KOG2283. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000119113.
HOGENOMiHOG000006936.
HOVERGENiHBG060186.
InParanoidiQ9HBL0.
KOiK18080.
OMAiMDHLENG.
OrthoDBiEOG091G0G8Y.
PhylomeDBiQ9HBL0.
TreeFamiTF315996.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000079308-MONOMER.
SignaLinkiQ9HBL0.

Miscellaneous databases

ChiTaRSiTNS1. human.
GeneWikiiTNS1.
GenomeRNAii7145.
PMAP-CutDBQ9HBL0.
PROiQ9HBL0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000079308.
CleanExiHS_TNS1.
ExpressionAtlasiQ9HBL0. baseline and differential.
GenevisibleiQ9HBL0. HS.

Family and domain databases

CDDicd01213. PTB_tensin. 1 hit.
Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR011993. PH_dom-like.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
IPR033929. Tensin_PTB.
IPR003595. Tyr_Pase_cat.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM01326. PTEN_C2. 1 hit.
SM00404. PTPc_motif. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTENS1_HUMAN
AccessioniPrimary (citable) accession number: Q9HBL0
Secondary accession number(s): Q4ZG71, Q6IPI5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: November 4, 2008
Last modified: November 30, 2016
This is version 142 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.