Q9HB21 (PKHA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pleckstrin homology domain-containing family A member 1 Short name=PH domain-containing family A member 1 Alternative name(s): Tandem PH domain-containing protein 1 Short name=TAPP-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 404 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds specifically to phosphatidylinositol 3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. May recruit other proteins to the plasma membrane. Ref.1 Ref.8 Ref.12 |
| Subunit structure | |
| Subcellular location | Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus. Note: Locates to the plasma membrane after treatments that stimulate the production of PtdIns3,4P2. Ref.6 Ref.7 |
| Tissue specificity | Highly expressed in skeletal muscle, thymus, pancreas, placenta and lung. Detected at low levels in brain, heart, peripheral blood leukocytes, testis, ovary, spinal cord, thyroid, kidney, liver, small intestine and colon. Ref.1 Ref.7 |
| Domain | Binds to membranes enriched in PtdIns3,4P2 via the C-terminal PH domain. |
| Sequence similarities | Contains 2 PH domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SH3BP4 | Q9P0V3 | 2 | EBI-2652984,EBI-1049513 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HB21-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HB21-2) The sequence of this isoform differs from the canonical sequence as follows: 301-404: EHPPGPSESK...DDASLPVSDV → MRQARRLSNPCIQRYTSRAGECSTYVGSHANVPS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 404 | 404 | Pleckstrin homology domain-containing family A member 1 | PRO_0000053873 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Domain | 7 – 112 | 106 | PH 1 | |||||||||||||||||||||||||||
| Domain | 191 – 289 | 99 | PH 2 | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 362 | 1 | Phosphoserine Ref.9 | |||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 301 – 404 | 104 | EHPPG…PVSDV → MRQARRLSNPCIQRYTSRAG ECSTYVGSHANVPS in isoform 2. | VSP_043091 | ||||||||||||||||||||||||||
| Natural variant | 320 | 1 | T → A. Ref.1 Ref.4 Corresponds to variant rs1045216 [ dbSNP | Ensembl ]. | VAR_024562 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Mutagenesis | 28 | 1 | R → L: No effect on phosphatidylinositide binding. Ref.1 | |||||||||||||||||||||||||||
| Mutagenesis | 203 – 205 | 3 | AVM → GGG: Abolishes phosphatidylinositide binding. Ref.12 | |||||||||||||||||||||||||||
| Mutagenesis | 203 – 205 | 3 | AVM → GLV: Binds both PtdIns3,4P2 and PtdIns3,4,5P3. Ref.12 | |||||||||||||||||||||||||||
| Mutagenesis | 203 – 204 | 2 | AV → GG: Binds both PtdIns3,4P2 and PtdIns3,4,5P3. Ref.12 | |||||||||||||||||||||||||||
| Mutagenesis | 203 | 1 | A → G: Binds both PtdIns3,4P2 and PtdIns3,4,5P3. Ref.12 | |||||||||||||||||||||||||||
| Mutagenesis | 204 | 1 | V → L: No effect. Ref.12 | |||||||||||||||||||||||||||
| Mutagenesis | 205 | 1 | M → V: No effect. Ref.12 | |||||||||||||||||||||||||||
| Mutagenesis | 207 | 1 | N → T: No effect. Ref.12 | |||||||||||||||||||||||||||
| Mutagenesis | 211 | 1 | R → L: Abolishes phosphatidylinositide binding. Ref.1 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 193 – 201 | 9 | ||||||||||||||||||||||||||||
| Turn | 203 – 205 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 208 – 215 | 8 | ||||||||||||||||||||||||||||
| Beta strand | 217 – 225 | 9 | ||||||||||||||||||||||||||||
| Beta strand | 232 – 236 | 5 | ||||||||||||||||||||||||||||
| Helix | 237 – 239 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 242 – 245 | 4 | ||||||||||||||||||||||||||||
| Helix | 249 – 252 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 255 – 261 | 7 | ||||||||||||||||||||||||||||
| Beta strand | 266 – 270 | 5 | ||||||||||||||||||||||||||||
| Helix | 274 – 290 | 17 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities." Dowler S.J., Currie R.A., Campbell D.G., Deak M., Kular G., Downes C.P., Alessi D.R. Biochem. J. 351:19-31(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, MUTAGENESIS OF ARG-28 AND ARG-211, TISSUE SPECIFICITY, VARIANT ALA-320. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ALA-320. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon and Testis. |
| [6] | "Evidence that the tandem-pleckstrin-homology-domain-containing protein TAPP1 interacts with Ptd(3,4)P2 and the multi-PDZ-domain-containing protein MUPP1 in vivo." Kimber W.A., Trinkle-Mulcahy L., Cheung P.C.F., Deak M., Marsden L.J., Kieloch A., Watt S., Javier R.T., Gray A., Downes C.P., Lucocq J.M., Alessi D.R. Biochem. J. 361:525-536(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MPDZ, SUBCELLULAR LOCATION. |
| [7] | "TAPP1 and TAPP2 are targets of phosphatidylinositol 3-kinase signaling in B cells: sustained plasma membrane recruitment triggered by the B-cell antigen receptor." Marshall A.J., Krahn A.K., Ma K., Duronio V., Hou S. Mol. Cell. Biol. 22:5479-5491(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [8] | "Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1." Kimber W.A., Deak M., Prescott A.R., Alessi D.R. Biochem. J. 376:525-535(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PTPN13, FUNCTION. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-362, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [11] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "Crystal structure of the phosphatidylinositol 3,4-bisphosphate-binding pleckstrin homology (PH) domain of tandem PH-domain-containing protein 1 (TAPP1): molecular basis of lipid specificity." Thomas C.C., Dowler S.J., Deak M., Alessi D.R., van Aalten D.M.F. Biochem. J. 358:287-294(2001) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.4 ANGSTROMS) OF 190-292, FUNCTION, MUTAGENESIS OF ALA-203; VAL-204; MET-205 AND ASN-207. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF286160 mRNA. Translation: AAG15197.1. AK057463 mRNA. Translation: BAG51917.1. BX664700, BX842242 Genomic DNA. Translation: CAI23597.1. CH471066 Genomic DNA. Translation: EAW49315.1. CH471066 Genomic DNA. Translation: EAW49316.1. CH471066 Genomic DNA. Translation: EAW49318.1. CH471066 Genomic DNA. Translation: EAW49319.1. BC001136 mRNA. Translation: AAH01136.1. BC042458 mRNA. Translation: AAH42458.1. | ||||||||||||
| IPI | IPI00306354. IPI00646101. | ||||||||||||
| RefSeq | NP_001001974.1. NM_001001974.2. NP_001182537.1. NM_001195608.1. NP_067635.2. NM_021622.4. | ||||||||||||
| UniGene | Hs.643512. Hs.738826. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9HB21. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9HB21. 3 interactions. | ||||||||||||
| MINT | MINT-275100. | ||||||||||||
| STRING | 9606.ENSP00000357986. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9HB21. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 48474647. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9HB21. | ||||||||||||
| PRIDE | Q9HB21. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 59338. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000368990; ENSP00000357986; ENSG00000107679. ENST00000409427; ENSP00000386800; ENSG00000107679. ENST00000433307; ENSP00000394416; ENSG00000107679. ENST00000538022; ENSP00000438608; ENSG00000107679. | ||||||||||||
| GeneID | 59338. | ||||||||||||
| KEGG | hsa:59338. | ||||||||||||
| UCSC | uc001lge.2. human. uc001lgf.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 59338. | ||||||||||||
| GeneCards | GC10P124124. | ||||||||||||
| HGNC | HGNC:14335. PLEKHA1. | ||||||||||||
| HPA | HPA002043. | ||||||||||||
| MIM | 607772. gene. | ||||||||||||
| neXtProt | NX_Q9HB21. | ||||||||||||
| PharmGKB | PA33401. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG45745. | ||||||||||||
| HOGENOM | HOG000116175. | ||||||||||||
| HOVERGEN | HBG053612. | ||||||||||||
| InParanoid | Q9HB21. | ||||||||||||
| OMA | NPCIQRS. | ||||||||||||
| OrthoDB | EOG4MPHQF. | ||||||||||||
| PhylomeDB | Q9HB21. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | pi3kcipathway. Class I PI3K signaling events. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9HB21. | ||||||||||||
| Bgee | Q9HB21. | ||||||||||||
| CleanEx | HS_PLEKHA1. | ||||||||||||
| Genevestigator | Q9HB21. | ||||||||||||
| GermOnline | ENSG00000107679. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.30.29.30. 2 hits. | ||||||||||||
| InterPro | IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. [Graphical view] | ||||||||||||
| Pfam | PF00169. PH. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00233. PH. 2 hits. [Graphical view] | ||||||||||||
| PROSITE | PS50003. PH_DOMAIN. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | PLEKHA1. human. | ||||||||||||
| EvolutionaryTrace | Q9HB21. | ||||||||||||
| GenomeRNAi | 59338. | ||||||||||||
| NextBio | 65210. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PKHA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HB21 Secondary accession number(s): B3KQ55, D3DRE2, Q9BVK0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
