Q9HAU0 (PKHA5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pleckstrin homology domain-containing family A member 5 Short name=PH domain-containing family A member 5 Alternative name(s): Phosphoinositol 3-phosphate-binding protein 2 Short name=PEPP-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1116 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Tissue specificity | Highly expressed in heart and kidney. Ref.1 |
| Sequence similarities | Contains 1 PH domain. Contains 2 WW domains. |
| Sequence caution | The sequence BAA91742.1 differs from that shown. Reason: Frameshift at position 759. The sequence BAB14419.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB21777.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular function | 1-phosphatidylinositol binding Non-traceable author statement Ref.1. Source: UniProtKB protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATN1 | P54259 | 2 | EBI-945934,EBI-945980 | |
| ATXN1 | P54253 | 2 | EBI-945934,EBI-930964 | |
| RBFOX1 | Q9NWB1 | 2 | EBI-945934,EBI-945906 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HAU0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HAU0-2) The sequence of this isoform differs from the canonical sequence as follows: 615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9HAU0-3) The sequence of this isoform differs from the canonical sequence as follows: 616-650: LSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVH → WGREKVATATGAAEAVASDTHLPRTGSSSPSLLCV 651-1116: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9HAU0-4) The sequence of this isoform differs from the canonical sequence as follows: 800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q9HAU0-5) The sequence of this isoform differs from the canonical sequence as follows: 785-840: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1116 | 1116 | Pleckstrin homology domain-containing family A member 5 | PRO_0000053883 | ||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||
| Domain | 10 – 43 | 34 | WW 1 | |||||||||||||||||||||||||||||
| Domain | 56 – 89 | 34 | WW 2 | |||||||||||||||||||||||||||||
| Domain | 169 – 268 | 100 | PH | |||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||
| Modified residue | 128 | 1 | Phosphotyrosine Ref.7 | |||||||||||||||||||||||||||||
| Modified residue | 134 | 1 | Phosphotyrosine Ref.7 Ref.14 | |||||||||||||||||||||||||||||
| Modified residue | 353 | 1 | Phosphotyrosine Ref.14 | |||||||||||||||||||||||||||||
| Modified residue | 410 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||
| Modified residue | 438 | 1 | Phosphothreonine Ref.11 | |||||||||||||||||||||||||||||
| Modified residue | 476 | 1 | Phosphothreonine Ref.11 | |||||||||||||||||||||||||||||
| Modified residue | 568 | 1 | Phosphoserine Ref.9 Ref.13 | |||||||||||||||||||||||||||||
| Modified residue | 607 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||
| Modified residue | 855 | 1 | Phosphoserine Ref.8 Ref.10 Ref.12 | |||||||||||||||||||||||||||||
| Modified residue | 857 | 1 | Phosphothreonine Ref.8 | |||||||||||||||||||||||||||||
| Modified residue | 930 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||
| Modified residue | 933 | 1 | Phosphoserine Ref.8 Ref.11 Ref.12 Ref.13 Ref.15 | |||||||||||||||||||||||||||||
| Modified residue | 937 | 1 | Phosphoserine Ref.8 Ref.11 Ref.12 Ref.13 | |||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||
| Alternative sequence | 615 | 1 | T → TPEELTLLLIKLRRQQAELS SIREHTLAQLMQLKLEAHSP KNEILSHHLQRNTIYLDHQ in isoform 2. | VSP_009775 | ||||||||||||||||||||||||||||
| Alternative sequence | 616 – 650 | 35 | LSQDE…DKVVH → WGREKVATATGAAEAVASDT HLPRTGSSSPSLLCV in isoform 3. | VSP_009776 | ||||||||||||||||||||||||||||
| Alternative sequence | 651 – 1116 | 466 | Missing in isoform 3. | VSP_014595 | ||||||||||||||||||||||||||||
| Alternative sequence | 785 – 840 | 56 | Missing in isoform 5. | VSP_009777 | ||||||||||||||||||||||||||||
| Alternative sequence | 800 | 1 | E → EEEEVVPPRPPLPRSYDFTE QPPIIPPLPSDSSSLLCYSR GPVHLPEEKKMYQVQGYPRN GSHC in isoform 4. | VSP_009778 | ||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||
| Sequence conflict | 627 | 1 | K → R in BAB14419. Ref.6 | |||||||||||||||||||||||||||||
| Sequence conflict | 736 | 1 | M → T in BAB14419. Ref.6 | |||||||||||||||||||||||||||||
| Sequence conflict | 970 | 1 | P → S in BAA91742. Ref.6 | |||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||
| Beta strand | 172 – 179 | 8 | ||||||||||||||||||||||||||||||
| Beta strand | 182 – 184 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 187 – 195 | 9 | ||||||||||||||||||||||||||||||
| Beta strand | 198 – 204 | 7 | ||||||||||||||||||||||||||||||
| Beta strand | 209 – 214 | 6 | ||||||||||||||||||||||||||||||
| Helix | 216 – 218 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 219 – 223 | 5 | ||||||||||||||||||||||||||||||
| Helix | 226 – 228 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 234 – 239 | 6 | ||||||||||||||||||||||||||||||
| Beta strand | 241 – 243 | 3 | ||||||||||||||||||||||||||||||
| Beta strand | 246 – 249 | 4 | ||||||||||||||||||||||||||||||
| Helix | 253 – 267 | 15 | ||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities." Dowler S.J., Currie R.A., Campbell D.G., Deak M., Kular G., Downes C.P., Alessi D.R. Biochem. J. 351:19-31(2000) [PubMed: 11001876] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed: 11214970] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed: 12168954] [Abstract] Cited for: SEQUENCE REVISION. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Amygdala. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 159-1116 (ISOFORM 3). Tissue: Placenta. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 625-1116 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 664-1116 (ISOFORM 5). Tissue: Teratocarcinoma. |
| [7] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-128 AND TYR-134, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-855; THR-857; SER-933 AND SER-937, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-568, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction." Tang L.-Y., Deng N., Wang L.-S., Dai J., Wang Z.-L., Jiang X.-S., Li S.-J., Li L., Sheng Q.-H., Wu D.-Q., Li L., Zeng R. Mol. Cell. Proteomics 6:1952-1967(2007) [PubMed: 17693683] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-855, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [11] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-438; THR-476; SER-933 AND SER-937, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-855; SER-933 AND SER-937, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-410; SER-568; SER-607; SER-930; SER-933 AND SER-937, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [14] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-134 AND TYR-353, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [15] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-933, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [16] | "Solution structure of the PH domain of pleckstrin homology domain-containing protein family A member 5 from human." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 156-271. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF302150 mRNA. Translation: AAG22817.1. AB051473 mRNA. Translation: BAB21777.2. Different initiation. AL834259 mRNA. Translation: CAD38934.1. BC000969 mRNA. Translation: AAH00969.1. BC013133 mRNA. Translation: AAH13133.3. BC127092 mRNA. Translation: AAI27093.1. AK001529 mRNA. Translation: BAA91742.1. Frameshift. AK023127 mRNA. Translation: BAB14419.1. Different initiation. | ||||||||||||
| IPI | IPI00029515. IPI00169401. IPI00409581. IPI00409582. IPI00409583. | ||||||||||||
| RefSeq | NP_001137293.2. NM_001143821.2. NP_061885.2. NM_019012.5. | ||||||||||||
| UniGene | Hs.188614. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9HAU0. | ||||||||||||
| SMR | Q9HAU0. Positions 2-89, 162-271. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9HAU0. 31 interactions. | ||||||||||||
| STRING | Q9HAU0. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9HAU0. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 48474955. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9HAU0. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000299275; ENSP00000299275; ENSG00000052126. | ||||||||||||
| GeneID | 54477. | ||||||||||||
| KEGG | hsa:54477. | ||||||||||||
| UCSC | uc001rea.1. human. uc001reb.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 54477. | ||||||||||||
| GeneCards | GC12P019282. | ||||||||||||
| H-InvDB | HIX0010473. | ||||||||||||
| HGNC | HGNC:30036. PLEKHA5. | ||||||||||||
| HPA | HPA035923. HPA035924. | ||||||||||||
| MIM | 607770. gene. | ||||||||||||
| neXtProt | NX_Q9HAU0. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00530000063012. | ||||||||||||
| HOVERGEN | HBG053615. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9HAU0. | ||||||||||||
| Bgee | Q9HAU0. | ||||||||||||
| CleanEx | HS_PLEKHA5. | ||||||||||||
| Genevestigator | Q9HAU0. | ||||||||||||
| GermOnline | ENSG00000052126. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR001202. WW_Rsp5_WWP. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.20.70.10. G3DSA:2.20.70.10. 2 hits. G3DSA:2.30.29.30. PH_type. 1 hit. | ||||||||||||
| Pfam | PF00169. PH. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00233. PH. 1 hit. SM00456. WW. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF51045. WW_Rsp5_WWP. 1 hit. | ||||||||||||
| PROSITE | PS50003. PH_DOMAIN. 1 hit. PS01159. WW_DOMAIN_1. 1 hit. PS50020. WW_DOMAIN_2. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 56792. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PKHA5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HAU0 Secondary accession number(s): A0JP03 Q9NVK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with