Q9HBI1 (PARVB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Beta-parvin Alternative name(s): Affixin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 364 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein that plays a role in integrin signaling via ILK and in activation of the GTPases CDC42 and RAC1 by guanine exchange factors, such as ARHGEF6. Is involved in the reorganization of the actin cytoskeleton and formation of lamellipodia. Plays a role in cell adhesion, cell spreading, establishment or maintenance of cell polarity, and cell migration. Ref.2 Ref.11 Ref.12 Ref.13 Ref.15 |
| Subunit structure | Interacts with DYSF. Interacts with ILK, ARHGEF6, PXN (via LD motifs), ACTN2 and actin. Ref.2 Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 Ref.18 |
| Subcellular location | Cell junction › focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm › cytoskeleton. Cell projection › lamellipodium. Cytoplasm › myofibril › sarcomere. Cytoplasm › myofibril › sarcomere › Z line. Note: Constituent of focal adhesions. Detected at the tips of the leading edge of cells. Colocalizes with F-actin at the tips of lamellipodia. Ref.2 Ref.13 Ref.15 Ref.18 |
| Tissue specificity | Expressed predominantly in heart and skeletal muscle. Ref.2 Ref.10 |
| Sequence similarities | Belongs to the parvin family. Contains 2 CH (calponin-homology) domains. |
| Sequence caution | The sequence AAD34051.1 differs from that shown. Reason: Frameshift at positions 4, 14, 48, 58, 155, 162, 171, 327, 331 and 344. The sequence BG743702 differs from that shown. Reason: Frameshift at positions 136, 232 and 237. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HBI1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HBI1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MSSAPRSPTP...TLARKRRARE → MHHVFKDHQR...VETSEYAQGG | ||||||
| Note: Ref.1 (AAL08219) sequence is in conflict in positions: 21:N->K and 37:W->R. | ||||||
| Isoform 3 (identifier: Q9HBI1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREV → M | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 364 | 364 | Beta-parvin | PRO_0000121583 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 87 – 194 | 108 | CH 1 | |||||||||||||||||||||||||
| Domain | 254 – 361 | 108 | CH 2 | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 54 | 1 | Phosphoserine Ref.16 | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 1 – 38 | 38 | MSSAP…RAREV → M in isoform 3. | VSP_045555 | ||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MSSAP…RRARE → MHHVFKDHQRGEKRGFLSPE NKNCRRLELRRGCSCSWGLC SQALMASLAGSLLPGSDRSG VETSEYAQGG in isoform 2. | VSP_041336 | ||||||||||||||||||||||||
| Natural variant | 52 | 1 | P → R. Corresponds to variant rs34476853 [ dbSNP | Ensembl ]. | VAR_034369 | ||||||||||||||||||||||||
| Natural variant | 58 | 1 | V → A. Ref.1 Ref.5 Ref.8 Ref.16 Corresponds to variant rs1983609 [ dbSNP | Ensembl ]. | VAR_017242 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Mutagenesis | 256 | 1 | V → Q: Abolishes interaction with PXN. Ref.18 | |||||||||||||||||||||||||
| Mutagenesis | 299 | 1 | F → D: Abolishes interaction with ILK. Abolishes location at focal adhesion sites. Ref.18 | |||||||||||||||||||||||||
| Sequence conflict | 27 | 1 | G → V in AAD34051. Ref.4 | |||||||||||||||||||||||||
| Sequence conflict | 59 | 1 | D → M in AAD34051. Ref.4 | |||||||||||||||||||||||||
| Sequence conflict | 349 | 1 | T → P in AAD34051. Ref.4 | |||||||||||||||||||||||||
| Isoform 2: | ||||||||||||||||||||||||||||
| Sequence conflict | 4 | 1 | V → G in BG743702. Ref.8 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Helix | 243 – 246 | 4 | ||||||||||||||||||||||||||
| Helix | 250 – 252 | 3 | ||||||||||||||||||||||||||
| Helix | 254 – 268 | 15 | ||||||||||||||||||||||||||
| Helix | 269 – 271 | 3 | ||||||||||||||||||||||||||
| Turn | 278 – 284 | 7 | ||||||||||||||||||||||||||
| Helix | 286 – 295 | 10 | ||||||||||||||||||||||||||
| Helix | 302 – 304 | 3 | ||||||||||||||||||||||||||
| Helix | 312 – 328 | 17 | ||||||||||||||||||||||||||
| Helix | 338 – 342 | 5 | ||||||||||||||||||||||||||
| Helix | 346 – 360 | 15 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "CLINT, Calponin homology domain protein binding to integrin-linked kinase, ILK1." Carnio L., Hannigan G.E. Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ALA-58. Tissue: Skeletal muscle. |
| [2] | "A novel integrin-linked kinase-binding protein, affixin, is involved in the early stage of cell-substrate interaction." Yamaji S., Suzuki A., Sugiyama Y., Koide Y., Yoshida M., Kanamori H., Mohri H., Ohno S., Ishigatsubo Y. J. Cell Biol. 153:1251-1264(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH ILK, SUBCELLULAR LOCATION, PHOSPHORYLATION, TISSUE SPECIFICITY. |
| [3] | "Parvin, a 42 kDa focal adhesion protein, related to the alpha-actinin superfamily." Olski T.M., Noegel A.A., Korenbaum E. J. Cell Sci. 114:525-538(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-58. Tissue: Colon. |
| [6] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-238 (ISOFORM 2), VARIANT ALA-58. Tissue: Brain, Leukocyte and Skin. |
| [9] | "Reevaluating human gene annotation: a second-generation analysis of chromosome 22." Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I. Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 15-364 (ISOFORM 1). |
| [10] | "Genomic organization and expression profile of the parvin family of focal adhesion proteins in mice and humans." Korenbaum E., Olski T.M., Noegel A.A. Gene 279:69-79(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [11] | "The first CH domain of affixin activates Cdc42 and Rac1 through alphaPIX, a Cdc42/Rac1-specific guanine nucleotide exchanging factor." Mishima W., Suzuki A., Yamaji S., Yoshimi R., Ueda A., Kaneko T., Tanaka J., Miwa Y., Ohno S., Ishigatsubo Y. Genes Cells 9:193-204(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ARHGEF6. |
| [12] | "Distinct roles of two structurally closely related focal adhesion proteins, alpha-parvins and beta-parvins, in regulation of cell morphology and survival." Zhang Y., Chen K., Tu Y., Wu C. J. Biol. Chem. 279:41695-41705(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ILK. |
| [13] | "Affixin interacts with alpha-actinin and mediates integrin signaling for reorganization of F-actin induced by initial cell-substrate interaction." Yamaji S., Suzuki A., Kanamori H., Mishima W., Yoshimi R., Takasaki H., Takabayashi M., Fujimaki K., Fujisawa S., Ohno S., Ishigatsubo Y. J. Cell Biol. 165:539-551(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ACTN2, SUBCELLULAR LOCATION, FUNCTION. |
| [14] | "Dysferlin interacts with affixin (beta-parvin) at the sarcolemma." Matsuda C., Kameyama K., Tagawa K., Ogawa M., Suzuki A., Yamaji S., Okamoto H., Nishino I., Hayashi Y.K. J. Neuropathol. Exp. Neurol. 64:334-340(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DYSF. |
| [15] | "Affixin activates Rac1 via betaPIX in C2C12 myoblast." Matsuda C., Kameyama K., Suzuki A., Mishima W., Yamaji S., Okamoto H., Nishino I., Hayashi Y.K. FEBS Lett. 582:1189-1196(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH ARHGEF6 AND ARHGEF7. |
| [16] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-54, VARIANT [LARGE SCALE ANALYSIS] ALA-58, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [18] | "Structural basis for paxillin binding and focal adhesion targeting of beta-parvin." Stiegler A.L., Draheim K.M., Li X., Chayen N.E., Calderwood D.A., Boggon T.J. J. Biol. Chem. 287:32566-32577(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 235-364 IN COMPLEX WITH PXN, SUBCELLULAR LOCATION, MUTAGENESIS OF VAL-256 AND PHE-299, INTERACTION WITH ILK AND PXN. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF303887 mRNA. Translation: AAL08219.1. AB048276 mRNA. Translation: BAB62077.1. AF237769 mRNA. Translation: AAG27171.1. AF151814 mRNA. Translation: AAD34051.1. Frameshift. AK313957 mRNA. Translation: BAG36673.1. AL031595, AL033543, Z82178 Genomic DNA. Translation: CAI22312.1. AL033543, AL031595, Z82178 Genomic DNA. Translation: CAI17969.1. Z82178, AL031595, AL033543 Genomic DNA. Translation: CAI18767.1. AL033543, AL031595, Z82174 Genomic DNA. Translation: CAQ06491.1. AL033543, AL031595, AL035398 Genomic DNA. Translation: CAQ06493.1. AL031595, AL033543, Z82174 Genomic DNA. Translation: CAQ08141.1. AL031595, AL033543, AL035398 Genomic DNA. Translation: CAQ08144.1. Z82174, AL031595, AL033543 Genomic DNA. Translation: CAQ08662.1. AL035398, AL031595, AL033543 Genomic DNA. Translation: CAQ09485.1. CH471138 Genomic DNA. Translation: EAW73328.1. BC039811 mRNA. No translation available. BC046103 mRNA. Translation: AAH46103.2. BG743702 mRNA. No translation available. AL159142 mRNA. Translation: CAB76900.1. | ||||||||||||||||||||||||
| IPI | IPI00043083. IPI00382605. IPI00879834. | ||||||||||||||||||||||||
| RefSeq | NP_001003828.1. NM_001003828.2. NP_001230314.1. NM_001243385.1. NP_001230315.1. NM_001243386.1. NP_037459.2. NM_013327.4. | ||||||||||||||||||||||||
| UniGene | Hs.475074. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q9HBI1. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q9HBI1. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-6178745. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q9HBI1. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 20139178. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q9HBI1. | ||||||||||||||||||||||||
| PRIDE | Q9HBI1. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000338758; ENSP00000342492; ENSG00000188677. ENST00000404989; ENSP00000384353; ENSG00000188677. ENST00000406477; ENSP00000384515; ENSG00000188677. | ||||||||||||||||||||||||
| GeneID | 29780. | ||||||||||||||||||||||||
| KEGG | hsa:29780. | ||||||||||||||||||||||||
| UCSC | uc003bem.3. human. uc003ben.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 29780. | ||||||||||||||||||||||||
| GeneCards | GC22P044395. | ||||||||||||||||||||||||
| HGNC | HGNC:14653. PARVB. | ||||||||||||||||||||||||
| MIM | 608121. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q9HBI1. | ||||||||||||||||||||||||
| PharmGKB | PA32951. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG303418. | ||||||||||||||||||||||||
| HOVERGEN | HBG053517. | ||||||||||||||||||||||||
| KO | K06275. | ||||||||||||||||||||||||
| OMA | NLFTNYK. | ||||||||||||||||||||||||
| OrthoDB | EOG4VX25H. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_111155. Cell-Cell communication. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q9HBI1. | ||||||||||||||||||||||||
| Bgee | Q9HBI1. | ||||||||||||||||||||||||
| CleanEx | HS_PARVB. | ||||||||||||||||||||||||
| Genevestigator | Q9HBI1. | ||||||||||||||||||||||||
| GermOnline | ENSG00000188677. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.418.10. 2 hits. | ||||||||||||||||||||||||
| InterPro | IPR001715. CH-domain. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00307. CH. 2 hits. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00033. CH. 2 hits. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF47576. Calponin-homology. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50021. CH. 2 hits. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| GenomeRNAi | 29780. | ||||||||||||||||||||||||
| NextBio | 52306. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | PARVB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HBI1 Secondary accession number(s): B0QYM8 Q9Y3L7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
