Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-parvin

Gene

PARVB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Adapter protein that plays a role in integrin signaling via ILK and in activation of the GTPases CDC42 and RAC1 by guanine exchange factors, such as ARHGEF6. Is involved in the reorganization of the actin cytoskeleton and formation of lamellipodia. Plays a role in cell adhesion, cell spreading, establishment or maintenance of cell polarity, and cell migration.5 Publications

GO - Biological processi

  • actin cytoskeleton reorganization Source: UniProtKB
  • cell adhesion Source: UniProtKB-KW
  • cell projection assembly Source: UniProtKB
  • establishment or maintenance of cell polarity regulating cell shape Source: UniProtKB
  • lamellipodium assembly Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:G66-31587-MONOMER.
ReactomeiR-HSA-446353. Cell-extracellular matrix interactions.
R-HSA-446388. Regulation of cytoskeletal remodeling and cell spreading by IPP complex components.

Names & Taxonomyi

Protein namesi
Recommended name:
Beta-parvin
Alternative name(s):
Affixin
Gene namesi
Name:PARVB
ORF Names:CGI-56
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:14653. PARVB.

Subcellular locationi

GO - Cellular componenti

  • cytoskeleton Source: UniProtKB-SubCell
  • cytosol Source: Reactome
  • focal adhesion Source: UniProtKB
  • lamellipodium Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
  • Z disc Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi256V → Q: Abolishes interaction with PXN. 1 Publication1
Mutagenesisi299F → D: Abolishes interaction with ILK. Abolishes location at focal adhesion sites. 1 Publication1

Organism-specific databases

DisGeNETi29780.
OpenTargetsiENSG00000188677.
PharmGKBiPA32951.

Polymorphism and mutation databases

BioMutaiPARVB.
DMDMi20139178.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001215831 – 364Beta-parvinAdd BLAST364

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei7PhosphoserineCombined sources1
Modified residuei54PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9HBI1.
MaxQBiQ9HBI1.
PaxDbiQ9HBI1.
PeptideAtlasiQ9HBI1.
PRIDEiQ9HBI1.

PTM databases

iPTMnetiQ9HBI1.
PhosphoSitePlusiQ9HBI1.

Expressioni

Tissue specificityi

Expressed predominantly in heart and skeletal muscle.2 Publications

Gene expression databases

BgeeiENSG00000188677.
CleanExiHS_PARVB.
ExpressionAtlasiQ9HBI1. baseline and differential.
GenevisibleiQ9HBI1. HS.

Interactioni

Subunit structurei

Interacts with DYSF. Interacts with ILK, ARHGEF6, PXN (via LD motifs), ACTN2 and actin.7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Arhgef6Q8K4I33EBI-1047679,EBI-6272809From a different organism.
Arhgef7Q9ES2810EBI-1047679,EBI-642580From a different organism.

Protein-protein interaction databases

BioGridi118912. 9 interactors.
IntActiQ9HBI1. 8 interactors.
MINTiMINT-6178745.
STRINGi9606.ENSP00000384515.

Structurei

Secondary structure

1364
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi243 – 246Combined sources4
Helixi250 – 252Combined sources3
Helixi254 – 268Combined sources15
Helixi269 – 271Combined sources3
Turni278 – 284Combined sources7
Helixi286 – 295Combined sources10
Helixi302 – 304Combined sources3
Helixi312 – 328Combined sources17
Helixi338 – 342Combined sources5
Helixi346 – 360Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4EDLX-ray2.10A/B/C/D/E/F235-364[»]
4EDMX-ray2.00A/B235-364[»]
4EDNX-ray2.90A/B/C/D/E/F/G/H/I/J235-364[»]
ProteinModelPortaliQ9HBI1.
SMRiQ9HBI1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini87 – 194CH 1PROSITE-ProRule annotationAdd BLAST108
Domaini254 – 361CH 2PROSITE-ProRule annotationAdd BLAST108

Sequence similaritiesi

Belongs to the parvin family.Curated
Contains 2 CH (calponin-homology) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3631. Eukaryota.
ENOG410XQWH. LUCA.
GeneTreeiENSGT00390000009673.
HOGENOMiHOG000247027.
HOVERGENiHBG053517.
InParanoidiQ9HBI1.
KOiK06275.
OMAiQWTVDSI.
OrthoDBiEOG091G0ULB.
PhylomeDBiQ9HBI1.
TreeFamiTF314025.

Family and domain databases

Gene3Di1.10.418.10. 2 hits.
InterProiIPR001715. CH-domain.
IPR028433. Parvin.
[Graphical view]
PANTHERiPTHR12114. PTHR12114. 1 hit.
PfamiPF00307. CH. 2 hits.
[Graphical view]
PIRSFiPIRSF039131. Parvin. 1 hit.
SMARTiSM00033. CH. 2 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 2 hits.
PROSITEiPS50021. CH. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HBI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSAPRSPTP RPRRMKKDES FLGKLGGTLA RKRRAREVSD LQEEGKNAIN
60 70 80 90 100
SPMSPALVDV HPEDTQLEEN EERTMIDPTS KEDPKFKELV KVLLDWINDV
110 120 130 140 150
LVEERIIVKQ LEEDLYDGQV LQKLLEKLAG CKLNVAEVTQ SEIGQKQKLQ
160 170 180 190 200
TVLEAVHDLL RPRGWALRWS VDSIHGKNLV AILHLLVSLA MHFRAPIRLP
210 220 230 240 250
EHVTVQVVVV RKREGLLHSS HISEELTTTT EMMMGRFERD AFDTLFDHAP
260 270 280 290 300
DKLSVVKKSL ITFVNKHLNK LNLEVTELET QFADGVYLVL LMGLLEDYFV
310 320 330 340 350
PLHHFYLTPE SFDQKVHNVS FAFELMLDGG LKKPKARPED VVNLDLKSTL
360
RVLYNLFTKY KNVE
Length:364
Mass (Da):41,714
Last modified:March 1, 2001 - v1
Checksum:i4BA4B50C83083DC7
GO
Isoform 2 (identifier: Q9HBI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MSSAPRSPTP...TLARKRRARE → MHHVFKDHQR...VETSEYAQGG

Show »
Length:397
Mass (Da):45,183
Checksum:iBA4335437824E465
GO
Isoform 3 (identifier: Q9HBI1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREV → M

Note: No experimental confirmation available.
Show »
Length:327
Mass (Da):37,538
Checksum:iBD4A2F8D5ECD7768
GO

Sequence cautioni

The sequence AAD34051 differs from that shown. Reason: Frameshift at positions 4, 14, 48, 58, 155, 162, 171, 327, 331 and 344.Curated
The sequence BG743702 differs from that shown. Reason: Frameshift at positions 136, 232 and 237.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27G → V in AAD34051 (PubMed:10810093).Curated1
Sequence conflicti59D → M in AAD34051 (PubMed:10810093).Curated1
Sequence conflicti349T → P in AAD34051 (PubMed:10810093).Curated1
Isoform 2 (identifier: Q9HBI1-2)
Sequence conflicti4V → G in BG743702 (PubMed:15489334).Curated1
Sequence conflicti21N → K in AAL08219 (Ref. 1) Curated1
Sequence conflicti37W → R in AAL08219 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03436952P → R.Corresponds to variant rs34476853dbSNPEnsembl.1
Natural variantiVAR_01724258V → A.Combined sources3 PublicationsCorresponds to variant rs1983609dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0455551 – 38MSSAP…RAREV → M in isoform 3. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_0413361 – 37MSSAP…RRARE → MHHVFKDHQRGEKRGFLSPE NKNCRRLELRRGCSCSWGLC SQALMASLAGSLLPGSDRSG VETSEYAQGG in isoform 2. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF303887 mRNA. Translation: AAL08219.1.
AB048276 mRNA. Translation: BAB62077.1.
AF237769 mRNA. Translation: AAG27171.1.
AF151814 mRNA. Translation: AAD34051.1. Frameshift.
AK313957 mRNA. Translation: BAG36673.1.
AL031595, AL033543, Z82178 Genomic DNA. Translation: CAI22312.1.
AL033543, AL031595, Z82178 Genomic DNA. Translation: CAI17969.1.
Z82178, AL031595, AL033543 Genomic DNA. Translation: CAI18767.1.
AL033543, AL031595, Z82174 Genomic DNA. Translation: CAQ06491.1.
AL033543, AL031595, AL035398 Genomic DNA. Translation: CAQ06493.1.
AL031595, AL033543, Z82174 Genomic DNA. Translation: CAQ08141.1.
AL031595, AL033543, AL035398 Genomic DNA. Translation: CAQ08144.1.
Z82174, AL031595, AL033543 Genomic DNA. Translation: CAQ08662.1.
AL035398, AL031595, AL033543 Genomic DNA. Translation: CAQ09485.1.
CH471138 Genomic DNA. Translation: EAW73328.1.
BC039811 mRNA. No translation available.
BC046103 mRNA. Translation: AAH46103.2.
BG743702 mRNA. No translation available.
AL159142 mRNA. Translation: CAB76900.1.
CCDSiCCDS14056.1. [Q9HBI1-1]
CCDS46724.1. [Q9HBI1-2]
CCDS58808.1. [Q9HBI1-3]
RefSeqiNP_001003828.1. NM_001003828.2. [Q9HBI1-2]
NP_001230314.1. NM_001243385.1. [Q9HBI1-3]
NP_001230315.1. NM_001243386.1.
NP_037459.2. NM_013327.4. [Q9HBI1-1]
UniGeneiHs.475074.

Genome annotation databases

EnsembliENST00000338758; ENSP00000342492; ENSG00000188677. [Q9HBI1-1]
ENST00000404989; ENSP00000384353; ENSG00000188677. [Q9HBI1-3]
ENST00000406477; ENSP00000384515; ENSG00000188677. [Q9HBI1-2]
GeneIDi29780.
KEGGihsa:29780.
UCSCiuc003bem.4. human. [Q9HBI1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF303887 mRNA. Translation: AAL08219.1.
AB048276 mRNA. Translation: BAB62077.1.
AF237769 mRNA. Translation: AAG27171.1.
AF151814 mRNA. Translation: AAD34051.1. Frameshift.
AK313957 mRNA. Translation: BAG36673.1.
AL031595, AL033543, Z82178 Genomic DNA. Translation: CAI22312.1.
AL033543, AL031595, Z82178 Genomic DNA. Translation: CAI17969.1.
Z82178, AL031595, AL033543 Genomic DNA. Translation: CAI18767.1.
AL033543, AL031595, Z82174 Genomic DNA. Translation: CAQ06491.1.
AL033543, AL031595, AL035398 Genomic DNA. Translation: CAQ06493.1.
AL031595, AL033543, Z82174 Genomic DNA. Translation: CAQ08141.1.
AL031595, AL033543, AL035398 Genomic DNA. Translation: CAQ08144.1.
Z82174, AL031595, AL033543 Genomic DNA. Translation: CAQ08662.1.
AL035398, AL031595, AL033543 Genomic DNA. Translation: CAQ09485.1.
CH471138 Genomic DNA. Translation: EAW73328.1.
BC039811 mRNA. No translation available.
BC046103 mRNA. Translation: AAH46103.2.
BG743702 mRNA. No translation available.
AL159142 mRNA. Translation: CAB76900.1.
CCDSiCCDS14056.1. [Q9HBI1-1]
CCDS46724.1. [Q9HBI1-2]
CCDS58808.1. [Q9HBI1-3]
RefSeqiNP_001003828.1. NM_001003828.2. [Q9HBI1-2]
NP_001230314.1. NM_001243385.1. [Q9HBI1-3]
NP_001230315.1. NM_001243386.1.
NP_037459.2. NM_013327.4. [Q9HBI1-1]
UniGeneiHs.475074.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4EDLX-ray2.10A/B/C/D/E/F235-364[»]
4EDMX-ray2.00A/B235-364[»]
4EDNX-ray2.90A/B/C/D/E/F/G/H/I/J235-364[»]
ProteinModelPortaliQ9HBI1.
SMRiQ9HBI1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118912. 9 interactors.
IntActiQ9HBI1. 8 interactors.
MINTiMINT-6178745.
STRINGi9606.ENSP00000384515.

PTM databases

iPTMnetiQ9HBI1.
PhosphoSitePlusiQ9HBI1.

Polymorphism and mutation databases

BioMutaiPARVB.
DMDMi20139178.

Proteomic databases

EPDiQ9HBI1.
MaxQBiQ9HBI1.
PaxDbiQ9HBI1.
PeptideAtlasiQ9HBI1.
PRIDEiQ9HBI1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338758; ENSP00000342492; ENSG00000188677. [Q9HBI1-1]
ENST00000404989; ENSP00000384353; ENSG00000188677. [Q9HBI1-3]
ENST00000406477; ENSP00000384515; ENSG00000188677. [Q9HBI1-2]
GeneIDi29780.
KEGGihsa:29780.
UCSCiuc003bem.4. human. [Q9HBI1-1]

Organism-specific databases

CTDi29780.
DisGeNETi29780.
GeneCardsiPARVB.
HGNCiHGNC:14653. PARVB.
MIMi608121. gene.
neXtProtiNX_Q9HBI1.
OpenTargetsiENSG00000188677.
PharmGKBiPA32951.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3631. Eukaryota.
ENOG410XQWH. LUCA.
GeneTreeiENSGT00390000009673.
HOGENOMiHOG000247027.
HOVERGENiHBG053517.
InParanoidiQ9HBI1.
KOiK06275.
OMAiQWTVDSI.
OrthoDBiEOG091G0ULB.
PhylomeDBiQ9HBI1.
TreeFamiTF314025.

Enzyme and pathway databases

BioCyciZFISH:G66-31587-MONOMER.
ReactomeiR-HSA-446353. Cell-extracellular matrix interactions.
R-HSA-446388. Regulation of cytoskeletal remodeling and cell spreading by IPP complex components.

Miscellaneous databases

GeneWikiiPARVB.
GenomeRNAii29780.
PROiQ9HBI1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000188677.
CleanExiHS_PARVB.
ExpressionAtlasiQ9HBI1. baseline and differential.
GenevisibleiQ9HBI1. HS.

Family and domain databases

Gene3Di1.10.418.10. 2 hits.
InterProiIPR001715. CH-domain.
IPR028433. Parvin.
[Graphical view]
PANTHERiPTHR12114. PTHR12114. 1 hit.
PfamiPF00307. CH. 2 hits.
[Graphical view]
PIRSFiPIRSF039131. Parvin. 1 hit.
SMARTiSM00033. CH. 2 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 2 hits.
PROSITEiPS50021. CH. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPARVB_HUMAN
AccessioniPrimary (citable) accession number: Q9HBI1
Secondary accession number(s): B0QYM8
, B0QYN1, B2R9X6, Q5TGJ5, Q86X93, Q96PN1, Q9NSP7, Q9UGT3, Q9Y368, Q9Y3L6, Q9Y3L7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: March 1, 2001
Last modified: November 2, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.