Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Claspin

Gene

CLSPN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for checkpoint mediated cell cycle arrest in response to inhibition of DNA replication or to DNA damage induced by both ionizing and UV irradiation. Adapter protein which binds to BRCA1 and the checkpoint kinase CHEK1 and facilitates the ATR-dependent phosphorylation of both proteins. Can also bind specifically to branched DNA structures and may associate with S-phase chromatin following formation of the pre-replication complex (pre-RC). This may indicate a role for this protein as a sensor which monitors the integrity of DNA replication forks.5 Publications

GO - Molecular functioni

  • anaphase-promoting complex binding Source: UniProtKB
  • DNA binding Source: UniProtKB-KW

GO - Biological processi

  • activation of protein kinase activity Source: UniProtKB
  • cellular component disassembly involved in execution phase of apoptosis Source: Reactome
  • DNA damage checkpoint Source: UniProtKB
  • DNA repair Source: UniProtKB-KW
  • DNA replication Source: Reactome
  • G2 DNA damage checkpoint Source: UniProtKB
  • mitotic DNA replication checkpoint Source: UniProtKB
  • peptidyl-serine phosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, DNA damage, DNA repair

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000092853-MONOMER.
ReactomeiR-HSA-111465. Apoptotic cleavage of cellular proteins.
R-HSA-176187. Activation of ATR in response to replication stress.
R-HSA-5689880. Ub-specific processing proteases.
R-HSA-5693607. Processing of DNA double-strand break ends.
SIGNORiQ9HAW4.

Names & Taxonomyi

Protein namesi
Recommended name:
Claspin
Short name:
hClaspin
Gene namesi
Name:CLSPN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:19715. CLSPN.

Subcellular locationi

  • Nucleus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi916T → A: Impairs interaction with CHEK1. 1 Publication1
Mutagenesisi945S → A: Impairs interaction with CHEK1. 1 Publication1
Mutagenesisi982S → A: No effect on interaction with CHEK1. 1 Publication1

Organism-specific databases

DisGeNETi63967.
OpenTargetsiENSG00000092853.
PharmGKBiPA134920757.

Polymorphism and mutation databases

BioMutaiCLSPN.
DMDMi218512100.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000898751 – 1339ClaspinAdd BLAST1339

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei26PhosphoserineBy similarity1
Modified residuei42PhosphoserineBy similarity1
Modified residuei46PhosphoserineBy similarity1
Modified residuei53PhosphoserineBy similarity1
Modified residuei65PhosphoserineCombined sources1
Modified residuei67PhosphoserineCombined sources1
Modified residuei83PhosphoserineCombined sources1
Modified residuei110PhosphoserineBy similarity1
Modified residuei113PhosphoserineBy similarity1
Modified residuei225PhosphoserineCombined sources1
Modified residuei260PhosphoserineCombined sources1
Modified residuei516PhosphoserineCombined sources1
Modified residuei718PhosphoserineCombined sources1
Modified residuei720PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei731PhosphoserineCombined sources1
Modified residuei744PhosphoserineCombined sources1
Modified residuei762PhosphoserineCombined sources1
Modified residuei808PhosphoserineCombined sources1
Modified residuei810PhosphoserineCombined sources1
Modified residuei833PhosphoserineCombined sources1
Modified residuei839PhosphoserineCombined sources1
Modified residuei846PhosphoserineCombined sources1
Modified residuei891N6-acetyllysineCombined sources1
Modified residuei916Phosphothreonine; by CHEK11 Publication1
Modified residuei950PhosphoserineCombined sources1
Modified residuei954PhosphoserineCombined sources1
Modified residuei958PhosphoserineCombined sources1
Modified residuei1012PhosphoserineCombined sources1
Modified residuei1018PhosphoserineCombined sources1
Modified residuei1020PhosphoserineCombined sources1
Modified residuei1156PhosphoserineCombined sources1
Modified residuei1289PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated. Undergoes ATR-dependent phosphorylation by CHEK1 during activation of DNA replication or damage checkpoints. Phosphorylation by CSNK1G1/CK1 promotes CHEK1 binding.4 Publications
Ubiquitinated by the anaphase promoting complex/cyclosome (APC/C) during G1 phase, leading to its degradation by the proteasome. Ubiquitination is mediated via its interaction with FZR1/CDH1. Following DNA damage, it is deubiquitinated by USP28 in G2 phase, preventing its degradation.2 Publications

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9HAW4.
MaxQBiQ9HAW4.
PaxDbiQ9HAW4.
PeptideAtlasiQ9HAW4.
PRIDEiQ9HAW4.

PTM databases

iPTMnetiQ9HAW4.
PhosphoSitePlusiQ9HAW4.

Miscellaneous databases

PMAP-CutDBQ2KHM3.

Expressioni

Inductioni

Expression peaks at S/G2 phases of the cell cycle.1 Publication

Gene expression databases

BgeeiENSG00000092853.
CleanExiHS_CLSPN.
ExpressionAtlasiQ9HAW4. baseline and differential.
GenevisibleiQ9HAW4. HS.

Organism-specific databases

HPAiHPA065278.

Interactioni

Subunit structurei

Interacts (phosphorylation-dependent) with CHEK1; regulates CLSPN function in checkpoint for DNA damage and replication. Interacts with ATR and RAD9A and these interactions are slightly reduced during checkpoint activation. Interacts with BRCA1 and this interaction increases during checkpoint activation. Interacts with TIMELESS.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CDC45O754194EBI-1369377,EBI-374969
CDK9P507503EBI-1369377,EBI-1383449
CHEK1O147575EBI-1369377,EBI-974488
FZR1Q9UM114EBI-1369377,EBI-724997

GO - Molecular functioni

  • anaphase-promoting complex binding Source: UniProtKB

Protein-protein interaction databases

BioGridi122015. 35 interactors.
IntActiQ9HAW4. 21 interactors.
MINTiMINT-7897460.
STRINGi9606.ENSP00000312995.

Structurei

3D structure databases

ProteinModelPortaliQ9HAW4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati910 – 919CKB motif 110
Repeati939 – 948CKB motif 210
Repeati976 – 985CKB motif 310

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili162 – 196Sequence analysisAdd BLAST35
Coiled coili592 – 681Sequence analysisAdd BLAST90

Domaini

The C-terminus of the protein contains 3 potential CHEK1-binding motifs (CKB motifs). Potential phosphorylation sites within CKB motif 1 and CKB motif 2 are required for interaction with CHEK1.

Sequence similaritiesi

Belongs to the claspin family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG4156. Eukaryota.
ENOG410Y041. LUCA.
GeneTreeiENSGT00390000012738.
HOVERGENiHBG080104.
InParanoidiQ9HAW4.
OMAiIRAAMKN.
OrthoDBiEOG091G0CRX.
PhylomeDBiQ9HAW4.
TreeFamiTF328925.

Family and domain databases

InterProiIPR024146. Claspin.
[Graphical view]
PANTHERiPTHR14396. PTHR14396. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HAW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGEVGSEVH LEINDPNVIS QEEADSPSDS GQGSYETIGP LSEGDSDEEI
60 70 80 90 100
FVSKKLKNRK VLQDSDSETE DTNASPEKTT YDSAEEENKE NLYAGKNTKI
110 120 130 140 150
KRIYKTVADS DESYMEKSLY QENLEAQVKP CLELSLQSGN STDFTTDRKS
160 170 180 190 200
SKKHIHDKEG TAGKAKVKSK RRLEKEERKM EKIRQLKKKE TKNQEDDVEQ
210 220 230 240 250
PFNDSGCLLV DKDLFETGLE DENNSPLEDE ESLESIRAAV KNKVKKHKKK
260 270 280 290 300
EPSLESGVHS FEEGSELSKG TTRKERKAAR LSKEALKQLH SETQRLIRES
310 320 330 340 350
ALNLPYHMPE NKTIHDFFKR KPRPTCHGNA MALLKSSKYQ SSHHKEIIDT
360 370 380 390 400
ANTTEMNSDH HSKGSEQTTG AENEVETNAL PVVSKETQII TGSDESCRKD
410 420 430 440 450
LVKNEELEIQ EKQKQSDIRP SPGDSSVLQQ ESNFLGNNHS EECQVGGLVA
460 470 480 490 500
FEPHALEGEG PQNPEETDEK VEEPEQQNKS SAVGPPEKVR RFTLDRLKQL
510 520 530 540 550
GVDVSIKPRL GADEDSFVIL EPETNRELEA LKQRFWKHAN PAAKPRAGQT
560 570 580 590 600
VNVNVIVKDM GTDGKEELKA DVVPVTLAPK KLDGASHTKP GEKLQVLKAK
610 620 630 640 650
LQEAMKLRRF EERQKRQALF KLDNEDGFEE EEEEEEEMTD ESEEDGEEKV
660 670 680 690 700
EKEEKEEELE EEEEKEEEEE EEGNQETAEF LLSSEEIETK DEKEMDKENN
710 720 730 740 750
DGSSEIGKAV GFLSVPKSLS SDSTLLLFKD SSSKMGYFPT EEKSETDENS
760 770 780 790 800
GKQPSKLDED DSCSLLTKES SHNSSFELIG STIPSYQPCN RQTGRGTSFF
810 820 830 840 850
PTAGGFRSPS PGLFRASLVS SASKSSGKLS EPSLPIEDSQ DLYNASPEPK
860 870 880 890 900
TLFLGAGDFQ FCLEDDTQSQ LLDADGFLNV RNHRNQYQAL KPRLPLASMD
910 920 930 940 950
ENAMDANMDE LLDLCTGKFT SQAEKHLPRK SDKKENMEEL LNLCSGKFTS
960 970 980 990 1000
QDASTPASSE LNKQEKESSM GDPMEEALAL CSGSFPTDKE EEDEEEEFGD
1010 1020 1030 1040 1050
FRLVSNDNEF DSDEDEHSDS GNDLALEDHE DDDEEELLKR SEKLKRQMRL
1060 1070 1080 1090 1100
RKYLEDEAEV SGSDVGSEDE YDGEEIDEYE EDVIDEVLPS DEELQSQIKK
1110 1120 1130 1140 1150
IHMKTMLDDD KRQLRLYQER YLADGDLHSD GPGRMRKFRW KNIDDASQMD
1160 1170 1180 1190 1200
LFHRDSDDDQ TEEQLDESEA RWRKERIERE QWLRDMAQQG KITAEEEEEI
1210 1220 1230 1240 1250
GEDSQFMILA KKVTAKALQK NASRPMVIQE SKSLLRNPFE AIRPGSAQQV
1260 1270 1280 1290 1300
KTGSLLNQPK AVLQKLAALS DHNPSAPRNS RNFVFHTLSP VKAEAAKESS
1310 1320 1330
KSQVKKRGPS FMTSPSPKHL KTDDSTSGLT RSIFKYLES
Length:1,339
Mass (Da):151,094
Last modified:December 16, 2008 - v3
Checksum:i3F3E392D5915955F
GO
Isoform 2 (identifier: Q9HAW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-590: Missing.

Show »
Length:1,275
Mass (Da):144,167
Checksum:i5F02FE258D856D5C
GO
Isoform 3 (identifier: Q9HAW4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1304-1339: VKKRGPSFMTSPSPKHLKTDDSTSGLTRSIFKYLES → KIPEKDSDWLTWSGAPIPGFFRLSFDPHG

Show »
Length:1,332
Mass (Da):150,368
Checksum:i6FF64D7891BB7484
GO

Sequence cautioni

The sequence AAH38991 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH62215 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti34S → G in AAI15026 (PubMed:15489334).Curated1
Sequence conflicti446G → E in AAI15026 (PubMed:15489334).Curated1
Sequence conflicti628F → S in AAG24515 (PubMed:11090622).Curated1
Sequence conflicti664E → G in AAG24515 (PubMed:11090622).Curated1
Sequence conflicti738F → S in AAG24515 (PubMed:11090622).Curated1
Sequence conflicti931 – 933SDK → GDE in AAI15026 (PubMed:15489334).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035674439H → R in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_023439525N → S.Corresponds to variant rs7537203dbSNPEnsembl.1
Natural variantiVAR_050867892P → T.Corresponds to variant rs34390044dbSNPEnsembl.1
Natural variantiVAR_0508681280S → L.Corresponds to variant rs35490896dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_036033527 – 590Missing in isoform 2. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_0360341304 – 1339VKKRG…KYLES → KIPEKDSDWLTWSGAPIPGF FRLSFDPHG in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF297866 mRNA. Translation: AAG24515.1.
AL354864 Genomic DNA. Translation: CAH73807.2.
BC038991 mRNA. Translation: AAH38991.1. Sequence problems.
BC062215 mRNA. Translation: AAH62215.1. Sequence problems.
BC113116 mRNA. Translation: AAI13117.1.
BC115025 mRNA. Translation: AAI15026.1.
BC137279 mRNA. Translation: AAI37280.1.
BC140789 mRNA. Translation: AAI40790.1.
CCDSiCCDS396.1. [Q9HAW4-1]
CCDS53297.1. [Q9HAW4-2]
CCDS81299.1. [Q9HAW4-3]
RefSeqiNP_001177410.1. NM_001190481.1. [Q9HAW4-2]
NP_001317419.1. NM_001330490.1.
NP_071394.2. NM_022111.3. [Q9HAW4-1]
UniGeneiHs.175613.

Genome annotation databases

EnsembliENST00000251195; ENSP00000251195; ENSG00000092853. [Q9HAW4-3]
ENST00000318121; ENSP00000312995; ENSG00000092853. [Q9HAW4-1]
ENST00000373220; ENSP00000362317; ENSG00000092853. [Q9HAW4-2]
GeneIDi63967.
KEGGihsa:63967.
UCSCiuc001bzi.4. human. [Q9HAW4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF297866 mRNA. Translation: AAG24515.1.
AL354864 Genomic DNA. Translation: CAH73807.2.
BC038991 mRNA. Translation: AAH38991.1. Sequence problems.
BC062215 mRNA. Translation: AAH62215.1. Sequence problems.
BC113116 mRNA. Translation: AAI13117.1.
BC115025 mRNA. Translation: AAI15026.1.
BC137279 mRNA. Translation: AAI37280.1.
BC140789 mRNA. Translation: AAI40790.1.
CCDSiCCDS396.1. [Q9HAW4-1]
CCDS53297.1. [Q9HAW4-2]
CCDS81299.1. [Q9HAW4-3]
RefSeqiNP_001177410.1. NM_001190481.1. [Q9HAW4-2]
NP_001317419.1. NM_001330490.1.
NP_071394.2. NM_022111.3. [Q9HAW4-1]
UniGeneiHs.175613.

3D structure databases

ProteinModelPortaliQ9HAW4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122015. 35 interactors.
IntActiQ9HAW4. 21 interactors.
MINTiMINT-7897460.
STRINGi9606.ENSP00000312995.

PTM databases

iPTMnetiQ9HAW4.
PhosphoSitePlusiQ9HAW4.

Polymorphism and mutation databases

BioMutaiCLSPN.
DMDMi218512100.

Proteomic databases

EPDiQ9HAW4.
MaxQBiQ9HAW4.
PaxDbiQ9HAW4.
PeptideAtlasiQ9HAW4.
PRIDEiQ9HAW4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251195; ENSP00000251195; ENSG00000092853. [Q9HAW4-3]
ENST00000318121; ENSP00000312995; ENSG00000092853. [Q9HAW4-1]
ENST00000373220; ENSP00000362317; ENSG00000092853. [Q9HAW4-2]
GeneIDi63967.
KEGGihsa:63967.
UCSCiuc001bzi.4. human. [Q9HAW4-1]

Organism-specific databases

CTDi63967.
DisGeNETi63967.
GeneCardsiCLSPN.
HGNCiHGNC:19715. CLSPN.
HPAiHPA065278.
MIMi605434. gene.
neXtProtiNX_Q9HAW4.
OpenTargetsiENSG00000092853.
PharmGKBiPA134920757.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4156. Eukaryota.
ENOG410Y041. LUCA.
GeneTreeiENSGT00390000012738.
HOVERGENiHBG080104.
InParanoidiQ9HAW4.
OMAiIRAAMKN.
OrthoDBiEOG091G0CRX.
PhylomeDBiQ9HAW4.
TreeFamiTF328925.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000092853-MONOMER.
ReactomeiR-HSA-111465. Apoptotic cleavage of cellular proteins.
R-HSA-176187. Activation of ATR in response to replication stress.
R-HSA-5689880. Ub-specific processing proteases.
R-HSA-5693607. Processing of DNA double-strand break ends.
SIGNORiQ9HAW4.

Miscellaneous databases

ChiTaRSiCLSPN. human.
GeneWikiiCLSPN.
GenomeRNAii63967.
PMAP-CutDBQ2KHM3.
PROiQ9HAW4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000092853.
CleanExiHS_CLSPN.
ExpressionAtlasiQ9HAW4. baseline and differential.
GenevisibleiQ9HAW4. HS.

Family and domain databases

InterProiIPR024146. Claspin.
[Graphical view]
PANTHERiPTHR14396. PTHR14396. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiCLSPN_HUMAN
AccessioniPrimary (citable) accession number: Q9HAW4
Secondary accession number(s): A6NFL4
, Q1RMC6, Q2KHM3, Q5VYG0, Q6P6H5, Q8IWI1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: December 16, 2008
Last modified: November 30, 2016
This is version 129 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.