Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pleckstrin homology domain-containing family A member 5

Gene

PLEKHA5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-1660499. Synthesis of PIPs at the plasma membrane.
SignaLinkiQ9HAU0.

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family A member 5
Short name:
PH domain-containing family A member 5
Alternative name(s):
Phosphoinositol 3-phosphate-binding protein 2
Short name:
PEPP-2
Gene namesi
Name:PLEKHA5
Synonyms:KIAA1686, PEPP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:30036. PLEKHA5.

Subcellular locationi

  • Cytoplasm 1 Publication

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytosol Source: Ensembl
  • membrane Source: UniProtKB
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000052126.
PharmGKBiPA134949896.

Polymorphism and mutation databases

BioMutaiPLEKHA5.
DMDMi48474955.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000538832 – 1116Pleckstrin homology domain-containing family A member 5Add BLAST1115

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei55PhosphoserineCombined sources1
Modified residuei382PhosphoserineCombined sources1
Modified residuei410PhosphoserineCombined sources1
Modified residuei438PhosphothreonineCombined sources1
Modified residuei460PhosphothreonineCombined sources1
Modified residuei568PhosphoserineCombined sources1
Modified residuei607PhosphoserineCombined sources1
Modified residuei809PhosphoserineCombined sources1
Modified residuei855PhosphoserineCombined sources1
Modified residuei933PhosphoserineCombined sources1
Modified residuei937PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9HAU0.
MaxQBiQ9HAU0.
PeptideAtlasiQ9HAU0.
PRIDEiQ9HAU0.
TopDownProteomicsiQ9HAU0-3. [Q9HAU0-3]

PTM databases

iPTMnetiQ9HAU0.
PhosphoSitePlusiQ9HAU0.

Expressioni

Tissue specificityi

Highly expressed in heart and kidney.1 Publication

Gene expression databases

BgeeiENSG00000052126.
CleanExiHS_PLEKHA5.
ExpressionAtlasiQ9HAU0. baseline and differential.
GenevisibleiQ9HAU0. HS.

Organism-specific databases

HPAiHPA035923.
HPA035924.
HPA041455.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ATN1P542592EBI-945934,EBI-945980
ATXN1P542532EBI-945934,EBI-930964
PDZD11Q5EBL85EBI-945934,EBI-1644207
RBFOX1Q9NWB12EBI-945934,EBI-945906

Protein-protein interaction databases

BioGridi119982. 55 interactors.
IntActiQ9HAU0. 48 interactors.

Structurei

Secondary structure

11116
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi172 – 179Combined sources8
Beta strandi182 – 184Combined sources3
Beta strandi187 – 195Combined sources9
Beta strandi198 – 204Combined sources7
Beta strandi209 – 214Combined sources6
Helixi216 – 218Combined sources3
Beta strandi219 – 223Combined sources5
Helixi226 – 228Combined sources3
Beta strandi234 – 239Combined sources6
Beta strandi241 – 243Combined sources3
Beta strandi246 – 249Combined sources4
Helixi253 – 267Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DKPNMR-A157-271[»]
ProteinModelPortaliQ9HAU0.
SMRiQ9HAU0.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HAU0.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini10 – 43WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini56 – 89WW 2PROSITE-ProRule annotationAdd BLAST34
Domaini169 – 268PHPROSITE-ProRule annotationAdd BLAST100

Domaini

Specifically interacts with PI3P, PI4P, PI5P, and PI(3,5)P2.1 Publication

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 2 WW domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

GeneTreeiENSGT00530000063012.
HOGENOMiHOG000115554.
HOVERGENiHBG053615.
InParanoidiQ9HAU0.
OMAiKYKNEGP.
OrthoDBiEOG091G00D6.
PhylomeDBiQ9HAU0.
TreeFamiTF329090.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00456. WW. 2 hits.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF51045. SSF51045. 2 hits.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 2 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HAU0-1) [UniParc]FASTAAdd to basket
Also known as: S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAADLNLEWI SLPRSWTYGI TRGGRVFFIN EEAKSTTWLH PVTGEAVVTG
60 70 80 90 100
HRRQSTDLPT GWEEAYTFEG ARYYINHNER KVTCKHPVTG QPSQDNCIFV
110 120 130 140 150
VNEQTVATMT SEEKKERPIS MINEASNYNV TSDYAVHPMS PVGRTSRASK
160 170 180 190 200
KVHNFGKRSN SIKRNPNAPV VRRGWLYKQD STGMKLWKKR WFVLSDLCLF
210 220 230 240 250
YYRDEKEEGI LGSILLPSFQ IALLTSEDHI NRKYAFKAAH PNMRTYYFCT
260 270 280 290 300
DTGKEMELWM KAMLDAALVQ TEPVKRVDKI TSENAPTKET NNIPNHRVLI
310 320 330 340 350
KPEIQNNQKN KEMSKIEEKK ALEAEKYGFQ KDGQDRPLTK INSVKLNSLP
360 370 380 390 400
SEYESGSACP AQTVHYRPIN LSSSENKIVN VSLADLRGGN RPNTGPLYTE
410 420 430 440 450
ADRVIQRTNS MQQLEQWIKI QKGRGHEEET RGVISYQTLP RNMPSHRAQI
460 470 480 490 500
MARYPEGYRT LPRNSKTRPE SICSVTPSTH DKTLGPGAEE KRRSMRDDTM
510 520 530 540 550
WQLYEWQQRQ FYNKQSTLPR HSTLSSPKTM VNISDQTMHS IPTSPSHGSI
560 570 580 590 600
AAYQGYSPQR TYRSEVSSPI QRGDVTIDRR HRAHHPKHVY VPDRRSVPAG
610 620 630 640 650
LTLQSVSPQS LQGKTLSQDE GRGTLYKYRP EEVDIDAKLS RLCEQDKVVH
660 670 680 690 700
ALEEKLQQLH KEKYTLEQAL LSASQEIEMH ADNPAAIQTV VLQRDDLQNG
710 720 730 740 750
LLSTCRELSR ATAELERAWR EYDKLEYDVT VTRNQMQEQL DHLGEVQTES
760 770 780 790 800
AGIQRAQIQK ELWRIQDVME GLSKHKQQRG TTEIGMIGSK PFSTVKYKNE
810 820 830 840 850
GPDYRLYKSE PELTTVAEVD ESNGEEKSEP VSEIETSVVK GSHFPVGVVP
860 870 880 890 900
PRAKSPTPES STIASYVTLR KTKKMMDLRT ERPRSAVEQL CLAESTRPRM
910 920 930 940 950
TVEEQMERIR RHQQACLREK KKGLNVIGAS DQSPLQSPSN LRDNPFRTTQ
960 970 980 990 1000
TRRRDDKELD TAIRENDVKP DHETPATEIV QLKETEPQNV DFSKELKKTE
1010 1020 1030 1040 1050
NISYEMLFEP EPNGVNSVEM MDKERNKDKM PEDVTFSPQD ETQTANHKPE
1060 1070 1080 1090 1100
EHPEENTKNS VDEQEETVIS YESTPEVSRG NQTMAVKSLS PSPESSASPV
1110
PSTQPQLTEG SHFMCV
Length:1,116
Mass (Da):127,464
Last modified:March 1, 2001 - v1
Checksum:i327F792F644B9D48
GO
Isoform 2 (identifier: Q9HAU0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ

Note: No experimental confirmation available.
Show »
Length:1,174
Mass (Da):134,323
Checksum:iB82D29C6F281D311
GO
Isoform 3 (identifier: Q9HAU0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     616-650: LSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVH → WGREKVATATGAAEAVASDTHLPRTGSSSPSLLCV
     651-1116: Missing.

Note: No experimental confirmation available.
Show »
Length:650
Mass (Da):73,909
Checksum:i98FCFC6BD6243232
GO
Isoform 4 (identifier: Q9HAU0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

Note: No experimental confirmation available.
Show »
Length:1,179
Mass (Da):134,593
Checksum:iA7E7827DDD2166DC
GO
Isoform 5 (identifier: Q9HAU0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     785-840: Missing.

Note: No experimental confirmation available.
Show »
Length:1,060
Mass (Da):121,272
Checksum:iEC6B2DC66DC64F6A
GO
Isoform 6 (identifier: Q9HAU0-6) [UniParc]FASTAAdd to basket
Also known as: L

The sequence of this isoform differs from the canonical sequence as follows:
     275-275: K → KRITFNF
     615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ
     616-616: L → MKENEPIITMVHTMIENSALRPQLYQQFLRQKSKISLYCL
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

Note: Specifically expressed in brain.
Show »
Length:1,282
Mass (Da):146,896
Checksum:i06D1168C576FF684
GO
Isoform 7 (identifier: Q9HAU0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-1116: Missing.

Note: No experimental confirmation available.
Show »
Length:76
Mass (Da):8,723
Checksum:iDC9FF548141EE15E
GO
Isoform 8 (identifier: Q9HAU0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.
     615-615: T → TMKENEPIITMVHTMIENSALRPQLYQQ
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

Note: No experimental confirmation available.
Show »
Length:1,098
Mass (Da):125,523
Checksum:i3145FF2D1B42D710
GO

Sequence cautioni

The sequence AAH70174 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA91742 differs from that shown. Reason: Frameshift at position 759.Curated
The sequence BAB14419 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB21777 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti311K → R in BAG57882 (PubMed:14702039).Curated1
Sequence conflicti534S → T in BAG57882 (PubMed:14702039).Curated1
Sequence conflicti627K → R in BAB14419 (PubMed:14702039).Curated1
Sequence conflicti736M → T in BAB14419 (PubMed:14702039).Curated1
Sequence conflicti970P → S in BAA91742 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0475141 – 108Missing in isoform 8. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_04686177 – 1116Missing in isoform 7. 1 PublicationAdd BLAST1040
Alternative sequenceiVSP_044678275K → KRITFNF in isoform 6. 1 Publication1
Alternative sequenceiVSP_009775615T → TPEELTLLLIKLRRQQAELS SIREHTLAQLMQLKLEAHSP KNEILSHHLQRNTIYLDHQ in isoform 2 and isoform 6. 2 Publications1
Alternative sequenceiVSP_047515615T → TMKENEPIITMVHTMIENSA LRPQLYQQ in isoform 8. 1 Publication1
Alternative sequenceiVSP_009776616 – 650LSQDE…DKVVH → WGREKVATATGAAEAVASDT HLPRTGSSSPSLLCV in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_044679616L → MKENEPIITMVHTMIENSAL RPQLYQQFLRQKSKISLYCL in isoform 6. 1 Publication1
Alternative sequenceiVSP_014595651 – 1116Missing in isoform 3. 1 PublicationAdd BLAST466
Alternative sequenceiVSP_009777785 – 840Missing in isoform 5. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_009778800E → EEEEVVPPRPPLPRSYDFTE QPPIIPPLPSDSSSLLCYSR GPVHLPEEKKMYQVQGYPRN GSHC in isoform 4, isoform 6 and isoform 8. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF302150 mRNA. Translation: AAG22817.1.
AB642244 mRNA. Translation: BAL45489.1.
AB051473 mRNA. Translation: BAB21777.2. Different initiation.
AK001529 mRNA. Translation: BAA91742.1. Frameshift.
AK023127 mRNA. Translation: BAB14419.1. Different initiation.
AK294739 mRNA. Translation: BAG57882.1.
AL834259 mRNA. Translation: CAD38934.1.
AC024902 Genomic DNA. No translation available.
AC087314 Genomic DNA. No translation available.
AC091805 Genomic DNA. No translation available.
AC092828 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96393.1.
BC000969 mRNA. Translation: AAH00969.1.
BC044245 mRNA. Translation: AAH44245.1.
BC070174 mRNA. Translation: AAH70174.1. Sequence problems.
BC013133 mRNA. Translation: AAH13133.3.
BC127092 mRNA. Translation: AAI27093.1.
CCDSiCCDS44840.2. [Q9HAU0-2]
CCDS55809.1. [Q9HAU0-7]
CCDS58213.1. [Q9HAU0-6]
CCDS58214.1. [Q9HAU0-8]
CCDS8682.1. [Q9HAU0-1]
RefSeqiNP_001137293.2. NM_001143821.2. [Q9HAU0-2]
NP_001177789.2. NM_001190860.2. [Q9HAU0-7]
NP_001243399.1. NM_001256470.1. [Q9HAU0-6]
NP_001243716.1. NM_001256787.1. [Q9HAU0-8]
NP_061885.2. NM_019012.5. [Q9HAU0-1]
XP_005253457.1. XM_005253400.1. [Q9HAU0-4]
XP_011519019.1. XM_011520717.1. [Q9HAU0-2]
XP_016874992.1. XM_017019503.1. [Q9HAU0-7]
UniGeneiHs.188614.

Genome annotation databases

EnsembliENST00000299275; ENSP00000299275; ENSG00000052126. [Q9HAU0-1]
ENST00000424268; ENSP00000400411; ENSG00000052126. [Q9HAU0-8]
ENST00000429027; ENSP00000404296; ENSG00000052126. [Q9HAU0-6]
ENST00000538714; ENSP00000439673; ENSG00000052126. [Q9HAU0-2]
ENST00000540972; ENSP00000439396; ENSG00000052126. [Q9HAU0-7]
GeneIDi54477.
KEGGihsa:54477.
UCSCiuc001rdz.5. human. [Q9HAU0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF302150 mRNA. Translation: AAG22817.1.
AB642244 mRNA. Translation: BAL45489.1.
AB051473 mRNA. Translation: BAB21777.2. Different initiation.
AK001529 mRNA. Translation: BAA91742.1. Frameshift.
AK023127 mRNA. Translation: BAB14419.1. Different initiation.
AK294739 mRNA. Translation: BAG57882.1.
AL834259 mRNA. Translation: CAD38934.1.
AC024902 Genomic DNA. No translation available.
AC087314 Genomic DNA. No translation available.
AC091805 Genomic DNA. No translation available.
AC092828 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96393.1.
BC000969 mRNA. Translation: AAH00969.1.
BC044245 mRNA. Translation: AAH44245.1.
BC070174 mRNA. Translation: AAH70174.1. Sequence problems.
BC013133 mRNA. Translation: AAH13133.3.
BC127092 mRNA. Translation: AAI27093.1.
CCDSiCCDS44840.2. [Q9HAU0-2]
CCDS55809.1. [Q9HAU0-7]
CCDS58213.1. [Q9HAU0-6]
CCDS58214.1. [Q9HAU0-8]
CCDS8682.1. [Q9HAU0-1]
RefSeqiNP_001137293.2. NM_001143821.2. [Q9HAU0-2]
NP_001177789.2. NM_001190860.2. [Q9HAU0-7]
NP_001243399.1. NM_001256470.1. [Q9HAU0-6]
NP_001243716.1. NM_001256787.1. [Q9HAU0-8]
NP_061885.2. NM_019012.5. [Q9HAU0-1]
XP_005253457.1. XM_005253400.1. [Q9HAU0-4]
XP_011519019.1. XM_011520717.1. [Q9HAU0-2]
XP_016874992.1. XM_017019503.1. [Q9HAU0-7]
UniGeneiHs.188614.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DKPNMR-A157-271[»]
ProteinModelPortaliQ9HAU0.
SMRiQ9HAU0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119982. 55 interactors.
IntActiQ9HAU0. 48 interactors.

PTM databases

iPTMnetiQ9HAU0.
PhosphoSitePlusiQ9HAU0.

Polymorphism and mutation databases

BioMutaiPLEKHA5.
DMDMi48474955.

Proteomic databases

EPDiQ9HAU0.
MaxQBiQ9HAU0.
PeptideAtlasiQ9HAU0.
PRIDEiQ9HAU0.
TopDownProteomicsiQ9HAU0-3. [Q9HAU0-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000299275; ENSP00000299275; ENSG00000052126. [Q9HAU0-1]
ENST00000424268; ENSP00000400411; ENSG00000052126. [Q9HAU0-8]
ENST00000429027; ENSP00000404296; ENSG00000052126. [Q9HAU0-6]
ENST00000538714; ENSP00000439673; ENSG00000052126. [Q9HAU0-2]
ENST00000540972; ENSP00000439396; ENSG00000052126. [Q9HAU0-7]
GeneIDi54477.
KEGGihsa:54477.
UCSCiuc001rdz.5. human. [Q9HAU0-1]

Organism-specific databases

CTDi54477.
GeneCardsiPLEKHA5.
H-InvDBHIX0171628.
HGNCiHGNC:30036. PLEKHA5.
HPAiHPA035923.
HPA035924.
HPA041455.
MIMi607770. gene.
neXtProtiNX_Q9HAU0.
OpenTargetsiENSG00000052126.
PharmGKBiPA134949896.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063012.
HOGENOMiHOG000115554.
HOVERGENiHBG053615.
InParanoidiQ9HAU0.
OMAiKYKNEGP.
OrthoDBiEOG091G00D6.
PhylomeDBiQ9HAU0.
TreeFamiTF329090.

Enzyme and pathway databases

ReactomeiR-HSA-1660499. Synthesis of PIPs at the plasma membrane.
SignaLinkiQ9HAU0.

Miscellaneous databases

ChiTaRSiPLEKHA5. human.
EvolutionaryTraceiQ9HAU0.
GeneWikiiPLEKHA5.
GenomeRNAii54477.
PROiQ9HAU0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000052126.
CleanExiHS_PLEKHA5.
ExpressionAtlasiQ9HAU0. baseline and differential.
GenevisibleiQ9HAU0. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00456. WW. 2 hits.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF51045. SSF51045. 2 hits.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPKHA5_HUMAN
AccessioniPrimary (citable) accession number: Q9HAU0
Secondary accession number(s): A0JP03
, B4DGS1, E9PHQ3, F5H0I0, Q6NSF8, Q86ST7, Q8N3K6, Q96DY9, Q9BVR4, Q9C0H7, Q9H924, Q9NVK8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 1, 2001
Last modified: November 30, 2016
This is version 154 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.