Q9HAW4 (CLSPN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Claspin Short name=hClaspin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1339 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for checkpoint mediated cell cycle arrest in response to inhibition of DNA replication or to DNA damage induced by both ionizing and UV irradiation. Adapter protein which binds to BRCA1 and the checkpoint kinase CHEK1 and facilitates the ATR-dependent phosphorylation of both proteins. Can also bind specifically to branched DNA structures and may associate with S-phase chromatin following formation of the pre-replication complex (pre-RC). This may indicate a role for this protein as a sensor which monitors the integrity of DNA replication forks. Ref.4 Ref.5 Ref.6 Ref.7 Ref.8 |
| Subunit structure | Interacts (phosphorylation-dependent) with CHEK1; regulates CLSPN function in checkpoint for DNA damage and replication. Interacts with ATR and RAD9A and these interactions are slightly reduced during checkpoint activation. Interacts with BRCA1 and this interaction increases during checkpoint activation. Interacts with TIMELESS. Ref.4 Ref.7 Ref.8 Ref.11 Ref.12 Ref.14 |
| Subcellular location | |
| Induction | Expression peaks at S/G2 phases of the cell cycle. Ref.4 |
| Domain | The C-terminus of the protein contains 3 potential CHEK1-binding motifs (CKB motifs). Potential phosphorylation sites within CKB motif 1 and CKB motif 2 are required for interaction with CHEK1. |
| Post-translational modification | Phosphorylated. Undergoes ATR-dependent phosphorylation by CHEK1 during activation of DNA replication or damage checkpoints. Phosphorylation by CSNK1G1/CK1 promotes CHEK1 binding. Ref.4 Ref.7 Ref.11 Ref.20 Ubiquitinated by the anaphase promoting complex/cyclosome (APC/C) during G1 phase, leading to its degradation by the proteasome. Ubiquitination is mediated via its interaction with FZR1/CDH1. Following DNA damage, it is deubiquitinated by USP28 in G2 phase, preventing its degradation. Ref.9 Ref.14 |
| Sequence similarities | Belongs to the claspin family. |
| Sequence caution | The sequence AAH38991.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence AAH62215.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CHEK1 | O14757 | 5 | EBI-1369377,EBI-974488 | |
| FZR1 | Q9UM11 | 4 | EBI-1369377,EBI-724997 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HAW4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HAW4-2) The sequence of this isoform differs from the canonical sequence as follows: 527-590: Missing. | ||||||
| Isoform 3 (identifier: Q9HAW4-3) The sequence of this isoform differs from the canonical sequence as follows: 1304-1339: VKKRGPSFMTSPSPKHLKTDDSTSGLTRSIFKYLES → KIPEKDSDWLTWSGAPIPGFFRLSFDPHG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1339 | 1339 | Claspin | PRO_0000089875 | |||||
Regions | |||||||||
| Repeat | 910 – 919 | 10 | CKB motif 1 | ||||||
| Repeat | 939 – 948 | 10 | CKB motif 2 | ||||||
| Repeat | 976 – 985 | 10 | CKB motif 3 | ||||||
| Coiled coil | 162 – 196 | 35 | Potential | ||||||
| Coiled coil | 592 – 681 | 90 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 65 | 1 | Phosphoserine Ref.15 Ref.18 Ref.21 | ||||||
| Modified residue | 67 | 1 | Phosphoserine Ref.15 Ref.18 Ref.21 | ||||||
| Modified residue | 83 | 1 | Phosphoserine Ref.21 | ||||||
| Modified residue | 225 | 1 | Phosphoserine Ref.15 Ref.18 Ref.21 | ||||||
| Modified residue | 718 | 1 | Phosphoserine Ref.18 | ||||||
| Modified residue | 720 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 723 | 1 | Phosphoserine Ref.18 | ||||||
| Modified residue | 808 | 1 | Phosphoserine Ref.15 Ref.18 | ||||||
| Modified residue | 810 | 1 | Phosphoserine Ref.15 Ref.18 | ||||||
| Modified residue | 833 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 839 | 1 | Phosphoserine Ref.16 | ||||||
| Modified residue | 846 | 1 | Phosphoserine Ref.15 Ref.16 | ||||||
| Modified residue | 891 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 916 | 1 | Phosphothreonine; by CHEK1 Ref.11 | ||||||
| Modified residue | 1012 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 1018 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 1020 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 1156 | 1 | Phosphoserine Ref.15 Ref.16 | ||||||
| Modified residue | 1289 | 1 | Phosphoserine Ref.15 Ref.16 Ref.18 | ||||||
Natural variations | |||||||||
| Alternative sequence | 527 – 590 | 64 | Missing in isoform 2. | VSP_036033 | |||||
| Alternative sequence | 1304 – 1339 | 36 | VKKRG…KYLES → KIPEKDSDWLTWSGAPIPGF FRLSFDPHG in isoform 3. | VSP_036034 | |||||
| Natural variant | 439 | 1 | H → R in a breast cancer sample; somatic mutation. Ref.22 | VAR_035674 | |||||
| Natural variant | 525 | 1 | N → S. Corresponds to variant rs7537203 [ dbSNP | Ensembl ]. | VAR_023439 | |||||
| Natural variant | 892 | 1 | P → T. Corresponds to variant rs34390044 [ dbSNP | Ensembl ]. | VAR_050867 | |||||
| Natural variant | 1280 | 1 | S → L. Corresponds to variant rs35490896 [ dbSNP | Ensembl ]. | VAR_050868 | |||||
Experimental info | |||||||||
| Mutagenesis | 916 | 1 | T → A: Impairs interaction with CHEK1. Ref.8 | ||||||
| Mutagenesis | 945 | 1 | S → A: Impairs interaction with CHEK1. Ref.8 | ||||||
| Mutagenesis | 982 | 1 | S → A: No effect on interaction with CHEK1. Ref.8 | ||||||
| Sequence conflict | 34 | 1 | S → G in AAI15026. Ref.3 | ||||||
| Sequence conflict | 446 | 1 | G → E in AAI15026. Ref.3 | ||||||
| Sequence conflict | 628 | 1 | F → S in AAG24515. Ref.1 | ||||||
| Sequence conflict | 664 | 1 | E → G in AAG24515. Ref.1 | ||||||
| Sequence conflict | 738 | 1 | F → S in AAG24515. Ref.1 | ||||||
| Sequence conflict | 931 – 933 | 3 | SDK → GDE in AAI15026. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Claspin, a novel protein required for the activation of Chk1 during a DNA replication checkpoint response in Xenopus egg extracts." Kumagai A., Dunphy W.G. Mol. Cell 6:839-849(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Skin. |
| [4] | "Human claspin is required for replication checkpoint control." Chini C.C.S., Chen J. J. Biol. Chem. 278:30057-30062(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CHEK1; ATR AND RAD9A, SUBCELLULAR LOCATION, INDUCTION, PHOSPHORYLATION. |
| [5] | "ATR, claspin and the Rad9-Rad1-Hus1 complex regulate Chk1 and Cdc25A in the absence of DNA damage." Sorensen C.S., Syljuasen R.G., Lukas J., Bartek J. Cell Cycle 3:941-945(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [6] | "Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures." Sar F., Lindsey-Boltz L.A., Subramanian D., Croteau D.L., Hutsell S.Q., Griffith J.D., Sancar A. J. Biol. Chem. 279:39289-39295(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "Human claspin works with BRCA1 to both positively and negatively regulate cell proliferation." Lin S.-Y., Li K., Stewart G.S., Elledge S.J. Proc. Natl. Acad. Sci. U.S.A. 101:6484-6489(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH BRCA1, PHOSPHORYLATION BY ATR. |
| [8] | "DNA-dependent phosphorylation of Chk1 and claspin in a human cell-free system." Clarke C.A.L., Clarke P.R. Biochem. J. 388:705-712(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CHEK1, MUTAGENESIS OF THR-916; SER-945 AND SER-982. |
| [9] | "A role for the deubiquitinating enzyme USP28 in control of the DNA-damage response." Zhang D., Zaugg K., Mak T.W., Elledge S.J. Cell 126:529-542(2006) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION, DEUBIQUITINATION BY USP28. |
| [10] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [11] | "Repeated phosphopeptide motifs in human Claspin are phosphorylated by Chk1 and mediate Claspin function." Chini C.C., Chen J. J. Biol. Chem. 281:33276-33282(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-916 BY CHEK1, INTERACTION WITH CHEK1. |
| [12] | "Mammalian TIMELESS and Tipin are evolutionarily conserved replication fork-associated factors." Gotter A.L., Suppa C., Emanuel B.S. J. Mol. Biol. 366:36-52(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TIMELESS. |
| [13] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-833, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [14] | "The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint." Bassermann F., Frescas D., Guardavaccaro D., Busino L., Peschiaroli A., Pagano M. Cell 134:256-267(2008) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY THE APC/C COMPLEX, DEUBIQUITINATION BY USP28, INTERACTION WITH FZR1. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-67; SER-225; SER-720; SER-808; SER-810; SER-846; SER-1012; SER-1018; SER-1020; SER-1156 AND SER-1289, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-839; SER-846; SER-1156 AND SER-1289, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [17] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-891, MASS SPECTROMETRY. |
| [18] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-67; SER-225; SER-718; SER-723; SER-808; SER-810 AND SER-1289, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [19] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [20] | "Role for casein kinase 1 in the phosphorylation of Claspin on critical residues necessary for the activation of Chk1." Meng Z., Capalbo L., Glover D.M., Dunphy W.G. Mol. Biol. Cell 22:2834-2847(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY CSNK1G1/CK1. |
| [21] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-67; SER-83 AND SER-225, MASS SPECTROMETRY. |
| [22] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-439. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF297866 mRNA. Translation: AAG24515.1. AL354864 Genomic DNA. Translation: CAH73807.2. BC038991 mRNA. Translation: AAH38991.1. Sequence problems. BC062215 mRNA. Translation: AAH62215.1. Sequence problems. BC113116 mRNA. Translation: AAI13117.1. BC115025 mRNA. Translation: AAI15026.1. BC137279 mRNA. Translation: AAI37280.1. BC140789 mRNA. Translation: AAI40790.1. |
| IPI | IPI00186968. IPI00748041. IPI00879588. |
| RefSeq | NP_001177410.1. NM_001190481.1. NP_071394.2. NM_022111.3. |
| UniGene | Hs.175613. |
3D structure databases | |
| ProteinModelPortal | Q9HAW4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9HAW4. 2 interactions. |
| STRING | 9606.ENSP00000312995. |
PTM databases | |
| PhosphoSite | Q9HAW4. |
Polymorphism databases | |
| DMDM | 218512100. |
Proteomic databases | |
| PaxDb | Q9HAW4. |
| PRIDE | Q9HAW4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000251195; ENSP00000251195; ENSG00000092853. ENST00000318121; ENSP00000312995; ENSG00000092853. ENST00000373220; ENSP00000362317; ENSG00000092853. |
| GeneID | 63967. |
| KEGG | hsa:63967. |
| UCSC | uc001bzi.3. human. uc009vux.3. human. |
Organism-specific databases | |
| CTD | 63967. |
| GeneCards | GC01M036185. |
| HGNC | HGNC:19715. CLSPN. |
| MIM | 605434. gene. |
| neXtProt | NX_Q9HAW4. |
| PharmGKB | PA134920757. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG314362. |
| HOVERGEN | HBG080104. |
| OMA | KKLHSET. |
| PhylomeDB | Q9HAW4. |
Enzyme and pathway databases | |
| Reactome | REACT_115566. Cell Cycle. REACT_578. Apoptosis. |
Gene expression databases | |
| ArrayExpress | Q9HAW4. |
| Bgee | Q9HAW4. |
| CleanEx | HS_CLSPN. |
| Genevestigator | Q9HAW4. |
| GermOnline | ENSG00000092853. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR024147. Claspin. IPR024146. Claspin/Claspin-like. [Graphical view] |
| PANTHER | PTHR14396. PTHR14396. 1 hit. PTHR14396:SF4. PTHR14396:SF4. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 63967. |
| NextBio | 65748. |
| PMAP-CutDB | Q2KHM3. |
| SOURCE | Search... |
Entry information
| Entry name | CLSPN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HAW4 Secondary accession number(s): A6NFL4 Q8IWI1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
