Q9HB75 (PIDD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: p53-induced protein with a death domain Alternative name(s): Leucine-rich repeat and death domain-containing protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 910 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Promotes apoptosis downstream of the tumor suppressor as component of the DNA damage/stress response pathway that connects p53/TP53 to apoptosis. Associates with NEMO/IKBKG and RIP1 and enhances sumoylation and ubiquitination of NEMO/IKBKG which is important for activation of the transcription factor NF-kappa-B. Associates with CASP2/caspase-2 and CRADD/RAIDD, and induces activation of CASP2 which an important regulator in apoptotic pathways. Ref.2 Ref.9 Ref.10 |
| Subunit structure | Interacts with FADD and MAP-kinase activating death domain/MADD. Forms a complex with IKBKG and with receptor-interacting serine-threonine kinase 1/RIP1. Forms also a complex named PIDDosome with CASP2 and CRADD. Ref.1 Ref.9 Ref.10 Ref.11 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Ref.1 |
| Induction | Induced by gamma-irradiation. Ref.2 |
| Sequence similarities | Contains 1 death domain. Contains 7 LRR (leucine-rich) repeats. Contains 1 peptidase S68 domain. Contains 2 ZU5 domains. |
| Sequence caution | The sequence BAD92069.1 differs from that shown. Reason: Erroneous initiation. The sequence BAD92186.1 differs from that shown. Reason: Erroneous initiation. The sequence BAD92766.1 differs from that shown. Reason: Erroneous initiation. The sequence CAD38708.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Leucine-rich repeat Repeat |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest Inferred from mutant phenotype PubMed 21726810. Source: UniProtKB apoptotic processInferred from electronic annotation. Source: UniProtKB-KW negative regulation of apoptotic processInferred from mutant phenotype PubMed 21726810. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from mutant phenotype PubMed 21726810. Source: UniProtKB nucleusInferred from mutant phenotype PubMed 21726810. Source: UniProtKB |
| Molecular_function | death receptor binding Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CRADD | P78560 | 6 | EBI-520427,EBI-520375 | |
| MDFI | Q99750 | 3 | EBI-520427,EBI-724076 | |
| PRKDC | P78527 | 6 | EBI-520427,EBI-352053 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HB75-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HB75-2) The sequence of this isoform differs from the canonical sequence as follows: 704-720: Missing. | ||||||
| Isoform 3 (identifier: Q9HB75-3) The sequence of this isoform differs from the canonical sequence as follows: 1-146: Missing. 579-589: Missing. | ||||||
| Isoform 4 (identifier: Q9HB75-4) The sequence of this isoform differs from the canonical sequence as follows: 1-313: Missing. | ||||||
| Isoform 5 (identifier: Q9HB75-5) The sequence of this isoform differs from the canonical sequence as follows: 1-313: Missing. 589-589: W → WSVPPSFLSPPPPVCTALLTPSSPR 759-815: RLRGSEGPRR...VALHLGVSYR → VGLRDSRGAG...GGGLASPWHP 816-910: Missing. | ||||||
| Isoform 6 (identifier: Q9HB75-6) The sequence of this isoform differs from the canonical sequence as follows: 1-492: Missing. 589-589: W → WSVPPSFLSPPPPVCTALLTPSSPR 704-720: Missing. 759-815: RLRGSEGPRR...VALHLGVSYR → VGLRDSRGAG...GGGLASPWHP 816-910: Missing. | ||||||
| Isoform 7 (identifier: Q9HB75-7) The sequence of this isoform differs from the canonical sequence as follows: 1-313: Missing. 585-621: THFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIAL → LALVHHQELCGRPGSEGLGAAAAAPCEPHRSAAAPGP 622-910: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.8 | |||||||||||||||||||||
| Chain | 2 – 910 | 909 | p53-induced protein with a death domain | PRO_0000245243 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Repeat | 126 – 147 | 22 | LRR 1 | |||||||||||||||||||||
| Repeat | 149 – 171 | 23 | LRR 2 | |||||||||||||||||||||
| Repeat | 172 – 194 | 23 | LRR 3 | |||||||||||||||||||||
| Repeat | 195 – 216 | 22 | LRR 4 | |||||||||||||||||||||
| Repeat | 218 – 240 | 23 | LRR 5 | |||||||||||||||||||||
| Repeat | 241 – 263 | 23 | LRR 6 | |||||||||||||||||||||
| Repeat | 264 – 285 | 22 | LRR 7 | |||||||||||||||||||||
| Domain | 315 – 422 | 108 | ZU5 1 | |||||||||||||||||||||
| Domain | 423 – 452 | 30 | Peptidase S68 | |||||||||||||||||||||
| Domain | 453 – 565 | 113 | ZU5 2 | |||||||||||||||||||||
| Domain | 788 – 873 | 86 | Death | |||||||||||||||||||||
| Region | 580 – 716 | 137 | UPA domain By similarity | |||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.8 | |||||||||||||||||||||
| Modified residue | 299 | 1 | Phosphoserine Ref.8 | |||||||||||||||||||||
| Modified residue | 305 | 1 | Phosphoserine Ref.8 | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 1 – 492 | 492 | Missing in isoform 6. | VSP_019664 | ||||||||||||||||||||
| Alternative sequence | 1 – 313 | 313 | Missing in isoform 4, isoform 5 and isoform 7. | VSP_019665 | ||||||||||||||||||||
| Alternative sequence | 1 – 146 | 146 | Missing in isoform 3. | VSP_019666 | ||||||||||||||||||||
| Alternative sequence | 579 – 589 | 11 | Missing in isoform 3. | VSP_019667 | ||||||||||||||||||||
| Alternative sequence | 585 – 621 | 37 | THFSW…NLIAL → LALVHHQELCGRPGSEGLGA AAAAPCEPHRSAAAPGP in isoform 7. | VSP_019668 | ||||||||||||||||||||
| Alternative sequence | 589 | 1 | W → WSVPPSFLSPPPPVCTALLT PSSPR in isoform 5 and isoform 6. | VSP_019669 | ||||||||||||||||||||
| Alternative sequence | 622 – 910 | 289 | Missing in isoform 7. | VSP_019670 | ||||||||||||||||||||
| Alternative sequence | 704 – 720 | 17 | Missing in isoform 2 and isoform 6. | VSP_019671 | ||||||||||||||||||||
| Alternative sequence | 759 – 815 | 57 | RLRGS…GVSYR → VGLRDSRGAGQDRGPGVTRV TWWSWGWSPGLNALFPSNRD FEGPRGHGGGLASPWHP in isoform 5 and isoform 6. | VSP_019672 | ||||||||||||||||||||
| Alternative sequence | 816 – 910 | 95 | Missing in isoform 5 and isoform 6. | VSP_019673 | ||||||||||||||||||||
| Natural variant | 331 | 1 | Q → R. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Corresponds to variant rs10902221 [ dbSNP | Ensembl ]. | VAR_028031 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Sequence conflict | 335 | 1 | V → A in BAC11272. Ref.4 | |||||||||||||||||||||
| Sequence conflict | 421 | 1 | W → L in AAP97716. Ref.3 | |||||||||||||||||||||
| Sequence conflict | 492 | 1 | S → F in BAC11272. Ref.4 | |||||||||||||||||||||
| Sequence conflict | 512 | 1 | A → V in CAD38708. Ref.6 | |||||||||||||||||||||
| Sequence conflict | 601 | 1 | G → E in CAD38708. Ref.6 | |||||||||||||||||||||
| Sequence conflict | 895 | 1 | A → V in AAF69491. Ref.1 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Turn | 782 – 784 | 3 | ||||||||||||||||||||||
| Helix | 789 – 797 | 9 | ||||||||||||||||||||||
| Helix | 803 – 809 | 7 | ||||||||||||||||||||||
| Helix | 814 – 823 | 10 | ||||||||||||||||||||||
| Turn | 824 – 826 | 3 | ||||||||||||||||||||||
| Helix | 828 – 841 | 14 | ||||||||||||||||||||||
| Helix | 849 – 859 | 11 | ||||||||||||||||||||||
| Helix | 863 – 872 | 10 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "LRDD, a novel leucine rich repeat and death domain containing protein." Telliez J.-B., Bean K.M., Lin L.-L. Biochim. Biophys. Acta 1478:280-288(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, INTERACTION WITH FADD AND MADD, VARIANT ARG-331. |
| [2] | "Pidd, a new death-domain-containing protein, is induced by p53 and promotes apoptosis." Lin Y., Ma W., Benchimol S. Nat. Genet. 26:122-127(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INDUCTION, VARIANT ARG-331. |
| [3] | Zan Q., Guo J.H., Yu L. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ARG-331. Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), VARIANT ARG-331. |
| [5] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6), VARIANT ARG-331. Tissue: Brain and Spleen. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANT ARG-331. Tissue: Testis. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-331. Tissue: Uterus. |
| [8] | Bienvenut W.V., Waridel P., Quadroni M. Submitted (MAR-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-37; 69-93; 103-111; 183-316; 343-357; 415-435; 454-497; 552-581; 598-605; 613-623; 626-637; 651-740; 743-759; 768-798 AND 826-870, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, PHOSPHORYLATION AT SER-299 AND SER-305, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [9] | "The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress." Tinel A., Tschopp J. Science 304:843-846(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DOMAIN, INTERACTION WITH CASP2 AND CRADD. |
| [10] | "PIDD mediates NF-kappaB activation in response to DNA damage." Janssens S., Tinel A., Lippens S., Tschopp J. Cell 123:1079-1092(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH IKBKG AND RIP1, SUBCELLULAR LOCATION. |
| [11] | "Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage." Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. Oncogene 25:5683-5692(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CASP2 AND CRADD. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF229178 mRNA. Translation: AAF69491.1. AF274972 mRNA. Translation: AAG13461.1. AF465246 mRNA. Translation: AAP97716.1. AK074893 mRNA. Translation: BAC11272.1. AB208832 mRNA. Translation: BAD92069.1. Different initiation. AB208949 mRNA. Translation: BAD92186.1. Different initiation. AB209529 mRNA. Translation: BAD92766.1. Different initiation. AL833849 mRNA. Translation: CAD38708.1. Different initiation. BC014904 mRNA. Translation: AAH14904.1. | ||||||||||||
| IPI | IPI00171737. IPI00396438. IPI00555732. IPI00749289. IPI00760720. IPI00760854. IPI00761169. | ||||||||||||
| RefSeq | NP_665893.2. NM_145886.3. NP_665894.2. NM_145887.3. | ||||||||||||
| UniGene | Hs.592290. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9HB75. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9HB75. 11 interactions. | ||||||||||||
| MINT | MINT-1474528. | ||||||||||||
Protein family/group databases | |||||||||||||
| MEROPS | S68.001. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9HB75. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 116242715. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9HB75. | ||||||||||||
| PRIDE | Q9HB75. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 55367. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000347755; ENSP00000337797; ENSG00000177595. ENST00000411829; ENSP00000416801; ENSG00000177595. | ||||||||||||
| GeneID | 55367. | ||||||||||||
| KEGG | hsa:55367. | ||||||||||||
| UCSC | uc001lrk.2. human. uc001lrl.1. human. uc001lrm.1. human. uc001lrp.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 55367. | ||||||||||||
| GeneCards | GC11M000799. | ||||||||||||
| H-InvDB | HIX0021767. | ||||||||||||
| HGNC | HGNC:16491. PIDD. | ||||||||||||
| HPA | CAB012647. | ||||||||||||
| MIM | 605247. gene. | ||||||||||||
| neXtProt | NX_Q9HB75. | ||||||||||||
| PharmGKB | PA30445. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG310879. | ||||||||||||
| HOVERGEN | HBG066762. | ||||||||||||
| InParanoid | Q9HB75. | ||||||||||||
| KO | K10130. | ||||||||||||
| OMA | FVRLQGN. | ||||||||||||
| OrthoDB | EOG40K7ZC. | ||||||||||||
| PhylomeDB | Q9HB75. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9HB75. | ||||||||||||
| Bgee | Q9HB75. | ||||||||||||
| Genevestigator | Q9HB75. | ||||||||||||
| GermOnline | ENSG00000177595. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.533.10. 1 hit. | ||||||||||||
| InterPro | IPR011029. DEATH-like_dom. IPR000488. Death_domain. IPR001611. Leu-rich_rpt. IPR003591. Leu-rich_rpt_typical-subtyp. IPR019502. Peptidase_S68_pidd. IPR000906. ZU5. [Graphical view] | ||||||||||||
| Pfam | PF00531. Death. 1 hit. PF00560. LRR_1. 1 hit. PF10461. Peptidase_S68. 1 hit. PF00791. ZU5. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00005. DEATH. 1 hit. SM00369. LRR_TYP. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47986. DEATH_like. 1 hit. | ||||||||||||
| PROSITE | PS50017. DEATH_DOMAIN. 1 hit. PS51450. LRR. 7 hits. PS51145. ZU5. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | PIDD. human. | ||||||||||||
| EvolutionaryTrace | Q9HB75. | ||||||||||||
| GenomeRNAi | 55367. | ||||||||||||
| NextBio | 59757. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PIDD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HB75 Secondary accession number(s): Q59FD1 Q9NRE6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
