Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9HAU0 (PKHA5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Pleckstrin homology domain-containing family A member 5

Short name=PH domain-containing family A member 5
Alternative name(s):
Phosphoinositol 3-phosphate-binding protein 2
Short name=PEPP-2
Gene names
Name:PLEKHA5
Synonyms:KIAA1686, PEPP2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1116 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Cytoplasm Ref.2.

Tissue specificity

Highly expressed in heart and kidney. Ref.1

Domain

Specifically interacts with PI3P, PI4P, PI5P, and PI(3,5)P2. Ref.2

Sequence similarities

Contains 1 PH domain.

Contains 2 WW domains.

Sequence caution

The sequence AAH70174.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence BAA91742.1 differs from that shown. Reason: Frameshift at position 759.

The sequence BAB14419.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB21777.2 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   DomainRepeat
   PTMAcetylation
Phosphoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_function1-phosphatidylinositol binding

Non-traceable author statement Ref.1. Source: UniProtKB

protein binding

Inferred from physical interaction PubMed 16713569. Source: IntAct

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9HAU0-1)

Also known as: S;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9HAU0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9HAU0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     616-650: LSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVH → WGREKVATATGAAEAVASDTHLPRTGSSSPSLLCV
     651-1116: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9HAU0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC
Note: No experimental confirmation available.
Isoform 5 (identifier: Q9HAU0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     785-840: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q9HAU0-6)

Also known as: L;

The sequence of this isoform differs from the canonical sequence as follows:
     275-275: K → KRITFNF
     615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ
     616-616: L → MKENEPIITMVHTMIENSALRPQLYQQFLRQKSKISLYCL
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC
Note: Specifically expresssed in brain.
Isoform 7 (identifier: Q9HAU0-7)

The sequence of this isoform differs from the canonical sequence as follows:
     77-1116: Missing.
Note: No experimental confirmation available.
Isoform 8 (identifier: Q9HAU0-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.
     615-615: T → TMKENEPIITMVHTMIENSALRPQLYQQ
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.17
Chain2 – 11161115Pleckstrin homology domain-containing family A member 5
PRO_0000053883

Regions

Domain10 – 4334WW 1
Domain56 – 8934WW 2
Domain169 – 268100PH

Amino acid modifications

Modified residue21N-acetylalanine Ref.17
Modified residue8091Phosphoserine Ref.16
Modified residue8551Phosphoserine Ref.12 Ref.16
Modified residue9331Phosphoserine Ref.10 Ref.11 Ref.12 Ref.14

Natural variations

Alternative sequence1 – 108108Missing in isoform 8.
VSP_047514
Alternative sequence77 – 11161040Missing in isoform 7.
VSP_046861
Alternative sequence2751K → KRITFNF in isoform 6.
VSP_044678
Alternative sequence6151T → TPEELTLLLIKLRRQQAELS SIREHTLAQLMQLKLEAHSP KNEILSHHLQRNTIYLDHQ in isoform 2 and isoform 6.
VSP_009775
Alternative sequence6151T → TMKENEPIITMVHTMIENSA LRPQLYQQ in isoform 8.
VSP_047515
Alternative sequence616 – 65035LSQDE…DKVVH → WGREKVATATGAAEAVASDT HLPRTGSSSPSLLCV in isoform 3.
VSP_009776
Alternative sequence6161L → MKENEPIITMVHTMIENSAL RPQLYQQFLRQKSKISLYCL in isoform 6.
VSP_044679
Alternative sequence651 – 1116466Missing in isoform 3.
VSP_014595
Alternative sequence785 – 84056Missing in isoform 5.
VSP_009777
Alternative sequence8001E → EEEEVVPPRPPLPRSYDFTE QPPIIPPLPSDSSSLLCYSR GPVHLPEEKKMYQVQGYPRN GSHC in isoform 4, isoform 6 and isoform 8.
VSP_009778

Experimental info

Sequence conflict3111K → R in BAG57882. Ref.5
Sequence conflict5341S → T in BAG57882. Ref.5
Sequence conflict6271K → R in BAB14419. Ref.5
Sequence conflict7361M → T in BAB14419. Ref.5
Sequence conflict9701P → S in BAA91742. Ref.5

Secondary structure

........................ 1116
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (S) [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: 327F792F644B9D48

FASTA1,116127,464
        10         20         30         40         50         60 
MAADLNLEWI SLPRSWTYGI TRGGRVFFIN EEAKSTTWLH PVTGEAVVTG HRRQSTDLPT 

        70         80         90        100        110        120 
GWEEAYTFEG ARYYINHNER KVTCKHPVTG QPSQDNCIFV VNEQTVATMT SEEKKERPIS 

       130        140        150        160        170        180 
MINEASNYNV TSDYAVHPMS PVGRTSRASK KVHNFGKRSN SIKRNPNAPV VRRGWLYKQD 

       190        200        210        220        230        240 
STGMKLWKKR WFVLSDLCLF YYRDEKEEGI LGSILLPSFQ IALLTSEDHI NRKYAFKAAH 

       250        260        270        280        290        300 
PNMRTYYFCT DTGKEMELWM KAMLDAALVQ TEPVKRVDKI TSENAPTKET NNIPNHRVLI 

       310        320        330        340        350        360 
KPEIQNNQKN KEMSKIEEKK ALEAEKYGFQ KDGQDRPLTK INSVKLNSLP SEYESGSACP 

       370        380        390        400        410        420 
AQTVHYRPIN LSSSENKIVN VSLADLRGGN RPNTGPLYTE ADRVIQRTNS MQQLEQWIKI 

       430        440        450        460        470        480 
QKGRGHEEET RGVISYQTLP RNMPSHRAQI MARYPEGYRT LPRNSKTRPE SICSVTPSTH 

       490        500        510        520        530        540 
DKTLGPGAEE KRRSMRDDTM WQLYEWQQRQ FYNKQSTLPR HSTLSSPKTM VNISDQTMHS 

       550        560        570        580        590        600 
IPTSPSHGSI AAYQGYSPQR TYRSEVSSPI QRGDVTIDRR HRAHHPKHVY VPDRRSVPAG 

       610        620        630        640        650        660 
LTLQSVSPQS LQGKTLSQDE GRGTLYKYRP EEVDIDAKLS RLCEQDKVVH ALEEKLQQLH 

       670        680        690        700        710        720 
KEKYTLEQAL LSASQEIEMH ADNPAAIQTV VLQRDDLQNG LLSTCRELSR ATAELERAWR 

       730        740        750        760        770        780 
EYDKLEYDVT VTRNQMQEQL DHLGEVQTES AGIQRAQIQK ELWRIQDVME GLSKHKQQRG 

       790        800        810        820        830        840 
TTEIGMIGSK PFSTVKYKNE GPDYRLYKSE PELTTVAEVD ESNGEEKSEP VSEIETSVVK 

       850        860        870        880        890        900 
GSHFPVGVVP PRAKSPTPES STIASYVTLR KTKKMMDLRT ERPRSAVEQL CLAESTRPRM 

       910        920        930        940        950        960 
TVEEQMERIR RHQQACLREK KKGLNVIGAS DQSPLQSPSN LRDNPFRTTQ TRRRDDKELD 

       970        980        990       1000       1010       1020 
TAIRENDVKP DHETPATEIV QLKETEPQNV DFSKELKKTE NISYEMLFEP EPNGVNSVEM 

      1030       1040       1050       1060       1070       1080 
MDKERNKDKM PEDVTFSPQD ETQTANHKPE EHPEENTKNS VDEQEETVIS YESTPEVSRG 

      1090       1100       1110 
NQTMAVKSLS PSPESSASPV PSTQPQLTEG SHFMCV 

« Hide

Isoform 2 [UniParc].

Checksum: B82D29C6F281D311
Show »

FASTA1,174134,323
Isoform 3 [UniParc].

Checksum: 98FCFC6BD6243232
Show »

FASTA65073,909
Isoform 4 [UniParc].

Checksum: A7E7827DDD2166DC
Show »

FASTA1,179134,593
Isoform 5 [UniParc].

Checksum: EC6B2DC66DC64F6A
Show »

FASTA1,060121,272
Isoform 6 (L) [UniParc].

Checksum: 06D1168C576FF684
Show »

FASTA1,282146,896
Isoform 7 [UniParc].

Checksum: DC9FF548141EE15E
Show »

FASTA768,723
Isoform 8 [UniParc].

Checksum: 3145FF2D1B42D710
Show »

FASTA1,098125,523

References

« Hide 'large scale' references
[1]"Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities."
Dowler S.J., Currie R.A., Campbell D.G., Deak M., Kular G., Downes C.P., Alessi D.R.
Biochem. J. 351:19-31(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Identification and characterization of splicing variants of PLEKHA5 (Plekha5) during brain development."
Yamada K., Nomura N., Yamano A., Yamada Y., Wakamatsu N.
Gene 492:270-275(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), SUBCELLULAR LOCATION, DOMAIN PH, ALTERNATIVE SPLICING.
[3]"Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[4]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 625-1116 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 664-1116 (ISOFORM 5).
Tissue: Brain and Teratocarcinoma.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Amygdala.
[7]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 159-1116 (ISOFORM 3).
Tissue: Colon, Lung and Placenta.
[10]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-855 AND SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[13]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[14]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-933, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[15]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[16]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-809 AND SER-855, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[17]"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
[18]"Solution structure of the PH domain of pleckstrin homology domain-containing protein family A member 5 from human."
RIKEN structural genomics initiative (RSGI)
Submitted (OCT-2006) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 156-271.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF302150 mRNA. Translation: AAG22817.1.
AB642244 mRNA. Translation: BAL45489.1.
AB051473 mRNA. Translation: BAB21777.2. Different initiation.
AK001529 mRNA. Translation: BAA91742.1. Frameshift.
AK023127 mRNA. Translation: BAB14419.1. Different initiation.
AK294739 mRNA. Translation: BAG57882.1.
AL834259 mRNA. Translation: CAD38934.1.
AC024902 Genomic DNA. No translation available.
AC087314 Genomic DNA. No translation available.
AC091805 Genomic DNA. No translation available.
AC092828 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96393.1.
BC000969 mRNA. Translation: AAH00969.1.
BC044245 mRNA. Translation: AAH44245.1.
BC070174 mRNA. Translation: AAH70174.1. Sequence problems.
BC013133 mRNA. Translation: AAH13133.3.
BC127092 mRNA. Translation: AAI27093.1.
CCDSCCDS44840.2. [Q9HAU0-2]
CCDS55809.1. [Q9HAU0-7]
CCDS58213.1. [Q9HAU0-6]
CCDS58214.1. [Q9HAU0-8]
CCDS8682.1. [Q9HAU0-1]
RefSeqNP_001137293.2. NM_001143821.2. [Q9HAU0-2]
NP_001177789.2. NM_001190860.2. [Q9HAU0-7]
NP_001243399.1. NM_001256470.1. [Q9HAU0-6]
NP_001243716.1. NM_001256787.1. [Q9HAU0-8]
NP_061885.2. NM_019012.5. [Q9HAU0-1]
XP_005253457.1. XM_005253400.1. [Q9HAU0-4]
UniGeneHs.188614.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2DKPNMR-A157-271[»]
ProteinModelPortalQ9HAU0.
SMRQ9HAU0. Positions 11-43, 55-88, 162-271.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119982. 34 interactions.
IntActQ9HAU0. 31 interactions.
STRING9606.ENSP00000299275.

PTM databases

PhosphoSiteQ9HAU0.

Polymorphism databases

DMDM48474955.

Proteomic databases

MaxQBQ9HAU0.
PaxDbQ9HAU0.
PRIDEQ9HAU0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000299275; ENSP00000299275; ENSG00000052126. [Q9HAU0-1]
ENST00000309364; ENSP00000311239; ENSG00000052126. [Q9HAU0-3]
ENST00000317589; ENSP00000325155; ENSG00000052126. [Q9HAU0-4]
ENST00000355397; ENSP00000347560; ENSG00000052126. [Q9HAU0-2]
ENST00000359180; ENSP00000352104; ENSG00000052126. [Q9HAU0-5]
ENST00000429027; ENSP00000404296; ENSG00000052126. [Q9HAU0-6]
ENST00000538714; ENSP00000439673; ENSG00000052126. [Q9HAU0-2]
ENST00000540972; ENSP00000439396; ENSG00000052126. [Q9HAU0-7]
ENST00000543806; ENSP00000439837; ENSG00000052126. [Q9HAU0-8]
GeneID54477.
KEGGhsa:54477.
UCSCuc001rdz.4. human.
uc001rea.3. human. [Q9HAU0-2]
uc001reb.3. human. [Q9HAU0-1]
uc001rec.1. human.
uc010sih.1. human. [Q9HAU0-4]

Organism-specific databases

CTD54477.
GeneCardsGC12P019282.
H-InvDBHIX0171628.
HGNCHGNC:30036. PLEKHA5.
HPAHPA035923.
HPA035924.
MIM607770. gene.
neXtProtNX_Q9HAU0.
PharmGKBPA134949896.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG279863.
HOVERGENHBG053615.
OMAKYKNEGP.
PhylomeDBQ9HAU0.
TreeFamTF329090.

Enzyme and pathway databases

SignaLinkQ9HAU0.

Gene expression databases

ArrayExpressQ9HAU0.
BgeeQ9HAU0.
CleanExHS_PLEKHA5.
GenevestigatorQ9HAU0.

Family and domain databases

Gene3D2.30.29.30. 1 hit.
InterProIPR011993. PH_like_dom.
IPR001849. Pleckstrin_homology.
IPR001202. WW_dom.
[Graphical view]
PfamPF00169. PH. 1 hit.
PF00397. WW. 1 hit.
[Graphical view]
SMARTSM00233. PH. 1 hit.
SM00456. WW. 2 hits.
[Graphical view]
SUPFAMSSF51045. SSF51045. 2 hits.
PROSITEPS50003. PH_DOMAIN. 1 hit.
PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9HAU0.
GeneWikiPLEKHA5.
GenomeRNAi54477.
NextBio56792.
PROQ9HAU0.
SOURCESearch...

Entry information

Entry namePKHA5_HUMAN
AccessionPrimary (citable) accession number: Q9HAU0
Secondary accession number(s): A0JP03 expand/collapse secondary AC list , B4DGS1, E9PHQ3, F5H0I0, Q6NSF8, Q86ST7, Q8N3K6, Q96DY9, Q9BVR4, Q9C0H7, Q9H924, Q9NVK8
Entry history
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM