Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HBE1

- PATZ1_HUMAN

UniProt

Q9HBE1 - PATZ1_HUMAN

Protein

POZ-, AT hook-, and zinc finger-containing protein 1

Gene

PATZ1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional repressor.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi264 – 27613A.T hookAdd
    BLAST
    Zinc fingeri292 – 31423C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri355 – 37723C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri383 – 40523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri413 – 43624C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri442 – 46423C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri495 – 51824C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri605 – 62824C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. chromatin binding Source: Ensembl
    2. DNA binding Source: UniProtKB
    3. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. male gonad development Source: Ensembl
    2. negative regulation of transcription, DNA-templated Source: UniProtKB
    3. positive regulation of transcription, DNA-templated Source: Ensembl
    4. regulation of transcription, DNA-templated Source: UniProtKB
    5. spermatogenesis Source: Ensembl
    6. T cell differentiation Source: Ensembl
    7. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    POZ-, AT hook-, and zinc finger-containing protein 1
    Alternative name(s):
    BTB/POZ domain zinc finger transcription factor
    Protein kinase A RI subunit alpha-associated protein
    Zinc finger and BTB domain-containing protein 19
    Zinc finger protein 278
    Zinc finger sarcoma gene protein
    Gene namesi
    Name:PATZ1
    Synonyms:PATZ, RIAZ, ZBTB19, ZNF278, ZSG
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:13071. PATZ1.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving PATZ1 is associated with small round cell sarcoma. Translocation t(1;22)(p36.1;q12) with EWSR1.

    Keywords - Diseasei

    Proto-oncogene

    Organism-specific databases

    PharmGKBiPA162398806.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 687687POZ-, AT hook-, and zinc finger-containing protein 1PRO_0000047504Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei282 – 2821Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9HBE1.
    PaxDbiQ9HBE1.
    PRIDEiQ9HBE1.

    PTM databases

    PhosphoSiteiQ9HBE1.

    Expressioni

    Tissue specificityi

    Ubiquitous.

    Gene expression databases

    ArrayExpressiQ9HBE1.
    BgeeiQ9HBE1.
    CleanExiHS_PATZ1.
    GenevestigatoriQ9HBE1.

    Organism-specific databases

    HPAiHPA047893.

    Interactioni

    Protein-protein interaction databases

    BioGridi117133. 9 interactions.
    STRINGi9606.ENSP00000266269.

    Structurei

    Secondary structure

    1
    687
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni295 – 2973
    Helixi304 – 31411
    Turni315 – 3173
    Beta strandi354 – 3574
    Turni358 – 3614
    Beta strandi362 – 3665
    Helixi367 – 3737
    Helixi374 – 3763
    Beta strandi382 – 3854
    Turni386 – 3894
    Beta strandi391 – 3933
    Helixi395 – 40511
    Beta strandi411 – 4133
    Beta strandi416 – 4183
    Beta strandi421 – 4244
    Helixi425 – 43410

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EPPNMR-A286-338[»]
    2EPQNMR-A380-411[»]
    2EPRNMR-A350-384[»]
    2EPSNMR-A408-445[»]
    2YT9NMR-A355-436[»]
    ProteinModelPortaliQ9HBE1.
    SMRiQ9HBE1. Positions 10-152, 281-637.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9HBE1.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini41 – 13090BTBPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 A.T hook DNA-binding domain.Curated
    Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
    Contains 7 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri292 – 31423C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri355 – 37723C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri383 – 40523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri413 – 43624C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri442 – 46423C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri495 – 51824C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri605 – 62824C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000037943.
    HOVERGENiHBG056645.
    InParanoidiQ9HBE1.
    OMAiMPEDEAT.
    OrthoDBiEOG79SDWK.
    PhylomeDBiQ9HBE1.
    TreeFamiTF331686.

    Family and domain databases

    Gene3Di3.30.160.60. 6 hits.
    3.30.710.10. 1 hit.
    InterProiIPR017956. AT_hook_DNA-bd_motif.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR000637. HMGI/Y_DNA-bd_CS.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00651. BTB. 1 hit.
    PF00096. zf-C2H2. 2 hits.
    [Graphical view]
    SMARTiSM00384. AT_hook. 2 hits.
    SM00225. BTB. 1 hit.
    SM00355. ZnF_C2H2. 8 hits.
    [Graphical view]
    SUPFAMiSSF54695. SSF54695. 2 hits.
    PROSITEiPS50097. BTB. 1 hit.
    PS00354. HMGI_Y. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 7 hits.
    PS50157. ZINC_FINGER_C2H2_2. 7 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HBE1-1) [UniParc]FASTAAdd to Basket

    Also known as: C

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MERVNDASCG PSGCYTYQVS RHSTEMLHNL NQQRKNGGRF CDVLLRVGDE    50
    SFPAHRAVLA ACSEYFESVF SAQLGDGGAA DGGPADVGGA TAAPGGGAGG 100
    SRELEMHTIS SKVFGDILDF AYTSRIVVRL ESFPELMTAA KFLLMRSVIE 150
    ICQEVIKQSN VQILVPPARA DIMLFRPPGT SDLGFPLDMT NGAALAANSN 200
    GIAGSMQPEE EAARAAGAAI AGQASLPVLP GVDRLPMVAG PLSPQLLTSP 250
    FPSVASSAPP LTGKRGRGRP RKANLLDSMF GSPGGLREAG ILPCGLCGKV 300
    FTDANRLRQH EAQHGVTSLQ LGYIDLPPPR LGENGLPISE DPDGPRKRSR 350
    TRKQVACEIC GKIFRDVYHL NRHKLSHSGE KPYSCPVCGL RFKRKDRMSY 400
    HVRSHDGSVG KPYICQSCGK GFSRPDHLNG HIKQVHTSER PHKCQTCNAS 450
    FATRDRLRSH LACHEDKVPC QVCGKYLRAA YMADHLKKHS EGPSNFCSIC 500
    NRGFSSASYL KVHVKTHHGV PLPQVSRHQE PILNGGAAFH CARTYGNKEG 550
    QKCSHQDPIE SSDSYGDLSD ASDLKTPEKQ SANGSFSCDM AVPKNKMESD 600
    GEKKYPCPEC GSFFRSKSYL NKHIQKVHVR ALGGPLGDLG PALGSPFSPQ 650
    QNMSLLESFG FQIVQSAFAS SLVDPEVDQQ PMGPEGK 687
    Length:687
    Mass (Da):74,060
    Last modified:March 1, 2001 - v1
    Checksum:i0F1C59A78C6D110A
    GO
    Isoform 2 (identifier: Q9HBE1-2) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         504-537: FSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGA → LQAPGAHPEWGSSVPLRQDLWQQRRPEMLTSGSD
         538-687: Missing.

    Show »
    Length:537
    Mass (Da):57,995
    Checksum:i950792413BF1F5DB
    GO
    Isoform 3 (identifier: Q9HBE1-3) [UniParc]FASTAAdd to Basket

    Also known as: A

    The sequence of this isoform differs from the canonical sequence as follows:
         503-548: Missing.

    Show »
    Length:641
    Mass (Da):69,079
    Checksum:i29515535E380F0CE
    GO
    Isoform 4 (identifier: Q9HBE1-4) [UniParc]FASTAAdd to Basket

    Also known as: Short

    The sequence of this isoform differs from the canonical sequence as follows:
         446-537: TCNASFATRD...HQEPILNGGA → VWVGSSSGLP...SRAFTQWPVG
         538-687: Missing.

    Show »
    Length:537
    Mass (Da):57,601
    Checksum:iBA4A909E24800F13
    GO

    Sequence cautioni

    The sequence CAB51404.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti63 – 631S → N in AAF32518. (PubMed:10713105)Curated
    Sequence conflicti259 – 2591P → L in AAF32518. (PubMed:10713105)Curated
    Sequence conflicti394 – 3941R → K in AAF32518. (PubMed:10713105)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti685 – 6851E → D.
    Corresponds to variant rs2240424 [ dbSNP | Ensembl ].
    VAR_052724

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei446 – 53792TCNAS…LNGGA → VWVGSSSGLPPLEPLPSDLP SWDFAQPALWRSSHSVPDTA FSLSLKKSFPALENLGPAHS SNTLFCPAPPGYLRQGWTTP EGSRAFTQWPVG in isoform 4. 3 PublicationsVSP_008802Add
    BLAST
    Alternative sequencei503 – 54846Missing in isoform 3. 3 PublicationsVSP_008801Add
    BLAST
    Alternative sequencei504 – 53734FSSAS…LNGGA → LQAPGAHPEWGSSVPLRQDL WQQRRPEMLTSGSD in isoform 2. 1 PublicationVSP_008799Add
    BLAST
    Alternative sequencei538 – 687150Missing in isoform 2 and isoform 4. 3 PublicationsVSP_008800Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF119256 mRNA. Translation: AAF32518.1.
    AF254082 mRNA. Translation: AAG09031.1.
    AF254083 mRNA. Translation: AAG09032.1.
    AF254084 mRNA. Translation: AAG09033.1.
    AF254085 mRNA. Translation: AAG09034.1.
    AY028384 mRNA. Translation: AAK19024.1.
    AL096880 mRNA. Translation: CAB51404.1. Different initiation.
    CR456613 mRNA. Translation: CAG30499.1.
    AC005003 Genomic DNA. Translation: AAF01349.1.
    BC021091 mRNA. Translation: AAH21091.1.
    CCDSiCCDS13894.1. [Q9HBE1-1]
    CCDS13895.1. [Q9HBE1-3]
    CCDS13896.1. [Q9HBE1-4]
    CCDS46691.1. [Q9HBE1-2]
    RefSeqiNP_055138.2. NM_014323.2. [Q9HBE1-1]
    NP_114439.1. NM_032050.1. [Q9HBE1-3]
    NP_114440.1. NM_032051.1. [Q9HBE1-4]
    NP_114441.1. NM_032052.1. [Q9HBE1-2]
    UniGeneiHs.731398.

    Genome annotation databases

    EnsembliENST00000215919; ENSP00000215919; ENSG00000100105. [Q9HBE1-4]
    ENST00000266269; ENSP00000266269; ENSG00000100105. [Q9HBE1-1]
    ENST00000351933; ENSP00000337520; ENSG00000100105. [Q9HBE1-3]
    ENST00000405309; ENSP00000384173; ENSG00000100105. [Q9HBE1-2]
    GeneIDi23598.
    KEGGihsa:23598.
    UCSCiuc003akp.3. human. [Q9HBE1-2]
    uc003akq.3. human. [Q9HBE1-1]
    uc003akr.3. human. [Q9HBE1-3]
    uc003aks.3. human. [Q9HBE1-4]

    Polymorphism databases

    DMDMi38258840.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF119256 mRNA. Translation: AAF32518.1 .
    AF254082 mRNA. Translation: AAG09031.1 .
    AF254083 mRNA. Translation: AAG09032.1 .
    AF254084 mRNA. Translation: AAG09033.1 .
    AF254085 mRNA. Translation: AAG09034.1 .
    AY028384 mRNA. Translation: AAK19024.1 .
    AL096880 mRNA. Translation: CAB51404.1 . Different initiation.
    CR456613 mRNA. Translation: CAG30499.1 .
    AC005003 Genomic DNA. Translation: AAF01349.1 .
    BC021091 mRNA. Translation: AAH21091.1 .
    CCDSi CCDS13894.1. [Q9HBE1-1 ]
    CCDS13895.1. [Q9HBE1-3 ]
    CCDS13896.1. [Q9HBE1-4 ]
    CCDS46691.1. [Q9HBE1-2 ]
    RefSeqi NP_055138.2. NM_014323.2. [Q9HBE1-1 ]
    NP_114439.1. NM_032050.1. [Q9HBE1-3 ]
    NP_114440.1. NM_032051.1. [Q9HBE1-4 ]
    NP_114441.1. NM_032052.1. [Q9HBE1-2 ]
    UniGenei Hs.731398.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EPP NMR - A 286-338 [» ]
    2EPQ NMR - A 380-411 [» ]
    2EPR NMR - A 350-384 [» ]
    2EPS NMR - A 408-445 [» ]
    2YT9 NMR - A 355-436 [» ]
    ProteinModelPortali Q9HBE1.
    SMRi Q9HBE1. Positions 10-152, 281-637.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117133. 9 interactions.
    STRINGi 9606.ENSP00000266269.

    PTM databases

    PhosphoSitei Q9HBE1.

    Polymorphism databases

    DMDMi 38258840.

    Proteomic databases

    MaxQBi Q9HBE1.
    PaxDbi Q9HBE1.
    PRIDEi Q9HBE1.

    Protocols and materials databases

    DNASUi 23598.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000215919 ; ENSP00000215919 ; ENSG00000100105 . [Q9HBE1-4 ]
    ENST00000266269 ; ENSP00000266269 ; ENSG00000100105 . [Q9HBE1-1 ]
    ENST00000351933 ; ENSP00000337520 ; ENSG00000100105 . [Q9HBE1-3 ]
    ENST00000405309 ; ENSP00000384173 ; ENSG00000100105 . [Q9HBE1-2 ]
    GeneIDi 23598.
    KEGGi hsa:23598.
    UCSCi uc003akp.3. human. [Q9HBE1-2 ]
    uc003akq.3. human. [Q9HBE1-1 ]
    uc003akr.3. human. [Q9HBE1-3 ]
    uc003aks.3. human. [Q9HBE1-4 ]

    Organism-specific databases

    CTDi 23598.
    GeneCardsi GC22M031721.
    HGNCi HGNC:13071. PATZ1.
    HPAi HPA047893.
    MIMi 605165. gene.
    neXtProti NX_Q9HBE1.
    PharmGKBi PA162398806.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000037943.
    HOVERGENi HBG056645.
    InParanoidi Q9HBE1.
    OMAi MPEDEAT.
    OrthoDBi EOG79SDWK.
    PhylomeDBi Q9HBE1.
    TreeFami TF331686.

    Miscellaneous databases

    ChiTaRSi PATZ1. human.
    EvolutionaryTracei Q9HBE1.
    GeneWikii PATZ1.
    GenomeRNAii 23598.
    NextBioi 46268.
    PROi Q9HBE1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HBE1.
    Bgeei Q9HBE1.
    CleanExi HS_PATZ1.
    Genevestigatori Q9HBE1.

    Family and domain databases

    Gene3Di 3.30.160.60. 6 hits.
    3.30.710.10. 1 hit.
    InterProi IPR017956. AT_hook_DNA-bd_motif.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR000637. HMGI/Y_DNA-bd_CS.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00651. BTB. 1 hit.
    PF00096. zf-C2H2. 2 hits.
    [Graphical view ]
    SMARTi SM00384. AT_hook. 2 hits.
    SM00225. BTB. 1 hit.
    SM00355. ZnF_C2H2. 8 hits.
    [Graphical view ]
    SUPFAMi SSF54695. SSF54695. 2 hits.
    PROSITEi PS50097. BTB. 1 hit.
    PS00354. HMGI_Y. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 7 hits.
    PS50157. ZINC_FINGER_C2H2_2. 7 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel member of the BTB/POZ family, PATZ, associates with the RNF4 RING finger protein and acts as a transcriptional repressor."
      Fedele M., Benvenuto G., Pero R., Majello B., Battista S., Lembo F., Vollono E., Day P.M., Santoro M., Lania L., Bruni C.B., Fusco A., Chiatiotti L.
      J. Biol. Chem. 275:7894-7901(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), SUBCELLULAR LOCATION, FUNCTION, INTERACTION WITH RNF4.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), CHROMOSOMAL TRANSLOCATION WITH EWSR1.
    3. "Novel cAMP signalling via the regulatory subunit of the cAMP-dependent protein kinase."
      Chin K.-V., Yang W.-L., Kudoh K.
      Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3).
    4. Collins J.E., Huckle E.J.
      Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    6. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Colon.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Solution structure of zinc finger domains in zinc finger protein 278."
      RIKEN structural genomics initiative (RSGI)
      Submitted (APR-2008) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 359-437.

    Entry informationi

    Entry nameiPATZ1_HUMAN
    AccessioniPrimary (citable) accession number: Q9HBE1
    Secondary accession number(s): Q9HBE2
    , Q9HBE3, Q9P1A9, Q9UDU0, Q9Y529
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 7, 2003
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3