Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HB75

- PIDD1_HUMAN

UniProt

Q9HB75 - PIDD1_HUMAN

Protein

p53-induced death domain-containing protein 1

Gene

PIDD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 2 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Promotes apoptosis downstream of the tumor suppressor as component of the DNA damage/stress response pathway that connects p53/TP53 to apoptosis. Associates with NEMO/IKBKG and RIP1 and enhances sumoylation and ubiquitination of NEMO/IKBKG which is important for activation of the transcription factor NF-kappa-B. Associates with CASP2/caspase-2 and CRADD/RAIDD, and induces activation of CASP2 which an important regulator in apoptotic pathways.3 Publications

    GO - Molecular functioni

    1. death receptor binding Source: ProtInc
    2. protein binding Source: IntAct

    GO - Biological processi

    1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
    2. cellular response to DNA damage stimulus Source: UniProtKB
    3. DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest Source: UniProtKB
    4. negative regulation of apoptotic process Source: UniProtKB
    5. positive regulation of apoptotic process Source: UniProtKB
    6. positive regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: Ensembl
    7. positive regulation of NF-kappaB transcription factor activity Source: UniProtKB
    8. signal transduction Source: ProtInc

    Keywords - Biological processi

    Apoptosis

    Enzyme and pathway databases

    SignaLinkiQ9HB75.

    Protein family/group databases

    MEROPSiS68.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    p53-induced death domain-containing protein 1
    Alternative name(s):
    Leucine-rich repeat and death domain-containing protein
    Gene namesi
    Name:PIDD1
    Synonyms:LRDD, PIDD
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:16491. PIDD1.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. Golgi apparatus Source: HPA
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30445.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 910909p53-induced death domain-containing protein 1PRO_0000245243Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei299 – 2991Phosphoserine1 Publication
    Modified residuei305 – 3051Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiQ9HB75.
    PRIDEiQ9HB75.

    PTM databases

    PhosphoSiteiQ9HB75.

    Expressioni

    Tissue specificityi

    Ubiquitous.1 Publication

    Inductioni

    Induced by gamma-irradiation.1 Publication

    Gene expression databases

    ArrayExpressiQ9HB75.
    BgeeiQ9HB75.
    GenevestigatoriQ9HB75.

    Organism-specific databases

    HPAiCAB012647.
    HPA055473.

    Interactioni

    Subunit structurei

    Interacts with FADD and MAP-kinase activating death domain/MADD. Forms a complex with IKBKG and with receptor-interacting serine-threonine kinase 1/RIP1. Forms also a complex named PIDDosome with CASP2 and CRADD.4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CRADDP785608EBI-520427,EBI-520375
    MDFIQ997503EBI-520427,EBI-724076
    PRKDCP785276EBI-520427,EBI-352053

    Protein-protein interaction databases

    BioGridi120645. 35 interactions.
    IntActiQ9HB75. 12 interactions.
    MINTiMINT-1474528.

    Structurei

    Secondary structure

    1
    910
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni782 – 7843
    Helixi789 – 7979
    Helixi803 – 8097
    Helixi814 – 82310
    Turni824 – 8263
    Helixi828 – 84114
    Helixi849 – 85911
    Helixi863 – 87210

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2OF5X-ray3.20H/I/J/K/L778-883[»]
    ProteinModelPortaliQ9HB75.
    SMRiQ9HB75. Positions 39-876.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9HB75.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati126 – 14722LRR 1Add
    BLAST
    Repeati149 – 17123LRR 2Add
    BLAST
    Repeati172 – 19423LRR 3Add
    BLAST
    Repeati195 – 21622LRR 4Add
    BLAST
    Repeati218 – 24023LRR 5Add
    BLAST
    Repeati241 – 26323LRR 6Add
    BLAST
    Repeati264 – 28522LRR 7Add
    BLAST
    Domaini315 – 422108ZU5 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini423 – 45230Peptidase S68Add
    BLAST
    Domaini453 – 565113ZU5 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini788 – 87386DeathPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni580 – 716137UPA domainBy similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 1 death domain.PROSITE-ProRule annotation
    Contains 7 LRR (leucine-rich) repeats.Curated
    Contains 1 peptidase S68 domain.Curated
    Contains 2 ZU5 domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Leucine-rich repeat, Repeat

    Phylogenomic databases

    eggNOGiNOG310879.
    HOVERGENiHBG066762.
    InParanoidiQ9HB75.
    KOiK10130.
    OMAiVPHFSWF.
    OrthoDBiEOG7BP81T.
    PhylomeDBiQ9HB75.
    TreeFamiTF331183.

    Family and domain databases

    Gene3Di1.10.533.10. 1 hit.
    InterProiIPR011029. DEATH-like_dom.
    IPR000488. Death_domain.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR019502. Peptidase_S68_pidd.
    IPR000906. ZU5.
    [Graphical view]
    PfamiPF00531. Death. 1 hit.
    PF00560. LRR_1. 1 hit.
    PF13855. LRR_8. 2 hits.
    PF10461. Peptidase_S68. 1 hit.
    PF00791. ZU5. 2 hits.
    [Graphical view]
    SMARTiSM00005. DEATH. 1 hit.
    SM00369. LRR_TYP. 1 hit.
    [Graphical view]
    SUPFAMiSSF47986. SSF47986. 1 hit.
    PROSITEiPS50017. DEATH_DOMAIN. 1 hit.
    PS51450. LRR. 7 hits.
    PS51145. ZU5. 2 hits.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HB75-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAATVEGPEL EAAAAAGDAS EDSDAGSRAL PFLGGNRLSL DLYPGGCQQL    50
    LHLCVQQPLQ LLQVEFLRLS THEDPQLLEA TLAQLPQSLS CLRSLVLKGG 100
    QRRDTLGACL RGALTNLPAG LSGLAHLAHL DLSFNSLETL PACVLQMRGL 150
    GALLLSHNCL SELPEALGAL PALTFLTVTH NRLQTLPPAL GALSTLQRLD 200
    LSQNLLDTLP PEIGGLGSLL ELNLASNRLQ SLPASLAGLR SLRLLVLHSN 250
    LLASVPADLA RLPLLTRLDL RDNQLRDLPP ELLDAPFVRL QGNPLGEASP 300
    DAPSSPVAAL IPEMPRLFLT SDLDSFPVTP QGCSVTLACG VRLQFPAGAT 350
    ATPITIRYRL LLPEPGLVPL GPHDALLSHV LELQPHGVAF QQDVGLWLLF 400
    TPPQARRCRE VVVRTRNDNS WGDLETYLEE EAPQRLWAHC QVPHFSWFLV 450
    VSRPVSNACL VPPEGTLLCS SGHPGVKVIF PPGATEEPRR VSMQVVRMAG 500
    RELQALLGEP EAAVSPLLCL SQSGPPSFLQ PVTVQLPLPS GITGLSLDRS 550
    RLHLLYWAPP AATWDDITAQ VVLELTHLYA RFQVTHFSWY WLWYTTKNCV 600
    GGLARKAWER LRLHRVNLIA LQRRRDPEQV LLQCLPRNKV DATLRRLLER 650
    YRGPEPSDTV EMFEGEEFFA AFERGIDVDA DRPDCVEGRI CFVFYSHLKN 700
    VKEVYVTTTL DREAQAVRGQ VSFYRGAVPV RVPEEAEAAR QRKGADALWM 750
    ATLPIKLPRL RGSEGPRRGA GLSLAPLNLG DAETGFLTQS NLLSVAGRLG 800
    LDWPAVALHL GVSYREVQRI RHEFRDDLDE QIRHMLFSWA ERQAGQPGAV 850
    GLLVQALEQS DRQDVAEEVR AVLELGRRKY QDSIRRMGLA PKDPALPGSS 900
    APQPPEPAQA 910
    Length:910
    Mass (Da):99,712
    Last modified:October 17, 2006 - v2
    Checksum:i8C98FC64230B57F8
    GO
    Isoform 2 (identifier: Q9HB75-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         704-720: Missing.

    Show »
    Length:893
    Mass (Da):97,823
    Checksum:i426694FB8EC10235
    GO
    Isoform 3 (identifier: Q9HB75-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-146: Missing.
         579-589: Missing.

    Show »
    Length:753
    Mass (Da):82,971
    Checksum:i6BD2B00A12B574DC
    GO
    Isoform 4 (identifier: Q9HB75-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-313: Missing.

    Show »
    Length:597
    Mass (Da):66,720
    Checksum:i2572BA6345C426AA
    GO
    Isoform 5 (identifier: Q9HB75-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-313: Missing.
         589-589: W → WSVPPSFLSPPPPVCTALLTPSSPR
         759-815: RLRGSEGPRR...VALHLGVSYR → VGLRDSRGAG...GGGLASPWHP
         816-910: Missing.

    Show »
    Length:526
    Mass (Da):58,652
    Checksum:iACB01B6B05784BF1
    GO
    Isoform 6 (identifier: Q9HB75-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-492: Missing.
         589-589: W → WSVPPSFLSPPPPVCTALLTPSSPR
         704-720: Missing.
         759-815: RLRGSEGPRR...VALHLGVSYR → VGLRDSRGAG...GGGLASPWHP
         816-910: Missing.

    Show »
    Length:330
    Mass (Da):37,019
    Checksum:i1A8F34F669B0F38A
    GO
    Isoform 7 (identifier: Q9HB75-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-313: Missing.
         585-621: THFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIAL → LALVHHQELCGRPGSEGLGAAAAAPCEPHRSAAAPGP
         622-910: Missing.

    Show »
    Length:308
    Mass (Da):33,375
    Checksum:i5E814E02D2E0E4CB
    GO

    Sequence cautioni

    The sequence BAD92069.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAD92186.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAD92766.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAD38708.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti335 – 3351V → A in BAC11272. (PubMed:14702039)Curated
    Sequence conflicti421 – 4211W → L in AAP97716. 1 PublicationCurated
    Sequence conflicti492 – 4921S → F in BAC11272. (PubMed:14702039)Curated
    Sequence conflicti512 – 5121A → V in CAD38708. (PubMed:17974005)Curated
    Sequence conflicti601 – 6011G → E in CAD38708. (PubMed:17974005)Curated
    Sequence conflicti895 – 8951A → V in AAF69491. (PubMed:10825539)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti331 – 3311Q → R.7 Publications
    Corresponds to variant rs10902221 [ dbSNP | Ensembl ].
    VAR_028031

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 492492Missing in isoform 6. 1 PublicationVSP_019664Add
    BLAST
    Alternative sequencei1 – 313313Missing in isoform 4, isoform 5 and isoform 7. 4 PublicationsVSP_019665Add
    BLAST
    Alternative sequencei1 – 146146Missing in isoform 3. 1 PublicationVSP_019666Add
    BLAST
    Alternative sequencei579 – 58911Missing in isoform 3. 1 PublicationVSP_019667Add
    BLAST
    Alternative sequencei585 – 62137THFSW…NLIAL → LALVHHQELCGRPGSEGLGA AAAAPCEPHRSAAAPGP in isoform 7. 1 PublicationVSP_019668Add
    BLAST
    Alternative sequencei589 – 5891W → WSVPPSFLSPPPPVCTALLT PSSPR in isoform 5 and isoform 6. 2 PublicationsVSP_019669
    Alternative sequencei622 – 910289Missing in isoform 7. 1 PublicationVSP_019670Add
    BLAST
    Alternative sequencei704 – 72017Missing in isoform 2 and isoform 6. 2 PublicationsVSP_019671Add
    BLAST
    Alternative sequencei759 – 81557RLRGS…GVSYR → VGLRDSRGAGQDRGPGVTRV TWWSWGWSPGLNALFPSNRD FEGPRGHGGGLASPWHP in isoform 5 and isoform 6. 2 PublicationsVSP_019672Add
    BLAST
    Alternative sequencei816 – 91095Missing in isoform 5 and isoform 6. 2 PublicationsVSP_019673Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF229178 mRNA. Translation: AAF69491.1.
    AF274972 mRNA. Translation: AAG13461.1.
    AF465246 mRNA. Translation: AAP97716.1.
    AK074893 mRNA. Translation: BAC11272.1.
    AB208832 mRNA. Translation: BAD92069.1. Different initiation.
    AB208949 mRNA. Translation: BAD92186.1. Different initiation.
    AB209529 mRNA. Translation: BAD92766.1. Different initiation.
    AL833849 mRNA. Translation: CAD38708.1. Different initiation.
    BC014904 mRNA. Translation: AAH14904.1.
    CCDSiCCDS44508.1. [Q9HB75-2]
    CCDS7716.1. [Q9HB75-1]
    RefSeqiNP_665893.2. NM_145886.3. [Q9HB75-1]
    NP_665894.2. NM_145887.3. [Q9HB75-2]
    UniGeneiHs.592290.

    Genome annotation databases

    EnsembliENST00000347755; ENSP00000337797; ENSG00000177595. [Q9HB75-1]
    ENST00000411829; ENSP00000416801; ENSG00000177595. [Q9HB75-2]
    GeneIDi55367.
    KEGGihsa:55367.
    UCSCiuc001lrk.2. human. [Q9HB75-2]
    uc001lrl.1. human. [Q9HB75-3]
    uc001lrm.1. human. [Q9HB75-1]
    uc001lrp.2. human. [Q9HB75-5]

    Polymorphism databases

    DMDMi116242715.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF229178 mRNA. Translation: AAF69491.1 .
    AF274972 mRNA. Translation: AAG13461.1 .
    AF465246 mRNA. Translation: AAP97716.1 .
    AK074893 mRNA. Translation: BAC11272.1 .
    AB208832 mRNA. Translation: BAD92069.1 . Different initiation.
    AB208949 mRNA. Translation: BAD92186.1 . Different initiation.
    AB209529 mRNA. Translation: BAD92766.1 . Different initiation.
    AL833849 mRNA. Translation: CAD38708.1 . Different initiation.
    BC014904 mRNA. Translation: AAH14904.1 .
    CCDSi CCDS44508.1. [Q9HB75-2 ]
    CCDS7716.1. [Q9HB75-1 ]
    RefSeqi NP_665893.2. NM_145886.3. [Q9HB75-1 ]
    NP_665894.2. NM_145887.3. [Q9HB75-2 ]
    UniGenei Hs.592290.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2OF5 X-ray 3.20 H/I/J/K/L 778-883 [» ]
    ProteinModelPortali Q9HB75.
    SMRi Q9HB75. Positions 39-876.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120645. 35 interactions.
    IntActi Q9HB75. 12 interactions.
    MINTi MINT-1474528.

    Protein family/group databases

    MEROPSi S68.001.

    PTM databases

    PhosphoSitei Q9HB75.

    Polymorphism databases

    DMDMi 116242715.

    Proteomic databases

    PaxDbi Q9HB75.
    PRIDEi Q9HB75.

    Protocols and materials databases

    DNASUi 55367.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000347755 ; ENSP00000337797 ; ENSG00000177595 . [Q9HB75-1 ]
    ENST00000411829 ; ENSP00000416801 ; ENSG00000177595 . [Q9HB75-2 ]
    GeneIDi 55367.
    KEGGi hsa:55367.
    UCSCi uc001lrk.2. human. [Q9HB75-2 ]
    uc001lrl.1. human. [Q9HB75-3 ]
    uc001lrm.1. human. [Q9HB75-1 ]
    uc001lrp.2. human. [Q9HB75-5 ]

    Organism-specific databases

    CTDi 55367.
    GeneCardsi GC11M000799.
    H-InvDB HIX0021767.
    HGNCi HGNC:16491. PIDD1.
    HPAi CAB012647.
    HPA055473.
    MIMi 605247. gene.
    neXtProti NX_Q9HB75.
    PharmGKBi PA30445.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG310879.
    HOVERGENi HBG066762.
    InParanoidi Q9HB75.
    KOi K10130.
    OMAi VPHFSWF.
    OrthoDBi EOG7BP81T.
    PhylomeDBi Q9HB75.
    TreeFami TF331183.

    Enzyme and pathway databases

    SignaLinki Q9HB75.

    Miscellaneous databases

    ChiTaRSi PIDD. human.
    EvolutionaryTracei Q9HB75.
    GeneWikii LRDD.
    GenomeRNAii 55367.
    NextBioi 59757.
    PROi Q9HB75.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HB75.
    Bgeei Q9HB75.
    Genevestigatori Q9HB75.

    Family and domain databases

    Gene3Di 1.10.533.10. 1 hit.
    InterProi IPR011029. DEATH-like_dom.
    IPR000488. Death_domain.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR019502. Peptidase_S68_pidd.
    IPR000906. ZU5.
    [Graphical view ]
    Pfami PF00531. Death. 1 hit.
    PF00560. LRR_1. 1 hit.
    PF13855. LRR_8. 2 hits.
    PF10461. Peptidase_S68. 1 hit.
    PF00791. ZU5. 2 hits.
    [Graphical view ]
    SMARTi SM00005. DEATH. 1 hit.
    SM00369. LRR_TYP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47986. SSF47986. 1 hit.
    PROSITEi PS50017. DEATH_DOMAIN. 1 hit.
    PS51450. LRR. 7 hits.
    PS51145. ZU5. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "LRDD, a novel leucine rich repeat and death domain containing protein."
      Telliez J.-B., Bean K.M., Lin L.-L.
      Biochim. Biophys. Acta 1478:280-288(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, INTERACTION WITH FADD AND MADD, VARIANT ARG-331.
    2. "Pidd, a new death-domain-containing protein, is induced by p53 and promotes apoptosis."
      Lin Y., Ma W., Benchimol S.
      Nat. Genet. 26:122-127(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INDUCTION, VARIANT ARG-331.
    3. Zan Q., Guo J.H., Yu L.
      Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ARG-331.
      Tissue: Brain.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), VARIANT ARG-331.
    5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6), VARIANT ARG-331.
      Tissue: Brain and Spleen.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANT ARG-331.
      Tissue: Testis.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-331.
      Tissue: Uterus.
    8. Bienvenut W.V., Waridel P., Quadroni M.
      Submitted (MAR-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 2-37; 69-93; 103-111; 183-316; 343-357; 415-435; 454-497; 552-581; 598-605; 613-623; 626-637; 651-740; 743-759; 768-798 AND 826-870, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, PHOSPHORYLATION AT SER-299 AND SER-305, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Embryonic kidney.
    9. "The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress."
      Tinel A., Tschopp J.
      Science 304:843-846(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DOMAIN, INTERACTION WITH CASP2 AND CRADD.
    10. "PIDD mediates NF-kappaB activation in response to DNA damage."
      Janssens S., Tinel A., Lippens S., Tschopp J.
      Cell 123:1079-1092(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH IKBKG AND RIP1, SUBCELLULAR LOCATION.
    11. "Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage."
      Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B.
      Oncogene 25:5683-5692(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CASP2 AND CRADD.

    Entry informationi

    Entry nameiPIDD1_HUMAN
    AccessioniPrimary (citable) accession number: Q9HB75
    Secondary accession number(s): Q59FD1
    , Q59H10, Q59HC7, Q7Z4P8, Q8NC89, Q8NDL2, Q96C25, Q9NRE6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 11, 2006
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 113 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. Peptidase families
      Classification of peptidase families and list of entries
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3