Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HB21

- PKHA1_HUMAN

UniProt

Q9HB21 - PKHA1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pleckstrin homology domain-containing family A member 1

Gene

PLEKHA1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Binds specifically to phosphatidylinositol 3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. May recruit other proteins to the plasma membrane.3 Publications

GO - Molecular functioni

  1. PDZ domain binding Source: UniProtKB
  2. phosphatidylinositol-3,4-bisphosphate binding Source: UniProtKB

GO - Biological processi

  1. androgen metabolic process Source: Ensembl
  2. B cell receptor signaling pathway Source: UniProtKB
  3. cellular response to hydrogen peroxide Source: UniProtKB
  4. establishment of protein localization Source: UniProtKB
  5. estrogen metabolic process Source: Ensembl
  6. face morphogenesis Source: Ensembl
  7. Leydig cell differentiation Source: Ensembl
  8. luteinization Source: Ensembl
  9. multicellular organism growth Source: Ensembl
  10. negative regulation of protein kinase B signaling Source: UniProtKB
  11. palate development Source: Ensembl
  12. phosphatidylinositol 3-kinase signaling Source: UniProtKB
  13. platelet-derived growth factor receptor signaling pathway Source: Ensembl
  14. post-embryonic development Source: Ensembl
  15. ruffle organization Source: UniProtKB
  16. skeletal system morphogenesis Source: Ensembl
  17. spermatogenesis Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family A member 1
Short name:
PH domain-containing family A member 1
Alternative name(s):
Tandem PH domain-containing protein 1
Short name:
TAPP-1
Gene namesi
Name:PLEKHA1
Synonyms:TAPP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:14335. PLEKHA1.

Subcellular locationi

Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus
Note: Locates to the plasma membrane after treatments that stimulate the production of PtdIns3,4P2.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. extracellular vesicular exosome Source: UniProt
  3. nucleus Source: HPA
  4. plasma membrane Source: UniProtKB
  5. ruffle membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi28 – 281R → L: No effect on phosphatidylinositide binding. 1 Publication
Mutagenesisi203 – 2053AVM → GGG: Abolishes phosphatidylinositide binding.
Mutagenesisi203 – 2053AVM → GLV: Binds both PtdIns3,4P2 and PtdIns3,4,5P3.
Mutagenesisi203 – 2042AV → GG: Binds both PtdIns3,4P2 and PtdIns3,4,5P3.
Mutagenesisi203 – 2031A → G: Binds both PtdIns3,4P2 and PtdIns3,4,5P3. 1 Publication
Mutagenesisi204 – 2041V → L: No effect. 1 Publication
Mutagenesisi205 – 2051M → V: No effect. 1 Publication
Mutagenesisi207 – 2071N → T: No effect. 1 Publication
Mutagenesisi211 – 2111R → L: Abolishes phosphatidylinositide binding. 1 Publication

Organism-specific databases

PharmGKBiPA33401.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 404404Pleckstrin homology domain-containing family A member 1PRO_0000053873Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei362 – 3621Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9HB21.
PaxDbiQ9HB21.
PRIDEiQ9HB21.

PTM databases

PhosphoSiteiQ9HB21.

Expressioni

Tissue specificityi

Highly expressed in skeletal muscle, thymus, pancreas, placenta and lung. Detected at low levels in brain, heart, peripheral blood leukocytes, testis, ovary, spinal cord, thyroid, kidney, liver, small intestine and colon.2 Publications

Gene expression databases

BgeeiQ9HB21.
CleanExiHS_PLEKHA1.
ExpressionAtlasiQ9HB21. baseline and differential.
GenevestigatoriQ9HB21.

Organism-specific databases

HPAiHPA002043.

Interactioni

Subunit structurei

Interacts with MPDZ and PTPN13.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
MPDZO759706EBI-2652984,EBI-821405
SH3BP4Q9P0V32EBI-2652984,EBI-1049513

Protein-protein interaction databases

BioGridi121880. 8 interactions.
IntActiQ9HB21. 5 interactions.
MINTiMINT-275100.
STRINGi9606.ENSP00000357986.

Structurei

Secondary structure

1
404
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi193 – 2019
Turni203 – 2053
Beta strandi208 – 2158
Beta strandi217 – 2259
Beta strandi232 – 2365
Helixi237 – 2393
Beta strandi242 – 2454
Helixi249 – 2524
Beta strandi255 – 2617
Beta strandi266 – 2705
Helixi274 – 29017

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1EAZX-ray1.40A182-303[»]
ProteinModelPortaliQ9HB21.
SMRiQ9HB21. Positions 1-112, 155-292.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HB21.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini7 – 112106PH 1PROSITE-ProRule annotationAdd
BLAST
Domaini191 – 28999PH 2PROSITE-ProRule annotationAdd
BLAST

Domaini

Binds to membranes enriched in PtdIns3,4P2 via the C-terminal PH domain.

Sequence similaritiesi

Contains 2 PH domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG45745.
GeneTreeiENSGT00440000037398.
HOGENOMiHOG000116175.
HOVERGENiHBG053612.
InParanoidiQ9HB21.
OrthoDBiEOG7VMP5J.
PhylomeDBiQ9HB21.
TreeFamiTF329516.

Family and domain databases

Gene3Di2.30.29.30. 2 hits.
InterProiIPR001849. PH_domain.
IPR011993. PH_like_dom.
[Graphical view]
PfamiPF00169. PH. 2 hits.
[Graphical view]
SMARTiSM00233. PH. 2 hits.
[Graphical view]
PROSITEiPS50003. PH_DOMAIN. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HB21-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPYVDRQNRI CGFLDIEENE NSGKFLRRYF ILDTREDSFV WYMDNPQNLP
60 70 80 90 100
SGSSRVGAIK LTYISKVSDA TKLRPKAEFC FVMNAGMRKY FLQANDQQDL
110 120 130 140 150
VEWVNVLNKA IKITVPKQSD SQPNSDNLSR HGECGKKQVS YRTDIVGGVP
160 170 180 190 200
IITPTQKEEV NECGESIDRN NLKRSQSHLP YFTPKPPQDS AVIKAGYCVK
210 220 230 240 250
QGAVMKNWKR RYFQLDENTI GYFKSELEKE PLRVIPLKEV HKVQECKQSD
260 270 280 290 300
IMMRDNLFEI VTTSRTFYVQ ADSPEEMHSW IKAVSGAIVA QRGPGRSASS
310 320 330 340 350
EHPPGPSESK HAFRPTNAAT ATSHSTASRS NSLVSTFTME KRGFYESLAK
360 370 380 390 400
VKPGNFKVQT VSPREPASKV TEQALLRPQS KNGPQEKDCD LVDLDDASLP

VSDV
Length:404
Mass (Da):45,553
Last modified:March 29, 2004 - v2
Checksum:i6855CD58E1A80F8A
GO
Isoform 2 (identifier: Q9HB21-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     301-404: EHPPGPSESK...DDASLPVSDV → MRQARRLSNPCIQRYTSRAGECSTYVGSHANVPS

Note: No experimental confirmation available.

Show »
Length:334
Mass (Da):38,113
Checksum:i34B9D858E2993FDE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti320 – 3201T → A.2 Publications
Corresponds to variant rs1045216 [ dbSNP | Ensembl ].
VAR_024562

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei301 – 404104EHPPG…PVSDV → MRQARRLSNPCIQRYTSRAG ECSTYVGSHANVPS in isoform 2. 1 PublicationVSP_043091Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF286160 mRNA. Translation: AAG15197.1.
AK057463 mRNA. Translation: BAG51917.1.
BX664700, BX842242 Genomic DNA. Translation: CAI23597.1.
CH471066 Genomic DNA. Translation: EAW49315.1.
CH471066 Genomic DNA. Translation: EAW49316.1.
CH471066 Genomic DNA. Translation: EAW49318.1.
CH471066 Genomic DNA. Translation: EAW49319.1.
BC001136 mRNA. Translation: AAH01136.1.
BC042458 mRNA. Translation: AAH42458.1.
CCDSiCCDS55730.1. [Q9HB21-2]
CCDS7629.1. [Q9HB21-1]
RefSeqiNP_001001974.1. NM_001001974.2. [Q9HB21-1]
NP_001182537.1. NM_001195608.1. [Q9HB21-2]
NP_067635.2. NM_021622.4. [Q9HB21-1]
XP_005270073.1. XM_005270016.1. [Q9HB21-1]
XP_005270074.1. XM_005270017.1. [Q9HB21-1]
XP_005270075.1. XM_005270018.1. [Q9HB21-1]
XP_005270078.1. XM_005270021.2. [Q9HB21-2]
UniGeneiHs.643512.
Hs.738826.

Genome annotation databases

EnsembliENST00000368988; ENSP00000357984; ENSG00000107679. [Q9HB21-2]
ENST00000368990; ENSP00000357986; ENSG00000107679. [Q9HB21-1]
ENST00000392799; ENSP00000376547; ENSG00000107679. [Q9HB21-1]
ENST00000433307; ENSP00000394416; ENSG00000107679. [Q9HB21-1]
GeneIDi59338.
KEGGihsa:59338.
UCSCiuc001lge.2. human. [Q9HB21-1]
uc001lgf.2. human. [Q9HB21-2]

Polymorphism databases

DMDMi48474647.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF286160 mRNA. Translation: AAG15197.1 .
AK057463 mRNA. Translation: BAG51917.1 .
BX664700 , BX842242 Genomic DNA. Translation: CAI23597.1 .
CH471066 Genomic DNA. Translation: EAW49315.1 .
CH471066 Genomic DNA. Translation: EAW49316.1 .
CH471066 Genomic DNA. Translation: EAW49318.1 .
CH471066 Genomic DNA. Translation: EAW49319.1 .
BC001136 mRNA. Translation: AAH01136.1 .
BC042458 mRNA. Translation: AAH42458.1 .
CCDSi CCDS55730.1. [Q9HB21-2 ]
CCDS7629.1. [Q9HB21-1 ]
RefSeqi NP_001001974.1. NM_001001974.2. [Q9HB21-1 ]
NP_001182537.1. NM_001195608.1. [Q9HB21-2 ]
NP_067635.2. NM_021622.4. [Q9HB21-1 ]
XP_005270073.1. XM_005270016.1. [Q9HB21-1 ]
XP_005270074.1. XM_005270017.1. [Q9HB21-1 ]
XP_005270075.1. XM_005270018.1. [Q9HB21-1 ]
XP_005270078.1. XM_005270021.2. [Q9HB21-2 ]
UniGenei Hs.643512.
Hs.738826.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1EAZ X-ray 1.40 A 182-303 [» ]
ProteinModelPortali Q9HB21.
SMRi Q9HB21. Positions 1-112, 155-292.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121880. 8 interactions.
IntActi Q9HB21. 5 interactions.
MINTi MINT-275100.
STRINGi 9606.ENSP00000357986.

PTM databases

PhosphoSitei Q9HB21.

Polymorphism databases

DMDMi 48474647.

Proteomic databases

MaxQBi Q9HB21.
PaxDbi Q9HB21.
PRIDEi Q9HB21.

Protocols and materials databases

DNASUi 59338.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000368988 ; ENSP00000357984 ; ENSG00000107679 . [Q9HB21-2 ]
ENST00000368990 ; ENSP00000357986 ; ENSG00000107679 . [Q9HB21-1 ]
ENST00000392799 ; ENSP00000376547 ; ENSG00000107679 . [Q9HB21-1 ]
ENST00000433307 ; ENSP00000394416 ; ENSG00000107679 . [Q9HB21-1 ]
GeneIDi 59338.
KEGGi hsa:59338.
UCSCi uc001lge.2. human. [Q9HB21-1 ]
uc001lgf.2. human. [Q9HB21-2 ]

Organism-specific databases

CTDi 59338.
GeneCardsi GC10P124124.
HGNCi HGNC:14335. PLEKHA1.
HPAi HPA002043.
MIMi 607772. gene.
neXtProti NX_Q9HB21.
PharmGKBi PA33401.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG45745.
GeneTreei ENSGT00440000037398.
HOGENOMi HOG000116175.
HOVERGENi HBG053612.
InParanoidi Q9HB21.
OrthoDBi EOG7VMP5J.
PhylomeDBi Q9HB21.
TreeFami TF329516.

Miscellaneous databases

ChiTaRSi PLEKHA1. human.
EvolutionaryTracei Q9HB21.
GeneWikii PLEKHA1.
GenomeRNAii 59338.
NextBioi 65210.
PROi Q9HB21.
SOURCEi Search...

Gene expression databases

Bgeei Q9HB21.
CleanExi HS_PLEKHA1.
ExpressionAtlasi Q9HB21. baseline and differential.
Genevestigatori Q9HB21.

Family and domain databases

Gene3Di 2.30.29.30. 2 hits.
InterProi IPR001849. PH_domain.
IPR011993. PH_like_dom.
[Graphical view ]
Pfami PF00169. PH. 2 hits.
[Graphical view ]
SMARTi SM00233. PH. 2 hits.
[Graphical view ]
PROSITEi PS50003. PH_DOMAIN. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities."
    Dowler S.J., Currie R.A., Campbell D.G., Deak M., Kular G., Downes C.P., Alessi D.R.
    Biochem. J. 351:19-31(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, MUTAGENESIS OF ARG-28 AND ARG-211, TISSUE SPECIFICITY, VARIANT ALA-320.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ALA-320.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon and Testis.
  6. "Evidence that the tandem-pleckstrin-homology-domain-containing protein TAPP1 interacts with Ptd(3,4)P2 and the multi-PDZ-domain-containing protein MUPP1 in vivo."
    Kimber W.A., Trinkle-Mulcahy L., Cheung P.C.F., Deak M., Marsden L.J., Kieloch A., Watt S., Javier R.T., Gray A., Downes C.P., Lucocq J.M., Alessi D.R.
    Biochem. J. 361:525-536(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MPDZ, SUBCELLULAR LOCATION.
  7. "TAPP1 and TAPP2 are targets of phosphatidylinositol 3-kinase signaling in B cells: sustained plasma membrane recruitment triggered by the B-cell antigen receptor."
    Marshall A.J., Krahn A.K., Ma K., Duronio V., Hou S.
    Mol. Cell. Biol. 22:5479-5491(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  8. "Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1."
    Kimber W.A., Deak M., Prescott A.R., Alessi D.R.
    Biochem. J. 376:525-535(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PTPN13, FUNCTION.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-362, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "Crystal structure of the phosphatidylinositol 3,4-bisphosphate-binding pleckstrin homology (PH) domain of tandem PH-domain-containing protein 1 (TAPP1): molecular basis of lipid specificity."
    Thomas C.C., Dowler S.J., Deak M., Alessi D.R., van Aalten D.M.F.
    Biochem. J. 358:287-294(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.4 ANGSTROMS) OF 190-292, FUNCTION, MUTAGENESIS OF ALA-203; VAL-204; MET-205 AND ASN-207.

Entry informationi

Entry nameiPKHA1_HUMAN
AccessioniPrimary (citable) accession number: Q9HB21
Secondary accession number(s): B3KQ55, D3DRE2, Q9BVK0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 29, 2004
Last modified: October 29, 2014
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3