Q9HBE1 (PATZ1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: POZ-, AT hook-, and zinc finger-containing protein 1 Alternative name(s): BTB/POZ domain zinc finger transcription factor Protein kinase A RI subunit alpha-associated protein Zinc finger and BTB domain-containing protein 19 Zinc finger protein 278 Zinc finger sarcoma gene protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 687 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional repressor. Ref.1 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. |
| Involvement in disease | A chromosomal aberration involving PATZ1 is associated with small round cell sarcoma. Translocation t(1;22)(p36.1;q12) with EWSR1. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 1 A.T hook DNA-binding domain. Contains 1 BTB (POZ) domain. Contains 7 C2H2-type zinc fingers. |
| Sequence caution | The sequence CAB51404.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HBE1-1) Also known as: C; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HBE1-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 504-537: FSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGA → LQAPGAHPEWGSSVPLRQDLWQQRRPEMLTSGSD 538-687: Missing. | ||||||
| Isoform 3 (identifier: Q9HBE1-3) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 503-548: Missing. | ||||||
| Isoform 4 (identifier: Q9HBE1-4) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 446-537: TCNASFATRD...HQEPILNGGA → VWVGSSSGLP...SRAFTQWPVG 538-687: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 687 | 687 | POZ-, AT hook-, and zinc finger-containing protein 1 | PRO_0000047504 | ||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||
| Domain | 41 – 130 | 90 | BTB | |||||||||||||||||||||||||||||||
| DNA binding | 264 – 276 | 13 | A.T hook | |||||||||||||||||||||||||||||||
| Zinc finger | 292 – 314 | 23 | C2H2-type 1 | |||||||||||||||||||||||||||||||
| Zinc finger | 355 – 377 | 23 | C2H2-type 2 | |||||||||||||||||||||||||||||||
| Zinc finger | 383 – 405 | 23 | C2H2-type 3 | |||||||||||||||||||||||||||||||
| Zinc finger | 413 – 436 | 24 | C2H2-type 4 | |||||||||||||||||||||||||||||||
| Zinc finger | 442 – 464 | 23 | C2H2-type 5 | |||||||||||||||||||||||||||||||
| Zinc finger | 495 – 518 | 24 | C2H2-type 6 | |||||||||||||||||||||||||||||||
| Zinc finger | 605 – 628 | 24 | C2H2-type 7 | |||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||
| Modified residue | 282 | 1 | Phosphoserine Ref.8 | |||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 446 – 537 | 92 | TCNAS…LNGGA → VWVGSSSGLPPLEPLPSDLP SWDFAQPALWRSSHSVPDTA FSLSLKKSFPALENLGPAHS SNTLFCPAPPGYLRQGWTTP EGSRAFTQWPVG in isoform 4. | VSP_008802 | ||||||||||||||||||||||||||||||
| Alternative sequence | 503 – 548 | 46 | Missing in isoform 3. | VSP_008801 | ||||||||||||||||||||||||||||||
| Alternative sequence | 504 – 537 | 34 | FSSAS…LNGGA → LQAPGAHPEWGSSVPLRQDL WQQRRPEMLTSGSD in isoform 2. | VSP_008799 | ||||||||||||||||||||||||||||||
| Alternative sequence | 538 – 687 | 150 | Missing in isoform 2 and isoform 4. | VSP_008800 | ||||||||||||||||||||||||||||||
| Natural variant | 685 | 1 | E → D. Corresponds to variant rs2240424 [ dbSNP | Ensembl ]. | VAR_052724 | ||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 63 | 1 | S → N in AAF32518. Ref.1 | |||||||||||||||||||||||||||||||
| Sequence conflict | 259 | 1 | P → L in AAF32518. Ref.1 | |||||||||||||||||||||||||||||||
| Sequence conflict | 394 | 1 | R → K in AAF32518. Ref.1 | |||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||
| Turn | 295 – 297 | 3 | ||||||||||||||||||||||||||||||||
| Helix | 304 – 314 | 11 | ||||||||||||||||||||||||||||||||
| Turn | 315 – 317 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 354 – 357 | 4 | ||||||||||||||||||||||||||||||||
| Turn | 358 – 361 | 4 | ||||||||||||||||||||||||||||||||
| Beta strand | 362 – 366 | 5 | ||||||||||||||||||||||||||||||||
| Helix | 367 – 373 | 7 | ||||||||||||||||||||||||||||||||
| Helix | 374 – 376 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 382 – 385 | 4 | ||||||||||||||||||||||||||||||||
| Turn | 386 – 389 | 4 | ||||||||||||||||||||||||||||||||
| Beta strand | 391 – 393 | 3 | ||||||||||||||||||||||||||||||||
| Helix | 395 – 405 | 11 | ||||||||||||||||||||||||||||||||
| Beta strand | 411 – 413 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 416 – 418 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 421 – 424 | 4 | ||||||||||||||||||||||||||||||||
| Helix | 425 – 434 | 10 | ||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel member of the BTB/POZ family, PATZ, associates with the RNF4 RING finger protein and acts as a transcriptional repressor." Fedele M., Benvenuto G., Pero R., Majello B., Battista S., Lembo F., Vollono E., Day P.M., Santoro M., Lania L., Bruni C.B., Fusco A., Chiatiotti L. J. Biol. Chem. 275:7894-7901(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), SUBCELLULAR LOCATION, FUNCTION, INTERACTION WITH RNF4. |
| [2] | "A novel zinc finger gene is fused to EWS in small round cell tumor." Mastrangelo T., Modena P., Tornielli S., Bullrich F., Testi A., Mezzelani A., Radice P., Azzarelli A., Pilotti S., Croce C., Pierotti M., Sozzi G. Oncogene 19:3799-3804(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), CHROMOSOMAL TRANSLOCATION WITH EWSR1. |
| [3] | "Novel cAMP signalling via the regulatory subunit of the cAMP-dependent protein kinase." Chin K.-V., Yang W.-L., Kudoh K. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3). |
| [4] | Collins J.E., Huckle E.J. Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [5] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [6] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Colon. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-282, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Solution structure of zinc finger domains in zinc finger protein 278." RIKEN structural genomics initiative (RSGI) Submitted (APR-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 359-437. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF119256 mRNA. Translation: AAF32518.1. AF254082 mRNA. Translation: AAG09031.1. AF254083 mRNA. Translation: AAG09032.1. AF254084 mRNA. Translation: AAG09033.1. AF254085 mRNA. Translation: AAG09034.1. AY028384 mRNA. Translation: AAK19024.1. AL096880 mRNA. Translation: CAB51404.1. Different initiation. CR456613 mRNA. Translation: CAG30499.1. AC005003 Genomic DNA. Translation: AAF01349.1. BC021091 mRNA. Translation: AAH21091.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00003801. IPI00034248. IPI00217078. IPI00395545. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_055138.2. NM_014323.2. NP_114439.1. NM_032050.1. NP_114440.1. NM_032051.1. NP_114441.1. NM_032052.1. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.731398. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| MINT | MINT-253467. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000266269. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 38258840. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 23598. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000215919; ENSP00000215919; ENSG00000100105. ENST00000266269; ENSP00000266269; ENSG00000100105. ENST00000351933; ENSP00000337520; ENSG00000100105. ENST00000405309; ENSP00000384173; ENSG00000100105. | ||||||||||||||||||||||||||||||||||||
| GeneID | 23598. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:23598. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc003akp.3. human. uc003akq.3. human. uc003akr.3. human. uc003aks.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 23598. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC22M031721. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:13071. PATZ1. | ||||||||||||||||||||||||||||||||||||
| MIM | 605165. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA162398806. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG5048. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000037943. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG056645. | ||||||||||||||||||||||||||||||||||||
| InParanoid | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| OMA | QVACDIC. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG41G33S. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PATZ1. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000100105. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| Gene3D | 3.30.160.60. 6 hits. 3.30.710.10. 1 hit. | ||||||||||||||||||||||||||||||||||||
| InterPro | IPR017956. AT_hook_DNA-bd_motif. IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR013069. BTB_POZ. IPR000637. HMGI/Y_DNA-bd_CS. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00651. BTB. 1 hit. PF00096. zf-C2H2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00384. AT_hook. 2 hits. SM00225. BTB. 1 hit. SM00355. ZnF_C2H2. 8 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF54695. BTB/POZ_fold. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS50097. BTB. 1 hit. PS00354. HMGI_Y. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 7 hits. PS50157. ZINC_FINGER_C2H2_2. 7 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | PATZ1. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9HBE1. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 23598. | ||||||||||||||||||||||||||||||||||||
| NextBio | 46268. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PATZ1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HBE1 Secondary accession number(s): Q9HBE2 Q9Y529 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
