Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HAU0

- PKHA5_HUMAN

UniProt

Q9HAU0 - PKHA5_HUMAN

Protein

Pleckstrin homology domain-containing family A member 5

Gene

PLEKHA5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. 1-phosphatidylinositol binding Source: UniProtKB
    2. protein binding Source: IntAct

    Enzyme and pathway databases

    SignaLinkiQ9HAU0.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pleckstrin homology domain-containing family A member 5
    Short name:
    PH domain-containing family A member 5
    Alternative name(s):
    Phosphoinositol 3-phosphate-binding protein 2
    Short name:
    PEPP-2
    Gene namesi
    Name:PLEKHA5
    Synonyms:KIAA1686, PEPP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:30036. PLEKHA5.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134949896.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 11161115Pleckstrin homology domain-containing family A member 5PRO_0000053883Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei809 – 8091Phosphoserine1 Publication
    Modified residuei855 – 8551Phosphoserine2 Publications
    Modified residuei933 – 9331Phosphoserine4 Publications

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9HAU0.
    PaxDbiQ9HAU0.
    PRIDEiQ9HAU0.

    PTM databases

    PhosphoSiteiQ9HAU0.

    Expressioni

    Tissue specificityi

    Highly expressed in heart and kidney.1 Publication

    Gene expression databases

    ArrayExpressiQ9HAU0.
    BgeeiQ9HAU0.
    CleanExiHS_PLEKHA5.
    GenevestigatoriQ9HAU0.

    Organism-specific databases

    HPAiHPA035923.
    HPA035924.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ATN1P542592EBI-945934,EBI-945980
    ATXN1P542532EBI-945934,EBI-930964
    RBFOX1Q9NWB12EBI-945934,EBI-945906

    Protein-protein interaction databases

    BioGridi119982. 34 interactions.
    IntActiQ9HAU0. 31 interactions.
    STRINGi9606.ENSP00000299275.

    Structurei

    Secondary structure

    1
    1116
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi172 – 1798
    Beta strandi182 – 1843
    Beta strandi187 – 1959
    Beta strandi198 – 2047
    Beta strandi209 – 2146
    Helixi216 – 2183
    Beta strandi219 – 2235
    Helixi226 – 2283
    Beta strandi234 – 2396
    Beta strandi241 – 2433
    Beta strandi246 – 2494
    Helixi253 – 26715

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2DKPNMR-A157-271[»]
    ProteinModelPortaliQ9HAU0.
    SMRiQ9HAU0. Positions 11-43, 55-88, 162-271.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9HAU0.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini10 – 4334WW 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini56 – 8934WW 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini169 – 268100PHPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    Specifically interacts with PI3P, PI4P, PI5P, and PI(3,5)P2.1 Publication

    Sequence similaritiesi

    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 2 WW domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG279863.
    HOVERGENiHBG053615.
    OMAiKYKNEGP.
    PhylomeDBiQ9HAU0.
    TreeFamiTF329090.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001202. WW_dom.
    [Graphical view]
    PfamiPF00169. PH. 1 hit.
    PF00397. WW. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    SM00456. WW. 2 hits.
    [Graphical view]
    SUPFAMiSSF51045. SSF51045. 2 hits.
    PROSITEiPS50003. PH_DOMAIN. 1 hit.
    PS01159. WW_DOMAIN_1. 1 hit.
    PS50020. WW_DOMAIN_2. 2 hits.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HAU0-1) [UniParc]FASTAAdd to Basket

    Also known as: S

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAADLNLEWI SLPRSWTYGI TRGGRVFFIN EEAKSTTWLH PVTGEAVVTG     50
    HRRQSTDLPT GWEEAYTFEG ARYYINHNER KVTCKHPVTG QPSQDNCIFV 100
    VNEQTVATMT SEEKKERPIS MINEASNYNV TSDYAVHPMS PVGRTSRASK 150
    KVHNFGKRSN SIKRNPNAPV VRRGWLYKQD STGMKLWKKR WFVLSDLCLF 200
    YYRDEKEEGI LGSILLPSFQ IALLTSEDHI NRKYAFKAAH PNMRTYYFCT 250
    DTGKEMELWM KAMLDAALVQ TEPVKRVDKI TSENAPTKET NNIPNHRVLI 300
    KPEIQNNQKN KEMSKIEEKK ALEAEKYGFQ KDGQDRPLTK INSVKLNSLP 350
    SEYESGSACP AQTVHYRPIN LSSSENKIVN VSLADLRGGN RPNTGPLYTE 400
    ADRVIQRTNS MQQLEQWIKI QKGRGHEEET RGVISYQTLP RNMPSHRAQI 450
    MARYPEGYRT LPRNSKTRPE SICSVTPSTH DKTLGPGAEE KRRSMRDDTM 500
    WQLYEWQQRQ FYNKQSTLPR HSTLSSPKTM VNISDQTMHS IPTSPSHGSI 550
    AAYQGYSPQR TYRSEVSSPI QRGDVTIDRR HRAHHPKHVY VPDRRSVPAG 600
    LTLQSVSPQS LQGKTLSQDE GRGTLYKYRP EEVDIDAKLS RLCEQDKVVH 650
    ALEEKLQQLH KEKYTLEQAL LSASQEIEMH ADNPAAIQTV VLQRDDLQNG 700
    LLSTCRELSR ATAELERAWR EYDKLEYDVT VTRNQMQEQL DHLGEVQTES 750
    AGIQRAQIQK ELWRIQDVME GLSKHKQQRG TTEIGMIGSK PFSTVKYKNE 800
    GPDYRLYKSE PELTTVAEVD ESNGEEKSEP VSEIETSVVK GSHFPVGVVP 850
    PRAKSPTPES STIASYVTLR KTKKMMDLRT ERPRSAVEQL CLAESTRPRM 900
    TVEEQMERIR RHQQACLREK KKGLNVIGAS DQSPLQSPSN LRDNPFRTTQ 950
    TRRRDDKELD TAIRENDVKP DHETPATEIV QLKETEPQNV DFSKELKKTE 1000
    NISYEMLFEP EPNGVNSVEM MDKERNKDKM PEDVTFSPQD ETQTANHKPE 1050
    EHPEENTKNS VDEQEETVIS YESTPEVSRG NQTMAVKSLS PSPESSASPV 1100
    PSTQPQLTEG SHFMCV 1116
    Length:1,116
    Mass (Da):127,464
    Last modified:March 1, 2001 - v1
    Checksum:i327F792F644B9D48
    GO
    Isoform 2 (identifier: Q9HAU0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ

    Note: No experimental confirmation available.

    Show »
    Length:1,174
    Mass (Da):134,323
    Checksum:iB82D29C6F281D311
    GO
    Isoform 3 (identifier: Q9HAU0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         616-650: LSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVH → WGREKVATATGAAEAVASDTHLPRTGSSSPSLLCV
         651-1116: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:650
    Mass (Da):73,909
    Checksum:i98FCFC6BD6243232
    GO
    Isoform 4 (identifier: Q9HAU0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

    Note: No experimental confirmation available.

    Show »
    Length:1,179
    Mass (Da):134,593
    Checksum:iA7E7827DDD2166DC
    GO
    Isoform 5 (identifier: Q9HAU0-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         785-840: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,060
    Mass (Da):121,272
    Checksum:iEC6B2DC66DC64F6A
    GO
    Isoform 6 (identifier: Q9HAU0-6) [UniParc]FASTAAdd to Basket

    Also known as: L

    The sequence of this isoform differs from the canonical sequence as follows:
         275-275: K → KRITFNF
         615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ
         616-616: L → MKENEPIITMVHTMIENSALRPQLYQQFLRQKSKISLYCL
         800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

    Note: Specifically expresssed in brain.

    Show »
    Length:1,282
    Mass (Da):146,896
    Checksum:i06D1168C576FF684
    GO
    Isoform 7 (identifier: Q9HAU0-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         77-1116: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:76
    Mass (Da):8,723
    Checksum:iDC9FF548141EE15E
    GO
    Isoform 8 (identifier: Q9HAU0-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-108: Missing.
         615-615: T → TMKENEPIITMVHTMIENSALRPQLYQQ
         800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

    Note: No experimental confirmation available.

    Show »
    Length:1,098
    Mass (Da):125,523
    Checksum:i3145FF2D1B42D710
    GO

    Sequence cautioni

    The sequence AAH70174.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence BAA91742.1 differs from that shown. Reason: Frameshift at position 759.
    The sequence BAB14419.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB21777.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti311 – 3111K → R in BAG57882. (PubMed:14702039)Curated
    Sequence conflicti534 – 5341S → T in BAG57882. (PubMed:14702039)Curated
    Sequence conflicti627 – 6271K → R in BAB14419. (PubMed:14702039)Curated
    Sequence conflicti736 – 7361M → T in BAB14419. (PubMed:14702039)Curated
    Sequence conflicti970 – 9701P → S in BAA91742. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 108108Missing in isoform 8. 1 PublicationVSP_047514Add
    BLAST
    Alternative sequencei77 – 11161040Missing in isoform 7. 1 PublicationVSP_046861Add
    BLAST
    Alternative sequencei275 – 2751K → KRITFNF in isoform 6. 1 PublicationVSP_044678
    Alternative sequencei615 – 6151T → TPEELTLLLIKLRRQQAELS SIREHTLAQLMQLKLEAHSP KNEILSHHLQRNTIYLDHQ in isoform 2 and isoform 6. 2 PublicationsVSP_009775
    Alternative sequencei615 – 6151T → TMKENEPIITMVHTMIENSA LRPQLYQQ in isoform 8. 1 PublicationVSP_047515
    Alternative sequencei616 – 65035LSQDE…DKVVH → WGREKVATATGAAEAVASDT HLPRTGSSSPSLLCV in isoform 3. 1 PublicationVSP_009776Add
    BLAST
    Alternative sequencei616 – 6161L → MKENEPIITMVHTMIENSAL RPQLYQQFLRQKSKISLYCL in isoform 6. 1 PublicationVSP_044679
    Alternative sequencei651 – 1116466Missing in isoform 3. 1 PublicationVSP_014595Add
    BLAST
    Alternative sequencei785 – 84056Missing in isoform 5. 1 PublicationVSP_009777Add
    BLAST
    Alternative sequencei800 – 8001E → EEEEVVPPRPPLPRSYDFTE QPPIIPPLPSDSSSLLCYSR GPVHLPEEKKMYQVQGYPRN GSHC in isoform 4, isoform 6 and isoform 8. 3 PublicationsVSP_009778

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF302150 mRNA. Translation: AAG22817.1.
    AB642244 mRNA. Translation: BAL45489.1.
    AB051473 mRNA. Translation: BAB21777.2. Different initiation.
    AK001529 mRNA. Translation: BAA91742.1. Frameshift.
    AK023127 mRNA. Translation: BAB14419.1. Different initiation.
    AK294739 mRNA. Translation: BAG57882.1.
    AL834259 mRNA. Translation: CAD38934.1.
    AC024902 Genomic DNA. No translation available.
    AC087314 Genomic DNA. No translation available.
    AC091805 Genomic DNA. No translation available.
    AC092828 Genomic DNA. No translation available.
    CH471094 Genomic DNA. Translation: EAW96393.1.
    BC000969 mRNA. Translation: AAH00969.1.
    BC044245 mRNA. Translation: AAH44245.1.
    BC070174 mRNA. Translation: AAH70174.1. Sequence problems.
    BC013133 mRNA. Translation: AAH13133.3.
    BC127092 mRNA. Translation: AAI27093.1.
    CCDSiCCDS44840.2. [Q9HAU0-2]
    CCDS55809.1. [Q9HAU0-7]
    CCDS58213.1. [Q9HAU0-6]
    CCDS58214.1. [Q9HAU0-8]
    CCDS8682.1. [Q9HAU0-1]
    RefSeqiNP_001137293.2. NM_001143821.2. [Q9HAU0-2]
    NP_001177789.2. NM_001190860.2. [Q9HAU0-7]
    NP_001243399.1. NM_001256470.1. [Q9HAU0-6]
    NP_001243716.1. NM_001256787.1. [Q9HAU0-8]
    NP_061885.2. NM_019012.5. [Q9HAU0-1]
    XP_005253457.1. XM_005253400.1. [Q9HAU0-4]
    UniGeneiHs.188614.

    Genome annotation databases

    EnsembliENST00000299275; ENSP00000299275; ENSG00000052126. [Q9HAU0-1]
    ENST00000429027; ENSP00000404296; ENSG00000052126. [Q9HAU0-6]
    ENST00000538714; ENSP00000439673; ENSG00000052126. [Q9HAU0-2]
    ENST00000540972; ENSP00000439396; ENSG00000052126. [Q9HAU0-7]
    GeneIDi54477.
    KEGGihsa:54477.
    UCSCiuc001rdz.4. human.
    uc001rea.3. human. [Q9HAU0-2]
    uc001reb.3. human. [Q9HAU0-1]
    uc001rec.1. human.
    uc010sih.1. human. [Q9HAU0-4]

    Polymorphism databases

    DMDMi48474955.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF302150 mRNA. Translation: AAG22817.1 .
    AB642244 mRNA. Translation: BAL45489.1 .
    AB051473 mRNA. Translation: BAB21777.2 . Different initiation.
    AK001529 mRNA. Translation: BAA91742.1 . Frameshift.
    AK023127 mRNA. Translation: BAB14419.1 . Different initiation.
    AK294739 mRNA. Translation: BAG57882.1 .
    AL834259 mRNA. Translation: CAD38934.1 .
    AC024902 Genomic DNA. No translation available.
    AC087314 Genomic DNA. No translation available.
    AC091805 Genomic DNA. No translation available.
    AC092828 Genomic DNA. No translation available.
    CH471094 Genomic DNA. Translation: EAW96393.1 .
    BC000969 mRNA. Translation: AAH00969.1 .
    BC044245 mRNA. Translation: AAH44245.1 .
    BC070174 mRNA. Translation: AAH70174.1 . Sequence problems.
    BC013133 mRNA. Translation: AAH13133.3 .
    BC127092 mRNA. Translation: AAI27093.1 .
    CCDSi CCDS44840.2. [Q9HAU0-2 ]
    CCDS55809.1. [Q9HAU0-7 ]
    CCDS58213.1. [Q9HAU0-6 ]
    CCDS58214.1. [Q9HAU0-8 ]
    CCDS8682.1. [Q9HAU0-1 ]
    RefSeqi NP_001137293.2. NM_001143821.2. [Q9HAU0-2 ]
    NP_001177789.2. NM_001190860.2. [Q9HAU0-7 ]
    NP_001243399.1. NM_001256470.1. [Q9HAU0-6 ]
    NP_001243716.1. NM_001256787.1. [Q9HAU0-8 ]
    NP_061885.2. NM_019012.5. [Q9HAU0-1 ]
    XP_005253457.1. XM_005253400.1. [Q9HAU0-4 ]
    UniGenei Hs.188614.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2DKP NMR - A 157-271 [» ]
    ProteinModelPortali Q9HAU0.
    SMRi Q9HAU0. Positions 11-43, 55-88, 162-271.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119982. 34 interactions.
    IntActi Q9HAU0. 31 interactions.
    STRINGi 9606.ENSP00000299275.

    PTM databases

    PhosphoSitei Q9HAU0.

    Polymorphism databases

    DMDMi 48474955.

    Proteomic databases

    MaxQBi Q9HAU0.
    PaxDbi Q9HAU0.
    PRIDEi Q9HAU0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000299275 ; ENSP00000299275 ; ENSG00000052126 . [Q9HAU0-1 ]
    ENST00000429027 ; ENSP00000404296 ; ENSG00000052126 . [Q9HAU0-6 ]
    ENST00000538714 ; ENSP00000439673 ; ENSG00000052126 . [Q9HAU0-2 ]
    ENST00000540972 ; ENSP00000439396 ; ENSG00000052126 . [Q9HAU0-7 ]
    GeneIDi 54477.
    KEGGi hsa:54477.
    UCSCi uc001rdz.4. human.
    uc001rea.3. human. [Q9HAU0-2 ]
    uc001reb.3. human. [Q9HAU0-1 ]
    uc001rec.1. human.
    uc010sih.1. human. [Q9HAU0-4 ]

    Organism-specific databases

    CTDi 54477.
    GeneCardsi GC12P019282.
    H-InvDB HIX0171628.
    HGNCi HGNC:30036. PLEKHA5.
    HPAi HPA035923.
    HPA035924.
    MIMi 607770. gene.
    neXtProti NX_Q9HAU0.
    PharmGKBi PA134949896.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG279863.
    HOVERGENi HBG053615.
    OMAi KYKNEGP.
    PhylomeDBi Q9HAU0.
    TreeFami TF329090.

    Enzyme and pathway databases

    SignaLinki Q9HAU0.

    Miscellaneous databases

    EvolutionaryTracei Q9HAU0.
    GeneWikii PLEKHA5.
    GenomeRNAii 54477.
    NextBioi 56792.
    PROi Q9HAU0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HAU0.
    Bgeei Q9HAU0.
    CleanExi HS_PLEKHA5.
    Genevestigatori Q9HAU0.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001202. WW_dom.
    [Graphical view ]
    Pfami PF00169. PH. 1 hit.
    PF00397. WW. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    SM00456. WW. 2 hits.
    [Graphical view ]
    SUPFAMi SSF51045. SSF51045. 2 hits.
    PROSITEi PS50003. PH_DOMAIN. 1 hit.
    PS01159. WW_DOMAIN_1. 1 hit.
    PS50020. WW_DOMAIN_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities."
      Dowler S.J., Currie R.A., Campbell D.G., Deak M., Kular G., Downes C.P., Alessi D.R.
      Biochem. J. 351:19-31(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Identification and characterization of splicing variants of PLEKHA5 (Plekha5) during brain development."
      Yamada K., Nomura N., Yamano A., Yamada Y., Wakamatsu N.
      Gene 492:270-275(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), SUBCELLULAR LOCATION, DOMAIN PH, ALTERNATIVE SPLICING.
    3. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
      DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 625-1116 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 664-1116 (ISOFORM 5).
      Tissue: Brain and Teratocarcinoma.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Amygdala.
    7. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 159-1116 (ISOFORM 3).
      Tissue: Colon, Lung and Placenta.
    10. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-855 AND SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-809 AND SER-855, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    17. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    18. "Solution structure of the PH domain of pleckstrin homology domain-containing protein family A member 5 from human."
      RIKEN structural genomics initiative (RSGI)
      Submitted (OCT-2006) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 156-271.

    Entry informationi

    Entry nameiPKHA5_HUMAN
    AccessioniPrimary (citable) accession number: Q9HAU0
    Secondary accession number(s): A0JP03
    , B4DGS1, E9PHQ3, F5H0I0, Q6NSF8, Q86ST7, Q8N3K6, Q96DY9, Q9BVR4, Q9C0H7, Q9H924, Q9NVK8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 29, 2004
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3