Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HAR2

- LPHN3_HUMAN

UniProt

Q9HAR2 - LPHN3_HUMAN

Protein

Latrophilin-3

Gene

LPHN3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 109 (01 Oct 2014)
      Sequence version 2 (10 May 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei841 – 8422CleavageBy similarity

    GO - Molecular functioni

    1. carbohydrate binding Source: InterPro
    2. G-protein coupled receptor activity Source: UniProtKB

    GO - Biological processi

    1. G-protein coupled receptor signaling pathway Source: UniProtKB
    2. neuropeptide signaling pathway Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Keywords - Ligandi

    Lectin

    Protein family/group databases

    MEROPSiS63.014.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Latrophilin-3
    Alternative name(s):
    Calcium-independent alpha-latrotoxin receptor 3
    Short name:
    CIRL-3
    Lectomedin-3
    Gene namesi
    Name:LPHN3
    Synonyms:KIAA0768, LEC3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:20974. LPHN3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134968284.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 14471428Latrophilin-3PRO_0000012913Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi93 – 931N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi135 ↔ 317PROSITE-ProRule annotation
    Glycosylationi464 – 4641N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi549 – 5491N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi746 – 7461N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi759 – 7591N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi804 – 8041N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi830 – 8301N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1076 – 10761N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity
    O-glycosylated (major) and N-glycosylated.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9HAR2.
    PRIDEiQ9HAR2.

    PTM databases

    PhosphoSiteiQ9HAR2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9HAR2.
    BgeeiQ9HAR2.
    CleanExiHS_LPHN3.
    GenevestigatoriQ9HAR2.

    Organism-specific databases

    HPAiCAB022698.
    HPA015027.
    HPA015762.

    Interactioni

    Subunit structurei

    Interacts with FLRT3 and TEN1.By similarity

    Protein-protein interaction databases

    BioGridi116882. 1 interaction.
    IntActiQ9HAR2. 1 interaction.
    STRINGi9606.ENSP00000295349.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9HAR2.
    SMRiQ9HAR2. Positions 25-129, 498-841, 866-1104.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 866847ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini890 – 90112CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini920 – 93314ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini957 – 96812CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini989 – 100719ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1031 – 104919CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1073 – 10819ExtracellularSequence Analysis
    Topological domaini1105 – 1447343CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei867 – 88923Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei902 – 91918Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei934 – 95623Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei969 – 98820Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei1008 – 103023Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei1050 – 107223Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei1082 – 110423Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini35 – 12490SUEL-type lectinPROSITE-ProRule annotationAdd
    BLAST
    Domaini134 – 393260Olfactomedin-likePROSITE-ProRule annotationAdd
    BLAST
    Domaini802 – 85352GPSPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The Olfactomedin-like domain is required for the synapse-promoting function and the interaction with FLRT3. The Olfactomedin-like and the SUEL-type lectin domains are required for the interaction with TEN1 By similarity.By similarity

    Sequence similaritiesi

    Contains 1 GPS domain.PROSITE-ProRule annotation
    Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation
    Contains 1 SUEL-type lectin domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG253931.
    HOGENOMiHOG000049065.
    HOVERGENiHBG052337.
    InParanoidiQ9HAR2.
    KOiK04594.
    PhylomeDBiQ9HAR2.
    TreeFamiTF351999.

    Family and domain databases

    InterProiIPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR003924. GPCR_2_latrophilin.
    IPR015630. GPCR_2_latrophilin3.
    IPR003334. GPCR_2_latrophilin_rcpt_C.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    IPR000922. Lectin_gal-bd_dom.
    IPR003112. Olfac-like.
    [Graphical view]
    PANTHERiPTHR12011:SF60. PTHR12011:SF60. 1 hit.
    PfamiPF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF02140. Gal_Lectin. 1 hit.
    PF01825. GPS. 1 hit.
    PF02793. HRM. 1 hit.
    PF02354. Latrophilin. 2 hits.
    PF02191. OLF. 1 hit.
    [Graphical view]
    PRINTSiPR00249. GPCRSECRETIN.
    PR01444. LATROPHILIN.
    SMARTiSM00303. GPS. 1 hit.
    SM00008. HormR. 1 hit.
    SM00284. OLF. 1 hit.
    [Graphical view]
    PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    PS51132. OLF. 1 hit.
    PS50228. SUEL_LECTIN. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HAR2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWPSQLLIFM MLLAPIIHAF SRAPIPMAVV RRELSCESYP IELRCPGTDV     50
    IMIESANYGR TDDKICDSDP AQMENIRCYL PDAYKIMSQR CNNRTQCAVV 100
    AGPDVFPDPC PGTYKYLEVQ YECVPYKVEQ KVFLCPGLLK GVYQSEHLFE 150
    SDHQSGAWCK DPLQASDKIY YMPWTPYRTD TLTEYSSKDD FIAGRPTTTY 200
    KLPHRVDGTG FVVYDGALFF NKERTRNIVK FDLRTRIKSG EAIIANANYH 250
    DTSPYRWGGK SDIDLAVDEN GLWVIYATEQ NNGKIVISQL NPYTLRIEGT 300
    WDTAYDKRSA SNAFMICGIL YVVKSVYEDD DNEATGNKID YIYNTDQSKD 350
    SLVDVPFPNS YQYIAAVDYN PRDNLLYVWN NYHVVKYSLD FGPLDSRSGQ 400
    AHHGQVSYIS PPIHLDSELE RPSVKDISTT GPLGMGSTTT STTLRTTTLS 450
    PGRSTTPSVS GRRNRSTSTP SPAVEVLDDM TTHLPSASSQ IPALEESCEA 500
    VEAREIMWFK TRQGQIAKQP CPAGTIGVST YLCLAPDGIW DPQGPDLSNC 550
    SSPWVNHITQ KLKSGETAAN IARELAEQTR NHLNAGDITY SVRAMDQLVG 600
    LLDVQLRNLT PGGKDSAARS LNKAMVETVN NLLQPQALNA WRDLTTSDQL 650
    RAATMLLHTV EESAFVLADN LLKTDIVREN TDNIKLEVAR LSTEGNLEDL 700
    KFPENMGHGS TIQLSANTLK QNGRNGEIRV AFVLYNNLGP YLSTENASMK 750
    LGTEALSTNH SVIVNSPVIT AAINKEFSNK VYLADPVVFT VKHIKQSEEN 800
    FNPNCSFWSY SKRTMTGYWS TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH 850
    VEVKHSDAVH DLLLDVITWV GILLSLVCLL ICIFTFCFFR GLQSDRNTIH 900
    KNLCISLFVA ELLFLIGINR TDQPIACAVF AALLHFFFLA AFTWMFLEGV 950
    QLYIMLVEVF ESEHSRRKYF YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW 1000
    LRLDTYFIWS FIGPATLIIM LNVIFLGIAL YKMFHHTAIL KPESGCLDNI 1050
    KSWVIGAIAL LCLLGLTWAF GLMYINESTV IMAYLFTIFN SLQGMFIFIF 1100
    HCVLQKKVRK EYGKCLRTHC CSGKSTESSI GSGKTSGSRT PGRYSTGSQS 1150
    RIRRMWNDTV RKQSESSFIT GDINSSASLN REGLLNNARD TSVMDTLPLN 1200
    GNHGNSYSIA SGEYLSNCVQ IIDRGYNHNE TALEKKILKE LTSNYIPSYL 1250
    NNHERSSEQN RNLMNKLVNN LGSGREDDAI VLDDATSFNH EESLGLELIH 1300
    EESDAPLLPP RVYSTENHQP HHYTRRRIPQ DHSESFFPLL TNEHTEDLQS 1350
    PHRDSLYTSM PTLAGVAATE SVTTSTQTEP PPAKCGDAED VYYKSMPNLG 1400
    SRNHVHQLHT YYQLGRGSSD GFIVPPNKDG TPPEGSSKGP AHLVTSL 1447
    Length:1,447
    Mass (Da):161,812
    Last modified:May 10, 2004 - v2
    Checksum:i54B7E7DBE516447A
    GO
    Isoform 2 (identifier: Q9HAR2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         623-623: K → KLQKRERSCRAYVQ
         1050-1050: I → INYEDNRPFI
         1183-1218: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
         1219-1447: Missing.

    Show »
    Length:1,240
    Mass (Da):139,280
    Checksum:iE357F856B07AE142
    GO
    Isoform 3 (identifier: Q9HAR2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         668-707: ADNLLKTDIV...EDLKFPENMG → VLQVCLPVRE...PLKFRLAKNK
         708-1447: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:707
    Mass (Da):79,337
    Checksum:i0AB57B9A7361496E
    GO
    Isoform 4 (identifier: Q9HAR2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         623-623: K → KLQKRERSCRAYVQ
         1050-1050: I → INYEDNRPFI

    Show »
    Length:1,469
    Mass (Da):164,580
    Checksum:i660D0446D584C7F4
    GO

    Sequence cautioni

    The sequence BAA91375.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti247 – 2471A → S.1 Publication
    VAR_064477
    Natural varianti465 – 4651R → Q.1 Publication
    Corresponds to variant rs35106420 [ dbSNP | Ensembl ].
    VAR_055934
    Natural varianti770 – 7701T → M.1 Publication
    VAR_064478
    Natural varianti915 – 9151L → V.1 Publication
    VAR_064479

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei623 – 6231K → KLQKRERSCRAYVQ in isoform 2 and isoform 4. 1 PublicationVSP_010235
    Alternative sequencei668 – 70740ADNLL…PENMG → VLQVCLPVREQSFLPFFSFF IFFFSFLPFIPLKFRLAKNK in isoform 3. 1 PublicationVSP_010236Add
    BLAST
    Alternative sequencei708 – 1447740Missing in isoform 3. 1 PublicationVSP_010237Add
    BLAST
    Alternative sequencei1050 – 10501I → INYEDNRPFI in isoform 2 and isoform 4. 1 PublicationVSP_010238
    Alternative sequencei1183 – 121836GLLNN…YLSNC → PYRETSMGVKLNIAYQIGAS EQCQGYKCHGYSTTEW in isoform 2. 1 PublicationVSP_010239Add
    BLAST
    Alternative sequencei1219 – 1447229Missing in isoform 2. 1 PublicationVSP_010240Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF307080 mRNA. Translation: AAG27462.1.
    AK000781 mRNA. Translation: BAA91375.1. Different initiation.
    AC007511 Genomic DNA. No translation available.
    AC020741 Genomic DNA. No translation available.
    AC092643 Genomic DNA. No translation available.
    AC092663 Genomic DNA. No translation available.
    AC092668 Genomic DNA. No translation available.
    AC096723 Genomic DNA. No translation available.
    AC104813 Genomic DNA. No translation available.
    AC108161 Genomic DNA. No translation available.
    AB018311 mRNA. Translation: BAA34488.1.
    RefSeqiNP_056051.2. NM_015236.4.
    UniGeneiHs.28391.
    Hs.570770.

    Genome annotation databases

    EnsembliENST00000512091; ENSP00000423388; ENSG00000150471. [Q9HAR2-2]
    GeneIDi23284.
    KEGGihsa:23284.
    UCSCiuc003hcq.4. human. [Q9HAR2-2]
    uc003hcs.1. human. [Q9HAR2-3]
    uc003hct.3. human. [Q9HAR2-1]
    uc010ihh.3. human.

    Polymorphism databases

    DMDMi47116772.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF307080 mRNA. Translation: AAG27462.1 .
    AK000781 mRNA. Translation: BAA91375.1 . Different initiation.
    AC007511 Genomic DNA. No translation available.
    AC020741 Genomic DNA. No translation available.
    AC092643 Genomic DNA. No translation available.
    AC092663 Genomic DNA. No translation available.
    AC092668 Genomic DNA. No translation available.
    AC096723 Genomic DNA. No translation available.
    AC104813 Genomic DNA. No translation available.
    AC108161 Genomic DNA. No translation available.
    AB018311 mRNA. Translation: BAA34488.1 .
    RefSeqi NP_056051.2. NM_015236.4.
    UniGenei Hs.28391.
    Hs.570770.

    3D structure databases

    ProteinModelPortali Q9HAR2.
    SMRi Q9HAR2. Positions 25-129, 498-841, 866-1104.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116882. 1 interaction.
    IntActi Q9HAR2. 1 interaction.
    STRINGi 9606.ENSP00000295349.

    Protein family/group databases

    MEROPSi S63.014.
    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q9HAR2.

    Polymorphism databases

    DMDMi 47116772.

    Proteomic databases

    PaxDbi Q9HAR2.
    PRIDEi Q9HAR2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000512091 ; ENSP00000423388 ; ENSG00000150471 . [Q9HAR2-2 ]
    GeneIDi 23284.
    KEGGi hsa:23284.
    UCSCi uc003hcq.4. human. [Q9HAR2-2 ]
    uc003hcs.1. human. [Q9HAR2-3 ]
    uc003hct.3. human. [Q9HAR2-1 ]
    uc010ihh.3. human.

    Organism-specific databases

    CTDi 23284.
    GeneCardsi GC04P062070.
    H-InvDB HIX0004247.
    HGNCi HGNC:20974. LPHN3.
    HPAi CAB022698.
    HPA015027.
    HPA015762.
    neXtProti NX_Q9HAR2.
    PharmGKBi PA134968284.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG253931.
    HOGENOMi HOG000049065.
    HOVERGENi HBG052337.
    InParanoidi Q9HAR2.
    KOi K04594.
    PhylomeDBi Q9HAR2.
    TreeFami TF351999.

    Miscellaneous databases

    ChiTaRSi LPHN3. human.
    GenomeRNAii 23284.
    NextBioi 45084.
    PROi Q9HAR2.

    Gene expression databases

    ArrayExpressi Q9HAR2.
    Bgeei Q9HAR2.
    CleanExi HS_LPHN3.
    Genevestigatori Q9HAR2.

    Family and domain databases

    InterProi IPR022624. DUF3497.
    IPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR003924. GPCR_2_latrophilin.
    IPR015630. GPCR_2_latrophilin3.
    IPR003334. GPCR_2_latrophilin_rcpt_C.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    IPR000922. Lectin_gal-bd_dom.
    IPR003112. Olfac-like.
    [Graphical view ]
    PANTHERi PTHR12011:SF60. PTHR12011:SF60. 1 hit.
    Pfami PF00002. 7tm_2. 1 hit.
    PF12003. DUF3497. 1 hit.
    PF02140. Gal_Lectin. 1 hit.
    PF01825. GPS. 1 hit.
    PF02793. HRM. 1 hit.
    PF02354. Latrophilin. 2 hits.
    PF02191. OLF. 1 hit.
    [Graphical view ]
    PRINTSi PR00249. GPCRSECRETIN.
    PR01444. LATROPHILIN.
    SMARTi SM00303. GPS. 1 hit.
    SM00008. HormR. 1 hit.
    SM00284. OLF. 1 hit.
    [Graphical view ]
    PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    PS51132. OLF. 1 hit.
    PS50228. SUEL_LECTIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Douangpanya J., Puri K., Hayflick J.
      Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 279-707 (ISOFORM 3).
      Tissue: Colon.
    4. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 576-1447 (ISOFORM 1).
      Tissue: Brain.
    5. Cited for: VARIANTS SER-247; GLN-465; MET-770 AND VAL-915.

    Entry informationi

    Entry nameiLPHN3_HUMAN
    AccessioniPrimary (citable) accession number: Q9HAR2
    Secondary accession number(s): E9PE04, O94867, Q9NWK5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2004
    Last sequence update: May 10, 2004
    Last modified: October 1, 2014
    This is version 109 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3