SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HBG6

- IF122_HUMAN

UniProt

Q9HBG6 - IF122_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Intraflagellar transport protein 122 homolog
Gene
IFT122, SPG, WDR10, WDR140
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required for cilia formation during neuronal patterning. Acts as a negative regulator of Shh signaling. Required to recruit TULP3 to primary cilia By similarity.

GO - Molecular functioni

  1. protein binding Source: IntAct

GO - Biological processi

  1. camera-type eye morphogenesis Source: UniProtKB
  2. ciliary receptor clustering involved in smoothened signaling pathway Source: Ensembl
  3. cilium morphogenesis Source: UniProtKB
  4. embryonic body morphogenesis Source: UniProtKB
  5. embryonic digit morphogenesis Source: Ensembl
  6. embryonic heart tube development Source: UniProtKB
  7. intraciliary retrograde transport Source: UniProtKB
  8. limb development Source: UniProtKB
  9. negative regulation of smoothened signaling pathway Source: UniProtKB
  10. neural tube closure Source: UniProtKB
  11. protein localization to cilium Source: MGI
  12. smoothened signaling pathway involved in dorsal/ventral neural tube patterning Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cilium biogenesis/degradation

Enzyme and pathway databases

SignaLinkiQ9HBG6.

Names & Taxonomyi

Protein namesi
Recommended name:
Intraflagellar transport protein 122 homolog
Alternative name(s):
WD repeat-containing protein 10
WD repeat-containing protein 140
Gene namesi
Name:IFT122
Synonyms:SPG, WDR10, WDR140
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:13556. IFT122.

Subcellular locationi

Cytoplasm. Cell projectioncilium By similarity. Cytoplasmcytoskeletoncilium basal body By similarity
Note: Localizes to photoreceptor connecting cilia By similarity.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. cytoskeleton Source: UniProtKB-KW
  3. intraciliary transport particle A Source: UniProtKB
  4. photoreceptor connecting cilium Source: UniProtKB
  5. primary cilium Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Involvement in diseasei

Cranioectodermal dysplasia 1 (CED1) [MIM:218330]: A disorder characterized by craniofacial, skeletal and ectodermal abnormalities. Clinical features include dolichocephaly (with or without sagittal suture synostosis), scaphocephaly, short stature, limb shortening, short ribs, narrow chest, brachydactyly, renal failure and hepatic fibrosis, small and abnormally shaped teeth, sparse hair, skin laxity and abnormal nails.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti7 – 71W → C in CED1. 1 Publication
VAR_063584
Natural varianti322 – 3221S → F in CED1. 1 Publication
VAR_063585
Natural varianti502 – 5021V → G in CED1. 1 Publication
VAR_063586

Keywords - Diseasei

Ciliopathy, Disease mutation, Ectodermal dysplasia

Organism-specific databases

MIMi218330. phenotype.
Orphaneti1515. Cranioectodermal dysplasia.
PharmGKBiPA37798.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12411241Intraflagellar transport protein 122 homolog
PRO_0000051045Add
BLAST

Proteomic databases

MaxQBiQ9HBG6.
PaxDbiQ9HBG6.
PRIDEiQ9HBG6.

PTM databases

PhosphoSiteiQ9HBG6.

Expressioni

Tissue specificityi

Expressed in many tissues. Predominant expression in testis and pituitary.1 Publication

Gene expression databases

ArrayExpressiQ9HBG6.
BgeeiQ9HBG6.
CleanExiHS_IFT122.
GenevestigatoriQ9HBG6.

Organism-specific databases

HPAiHPA041815.

Interactioni

Subunit structurei

Component of the IFT complex A (IFT-A) complex.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ORFQ9Q2G43EBI-2805994,EBI-6248094From a different organism.

Protein-protein interaction databases

BioGridi120882. 3 interactions.
IntActiQ9HBG6. 2 interactions.
STRINGi9606.ENSP00000296266.

Structurei

3D structure databases

ProteinModelPortaliQ9HBG6.
SMRiQ9HBG6. Positions 15-171, 536-586.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati10 – 5041WD 1
Add
BLAST
Repeati51 – 9141WD 2
Add
BLAST
Repeati93 – 12937WD 3
Add
BLAST
Repeati131 – 16939WD 4
Add
BLAST
Repeati278 – 31740WD 5
Add
BLAST
Repeati319 – 35941WD 6
Add
BLAST
Repeati512 – 55140WD 7
Add
BLAST

Sequence similaritiesi

Contains 7 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOGENOMiHOG000261131.
HOVERGENiHBG069969.
OMAiPMYQYLE.
OrthoDBiEOG7P2XR8.
PhylomeDBiQ9HBG6.
TreeFamiTF105855.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
2.130.10.10. 3 hits.
InterProiIPR011990. TPR-like_helical.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 3 hits.
PROSITEiPS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HBG6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRAVLTWRDK AEHCINDIAF KPDGTQLILA AGSRLLVYDT SDGTLLQPLK     50
GHKDTVYCVA YAKDGKRFAS GSADKSVIIW TSKLEGILKY THNDAIQCVS 100
YNPITHQLAS CSSSDFGLWS PEQKSVSKHK SSSKIICCSW TNDGQYLALG 150
MFNGIISIRN KNGEEKVKIE RPGGSLSPIW SICWNPSSRW ESFWMNRENE 200
DAEDVIVNRY IQEIPSTLKS AVYSSQGSEA EEEEPEEEDD SPRDDNLEER 250
NDILAVADWG QKVSFYQLSG KQIGKDRALN FDPCCISYFT KGEYILLGGS 300
DKQVSLFTKD GVRLGTVGEQ NSWVWTCQAK PDSNYVVVGC QDGTISFYQL 350
IFSTVHGLYK DRYAYRDSMT DVIVQHLITE QKVRIKCKEL VKKIAIYRNR 400
LAIQLPEKIL IYELYSEDLS DMHYRVKEKI IKKFECNLLV VCANHIILCQ 450
EKRLQCLSFS GVKEREWQME SLIRYIKVIG GPPGREGLLV GLKNGQILKI 500
FVDNLFAIVL LKQATAVRCL DMSASRKKLA VVDENDTCLV YDIDTKELLF 550
QEPNANSVAW NTQCEDMLCF SGGGYLNIKA STFPVHRQKL QGFVVGYNGS 600
KIFCLHVFSI SAVEVPQSAP MYQYLDRKLF KEAYQIACLG VTDTDWRELA 650
MEALEGLDFE TAKKAFIRVQ DLRYLELISS IEERKKRGET NNDLFLADVF 700
SYQGKFHEAA KLYKRSGHEN LALEMYTDLC MFEYAKDFLG SGDPKETKML 750
ITKQADWARN IKEPKAAVEM YISAGEHVKA IEICGDHGWV DMLIDIARKL 800
DKAEREPLLL CATYLKKLDS PGYAAETYLK MGDLKSLVQL HVETQRWDEA 850
FALGEKHPEF KDDIYMPYAQ WLAENDRFEE AQKAFHKAGR QREAVQVLEQ 900
LTNNAVAESR FNDAAYYYWM LSMQCLDIAQ DPAQKDTMLG KFYHFQRLAE 950
LYHGYHAIHR HTEDPFSVHR PETLFNISRF LLHSLPKDTP SGISKVKILF 1000
TLAKQSKALG AYRLARHAYD KLRGLYIPAR FQKSIELGTL TIRAKPFHDS 1050
EELVPLCYRC STNNPLLNNL GNVCINCRQP FIFSASSYDV LHLVEFYLEE 1100
GITDEEAISL IDLEVLRPKR DDRQLEIANN SSQILRLVET KDSIGDEDPF 1150
TAKLSFEQGG SEFVPVVVSR LVLRSMSRRD VLIKRWPPPL RWQYFRSLLP 1200
DASITMCPSC FQMFHSEDYE LLVLQHGCCP YCRRCKDDPG P 1241
Length:1,241
Mass (Da):141,825
Last modified:November 4, 2008 - v2
Checksum:i6C3C543369A6BDF5
GO
Isoform 2 (identifier: Q9HBG6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     996-996: V → VR

Show »
Length:1,242
Mass (Da):141,981
Checksum:i9A8CB711397BEFA2
GO
Isoform 3 (identifier: Q9HBG6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     188-247: SRWESFWMNRENEDAEDVIVNRYIQEIPSTLKSAVYSSQGSEAEEEEPEEEDDSPRDDNL → R

Show »
Length:1,182
Mass (Da):134,947
Checksum:i656347FD84660F4E
GO
Isoform 4 (identifier: Q9HBG6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     65-116: Missing.
     188-247: SRWESFWMNRENEDAEDVIVNRYIQEIPSTLKSAVYSSQGSEAEEEEPEEEDDSPRDDNL → R
     930-930: Q → QA

Note: No experimental confirmation available.

Show »
Length:1,131
Mass (Da):129,360
Checksum:iC5B817F74CDF0FD5
GO
Isoform 5 (identifier: Q9HBG6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-91: T → TSWSVMSSLHLHLPFLGLHKTVRVTATDKAPKGQGGRIDCLRPSVQNQPGQK

Show »
Length:1,292
Mass (Da):147,386
Checksum:i654E06B93117E686
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti7 – 71W → C in CED1. 1 Publication
VAR_063584
Natural varianti322 – 3221S → F in CED1. 1 Publication
VAR_063585
Natural varianti502 – 5021V → G in CED1. 1 Publication
VAR_063586

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei65 – 11652Missing in isoform 4.
VSP_043310Add
BLAST
Alternative sequencei91 – 911T → TSWSVMSSLHLHLPFLGLHK TVRVTATDKAPKGQGGRIDC LRPSVQNQPGQK in isoform 5.
VSP_045224
Alternative sequencei188 – 24760SRWES…RDDNL → R in isoform 3 and isoform 4.
VSP_041161Add
BLAST
Alternative sequencei930 – 9301Q → QA in isoform 4.
VSP_043311
Alternative sequencei996 – 9961V → VR in isoform 2.
VSP_035605

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti273 – 2731I → T in AAG15427. 1 Publication
Sequence conflicti489 – 4891L → S in BAD96815. 1 Publication
Sequence conflicti687 – 6871R → Q in AAG15428. 1 Publication
Sequence conflicti907 – 9071A → V in AAG15428. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF244930 mRNA. Translation: AAG15427.1.
AF244931 mRNA. Translation: AAG15428.1.
AF302154 mRNA. Translation: AAG13415.1.
AK223095 mRNA. Translation: BAD96815.1.
AC080007 Genomic DNA. No translation available.
AL449212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79247.1.
CH471052 Genomic DNA. Translation: EAW79249.1.
CH471052 Genomic DNA. Translation: EAW79250.1.
BC003045 mRNA. Translation: AAH03045.2.
BC004238 mRNA. Translation: AAH04238.1.
CCDSiCCDS3059.1. [Q9HBG6-3]
CCDS3060.1. [Q9HBG6-5]
CCDS3061.1. [Q9HBG6-1]
CCDS3062.1. [Q9HBG6-4]
PIRiT43484.
RefSeqiNP_001267470.1. NM_001280541.1.
NP_001267474.1. NM_001280545.1.
NP_443711.2. NM_052985.3. [Q9HBG6-5]
NP_443715.1. NM_052989.2. [Q9HBG6-1]
NP_443716.1. NM_052990.2. [Q9HBG6-4]
XP_005247661.1. XM_005247604.2. [Q9HBG6-2]
UniGeneiHs.655284.

Genome annotation databases

EnsembliENST00000296266; ENSP00000296266; ENSG00000163913. [Q9HBG6-5]
ENST00000347300; ENSP00000323973; ENSG00000163913. [Q9HBG6-3]
ENST00000348417; ENSP00000324005; ENSG00000163913. [Q9HBG6-1]
ENST00000349441; ENSP00000324165; ENSG00000163913. [Q9HBG6-4]
GeneIDi55764.
KEGGihsa:55764.
UCSCiuc003eml.3. human.
uc003emm.3. human. [Q9HBG6-1]
uc003emn.3. human. [Q9HBG6-3]
uc003emo.3. human. [Q9HBG6-4]

Polymorphism databases

DMDMi212276436.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF244930 mRNA. Translation: AAG15427.1 .
AF244931 mRNA. Translation: AAG15428.1 .
AF302154 mRNA. Translation: AAG13415.1 .
AK223095 mRNA. Translation: BAD96815.1 .
AC080007 Genomic DNA. No translation available.
AL449212 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79247.1 .
CH471052 Genomic DNA. Translation: EAW79249.1 .
CH471052 Genomic DNA. Translation: EAW79250.1 .
BC003045 mRNA. Translation: AAH03045.2 .
BC004238 mRNA. Translation: AAH04238.1 .
CCDSi CCDS3059.1. [Q9HBG6-3 ]
CCDS3060.1. [Q9HBG6-5 ]
CCDS3061.1. [Q9HBG6-1 ]
CCDS3062.1. [Q9HBG6-4 ]
PIRi T43484.
RefSeqi NP_001267470.1. NM_001280541.1.
NP_001267474.1. NM_001280545.1.
NP_443711.2. NM_052985.3. [Q9HBG6-5 ]
NP_443715.1. NM_052989.2. [Q9HBG6-1 ]
NP_443716.1. NM_052990.2. [Q9HBG6-4 ]
XP_005247661.1. XM_005247604.2. [Q9HBG6-2 ]
UniGenei Hs.655284.

3D structure databases

ProteinModelPortali Q9HBG6.
SMRi Q9HBG6. Positions 15-171, 536-586.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120882. 3 interactions.
IntActi Q9HBG6. 2 interactions.
STRINGi 9606.ENSP00000296266.

PTM databases

PhosphoSitei Q9HBG6.

Polymorphism databases

DMDMi 212276436.

Proteomic databases

MaxQBi Q9HBG6.
PaxDbi Q9HBG6.
PRIDEi Q9HBG6.

Protocols and materials databases

DNASUi 55764.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000296266 ; ENSP00000296266 ; ENSG00000163913 . [Q9HBG6-5 ]
ENST00000347300 ; ENSP00000323973 ; ENSG00000163913 . [Q9HBG6-3 ]
ENST00000348417 ; ENSP00000324005 ; ENSG00000163913 . [Q9HBG6-1 ]
ENST00000349441 ; ENSP00000324165 ; ENSG00000163913 . [Q9HBG6-4 ]
GeneIDi 55764.
KEGGi hsa:55764.
UCSCi uc003eml.3. human.
uc003emm.3. human. [Q9HBG6-1 ]
uc003emn.3. human. [Q9HBG6-3 ]
uc003emo.3. human. [Q9HBG6-4 ]

Organism-specific databases

CTDi 55764.
GeneCardsi GC03P129158.
GeneReviewsi IFT122.
H-InvDB HIX0003670.
HIX0163443.
HGNCi HGNC:13556. IFT122.
HPAi HPA041815.
MIMi 218330. phenotype.
606045. gene.
neXtProti NX_Q9HBG6.
Orphaneti 1515. Cranioectodermal dysplasia.
PharmGKBi PA37798.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
HOGENOMi HOG000261131.
HOVERGENi HBG069969.
OMAi PMYQYLE.
OrthoDBi EOG7P2XR8.
PhylomeDBi Q9HBG6.
TreeFami TF105855.

Enzyme and pathway databases

SignaLinki Q9HBG6.

Miscellaneous databases

GenomeRNAii 55764.
NextBioi 60799.
PROi Q9HBG6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9HBG6.
Bgeei Q9HBG6.
CleanExi HS_IFT122.
Genevestigatori Q9HBG6.

Family and domain databases

Gene3Di 1.25.40.10. 3 hits.
2.130.10.10. 3 hits.
InterProi IPR011990. TPR-like_helical.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF00400. WD40. 2 hits.
[Graphical view ]
SMARTi SM00320. WD40. 7 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 3 hits.
PROSITEi PS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of human WDR10, a novel gene located at 3q21 encoding a WD-repeat protein that is highly expressed in pituitary and testis."
    Gross C., De Baere E., Lo A., Chang W., Messiaen L.
    DNA Cell Biol. 20:41-52(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), TISSUE SPECIFICITY.
  2. "The research of spermatogenesis related genes."
    Shan Y.X., Li J.M., Sha J.H.
    Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Lung.
  7. "TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia."
    Mukhopadhyay S., Wen X., Chih B., Nelson C.D., Lane W.S., Scales S.J., Jackson P.K.
    Genes Dev. 24:2180-2193(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE IFT-A COMPLEX.
  8. Cited for: VARIANTS CED1 CYS-7; PHE-322 AND GLY-502.

Entry informationi

Entry nameiIF122_HUMAN
AccessioniPrimary (citable) accession number: Q9HBG6
Secondary accession number(s): G3XAB1
, Q53G36, Q9BTB9, Q9BTY4, Q9HAT9, Q9HBG5, Q9UF80
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: November 4, 2008
Last modified: September 3, 2014
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi