SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HAR2

- LPHN3_HUMAN

UniProt

Q9HAR2 - LPHN3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Latrophilin-3

Gene
LPHN3, KIAA0768, LEC3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei841 – 8422Cleavage By similarity

GO - Molecular functioni

  1. carbohydrate binding Source: InterPro
  2. G-protein coupled receptor activity Source: UniProtKB

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: UniProtKB
  2. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Lectin

Protein family/group databases

MEROPSiS63.014.

Names & Taxonomyi

Protein namesi
Recommended name:
Latrophilin-3
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 3
Short name:
CIRL-3
Lectomedin-3
Gene namesi
Name:LPHN3
Synonyms:KIAA0768, LEC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:20974. LPHN3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 866847Extracellular Reviewed predictionAdd
BLAST
Transmembranei867 – 88923Helical; Name=1; Reviewed predictionAdd
BLAST
Topological domaini890 – 90112Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei902 – 91918Helical; Name=2; Reviewed predictionAdd
BLAST
Topological domaini920 – 93314Extracellular Reviewed predictionAdd
BLAST
Transmembranei934 – 95623Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini957 – 96812Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei969 – 98820Helical; Name=4; Reviewed predictionAdd
BLAST
Topological domaini989 – 100719Extracellular Reviewed predictionAdd
BLAST
Transmembranei1008 – 103023Helical; Name=5; Reviewed predictionAdd
BLAST
Topological domaini1031 – 104919Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei1050 – 107223Helical; Name=6; Reviewed predictionAdd
BLAST
Topological domaini1073 – 10819Extracellular Reviewed prediction
Transmembranei1082 – 110423Helical; Name=7; Reviewed predictionAdd
BLAST
Topological domaini1105 – 1447343Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134968284.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919 Reviewed predictionAdd
BLAST
Chaini20 – 14471428Latrophilin-3PRO_0000012913Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi93 – 931N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi135 ↔ 317 By similarity
Glycosylationi464 – 4641N-linked (GlcNAc...) Reviewed prediction
Glycosylationi549 – 5491N-linked (GlcNAc...) Reviewed prediction
Glycosylationi746 – 7461N-linked (GlcNAc...) Reviewed prediction
Glycosylationi759 – 7591N-linked (GlcNAc...) Reviewed prediction
Glycosylationi804 – 8041N-linked (GlcNAc...) Reviewed prediction
Glycosylationi830 – 8301N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1076 – 10761N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9HAR2.
PRIDEiQ9HAR2.

PTM databases

PhosphoSiteiQ9HAR2.

Expressioni

Gene expression databases

ArrayExpressiQ9HAR2.
BgeeiQ9HAR2.
CleanExiHS_LPHN3.
GenevestigatoriQ9HAR2.

Organism-specific databases

HPAiCAB022698.
HPA015027.
HPA015762.

Interactioni

Subunit structurei

Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85) By similarity.

Protein-protein interaction databases

BioGridi116882. 1 interaction.
IntActiQ9HAR2. 1 interaction.
STRINGi9606.ENSP00000295349.

Structurei

3D structure databases

ProteinModelPortaliQ9HAR2.
SMRiQ9HAR2. Positions 25-129, 498-841, 866-1104.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 12490SUEL-type lectinAdd
BLAST
Domaini134 – 393260Olfactomedin-likeAdd
BLAST
Domaini802 – 85352GPSAdd
BLAST

Sequence similaritiesi

Contains 1 GPS domain.

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253931.
HOGENOMiHOG000049065.
HOVERGENiHBG052337.
InParanoidiQ9HAR2.
KOiK04594.
PhylomeDBiQ9HAR2.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view]
PANTHERiPTHR12011:SF60. PTHR12011:SF60. 1 hit.
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HAR2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MWPSQLLIFM MLLAPIIHAF SRAPIPMAVV RRELSCESYP IELRCPGTDV     50
IMIESANYGR TDDKICDSDP AQMENIRCYL PDAYKIMSQR CNNRTQCAVV 100
AGPDVFPDPC PGTYKYLEVQ YECVPYKVEQ KVFLCPGLLK GVYQSEHLFE 150
SDHQSGAWCK DPLQASDKIY YMPWTPYRTD TLTEYSSKDD FIAGRPTTTY 200
KLPHRVDGTG FVVYDGALFF NKERTRNIVK FDLRTRIKSG EAIIANANYH 250
DTSPYRWGGK SDIDLAVDEN GLWVIYATEQ NNGKIVISQL NPYTLRIEGT 300
WDTAYDKRSA SNAFMICGIL YVVKSVYEDD DNEATGNKID YIYNTDQSKD 350
SLVDVPFPNS YQYIAAVDYN PRDNLLYVWN NYHVVKYSLD FGPLDSRSGQ 400
AHHGQVSYIS PPIHLDSELE RPSVKDISTT GPLGMGSTTT STTLRTTTLS 450
PGRSTTPSVS GRRNRSTSTP SPAVEVLDDM TTHLPSASSQ IPALEESCEA 500
VEAREIMWFK TRQGQIAKQP CPAGTIGVST YLCLAPDGIW DPQGPDLSNC 550
SSPWVNHITQ KLKSGETAAN IARELAEQTR NHLNAGDITY SVRAMDQLVG 600
LLDVQLRNLT PGGKDSAARS LNKAMVETVN NLLQPQALNA WRDLTTSDQL 650
RAATMLLHTV EESAFVLADN LLKTDIVREN TDNIKLEVAR LSTEGNLEDL 700
KFPENMGHGS TIQLSANTLK QNGRNGEIRV AFVLYNNLGP YLSTENASMK 750
LGTEALSTNH SVIVNSPVIT AAINKEFSNK VYLADPVVFT VKHIKQSEEN 800
FNPNCSFWSY SKRTMTGYWS TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH 850
VEVKHSDAVH DLLLDVITWV GILLSLVCLL ICIFTFCFFR GLQSDRNTIH 900
KNLCISLFVA ELLFLIGINR TDQPIACAVF AALLHFFFLA AFTWMFLEGV 950
QLYIMLVEVF ESEHSRRKYF YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW 1000
LRLDTYFIWS FIGPATLIIM LNVIFLGIAL YKMFHHTAIL KPESGCLDNI 1050
KSWVIGAIAL LCLLGLTWAF GLMYINESTV IMAYLFTIFN SLQGMFIFIF 1100
HCVLQKKVRK EYGKCLRTHC CSGKSTESSI GSGKTSGSRT PGRYSTGSQS 1150
RIRRMWNDTV RKQSESSFIT GDINSSASLN REGLLNNARD TSVMDTLPLN 1200
GNHGNSYSIA SGEYLSNCVQ IIDRGYNHNE TALEKKILKE LTSNYIPSYL 1250
NNHERSSEQN RNLMNKLVNN LGSGREDDAI VLDDATSFNH EESLGLELIH 1300
EESDAPLLPP RVYSTENHQP HHYTRRRIPQ DHSESFFPLL TNEHTEDLQS 1350
PHRDSLYTSM PTLAGVAATE SVTTSTQTEP PPAKCGDAED VYYKSMPNLG 1400
SRNHVHQLHT YYQLGRGSSD GFIVPPNKDG TPPEGSSKGP AHLVTSL 1447
Length:1,447
Mass (Da):161,812
Last modified:May 10, 2004 - v2
Checksum:i54B7E7DBE516447A
GO
Isoform 2 (identifier: Q9HAR2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     623-623: K → KLQKRERSCRAYVQ
     1050-1050: I → INYEDNRPFI
     1183-1218: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1219-1447: Missing.

Show »
Length:1,240
Mass (Da):139,280
Checksum:iE357F856B07AE142
GO
Isoform 3 (identifier: Q9HAR2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     668-707: ADNLLKTDIV...EDLKFPENMG → VLQVCLPVRE...PLKFRLAKNK
     708-1447: Missing.

Note: No experimental confirmation available.

Show »
Length:707
Mass (Da):79,337
Checksum:i0AB57B9A7361496E
GO

Sequence cautioni

The sequence BAA91375.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti247 – 2471A → S.1 Publication
VAR_064477
Natural varianti465 – 4651R → Q.1 Publication
Corresponds to variant rs35106420 [ dbSNP | Ensembl ].
VAR_055934
Natural varianti770 – 7701T → M.1 Publication
VAR_064478
Natural varianti915 – 9151L → V.1 Publication
VAR_064479

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei623 – 6231K → KLQKRERSCRAYVQ in isoform 2. VSP_010235
Alternative sequencei668 – 70740ADNLL…PENMG → VLQVCLPVREQSFLPFFSFF IFFFSFLPFIPLKFRLAKNK in isoform 3. VSP_010236Add
BLAST
Alternative sequencei708 – 1447740Missing in isoform 3. VSP_010237Add
BLAST
Alternative sequencei1050 – 10501I → INYEDNRPFI in isoform 2. VSP_010238
Alternative sequencei1183 – 121836GLLNN…YLSNC → PYRETSMGVKLNIAYQIGAS EQCQGYKCHGYSTTEW in isoform 2. VSP_010239Add
BLAST
Alternative sequencei1219 – 1447229Missing in isoform 2. VSP_010240Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF307080 mRNA. Translation: AAG27462.1.
AK000781 mRNA. Translation: BAA91375.1. Different initiation.
AB018311 mRNA. Translation: BAA34488.1.
RefSeqiNP_056051.2. NM_015236.4.
UniGeneiHs.28391.
Hs.570770.

Genome annotation databases

EnsembliENST00000512091; ENSP00000423388; ENSG00000150471. [Q9HAR2-2]
ENST00000570545; ENSP00000459702; ENSG00000262515. [Q9HAR2-2]
GeneIDi23284.
KEGGihsa:23284.
UCSCiuc003hcq.4. human. [Q9HAR2-2]
uc003hcs.1. human. [Q9HAR2-3]
uc003hct.3. human. [Q9HAR2-1]

Polymorphism databases

DMDMi47116772.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF307080 mRNA. Translation: AAG27462.1 .
AK000781 mRNA. Translation: BAA91375.1 . Different initiation.
AB018311 mRNA. Translation: BAA34488.1 .
RefSeqi NP_056051.2. NM_015236.4.
UniGenei Hs.28391.
Hs.570770.

3D structure databases

ProteinModelPortali Q9HAR2.
SMRi Q9HAR2. Positions 25-129, 498-841, 866-1104.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116882. 1 interaction.
IntActi Q9HAR2. 1 interaction.
STRINGi 9606.ENSP00000295349.

Protein family/group databases

MEROPSi S63.014.
GPCRDBi Search...

PTM databases

PhosphoSitei Q9HAR2.

Polymorphism databases

DMDMi 47116772.

Proteomic databases

PaxDbi Q9HAR2.
PRIDEi Q9HAR2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000512091 ; ENSP00000423388 ; ENSG00000150471 . [Q9HAR2-2 ]
ENST00000570545 ; ENSP00000459702 ; ENSG00000262515 . [Q9HAR2-2 ]
GeneIDi 23284.
KEGGi hsa:23284.
UCSCi uc003hcq.4. human. [Q9HAR2-2 ]
uc003hcs.1. human. [Q9HAR2-3 ]
uc003hct.3. human. [Q9HAR2-1 ]

Organism-specific databases

CTDi 23284.
GeneCardsi GC04P062070.
H-InvDB HIX0004247.
HGNCi HGNC:20974. LPHN3.
HPAi CAB022698.
HPA015027.
HPA015762.
neXtProti NX_Q9HAR2.
PharmGKBi PA134968284.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG253931.
HOGENOMi HOG000049065.
HOVERGENi HBG052337.
InParanoidi Q9HAR2.
KOi K04594.
PhylomeDBi Q9HAR2.

Miscellaneous databases

ChiTaRSi LPHN3. human.
GenomeRNAii 23284.
NextBioi 45084.
PROi Q9HAR2.

Gene expression databases

ArrayExpressi Q9HAR2.
Bgeei Q9HAR2.
CleanExi HS_LPHN3.
Genevestigatori Q9HAR2.

Family and domain databases

InterProi IPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view ]
PANTHERi PTHR12011:SF60. PTHR12011:SF60. 1 hit.
Pfami PF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTi SM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view ]
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Douangpanya J., Puri K., Hayflick J.
    Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 279-707 (ISOFORM 3).
    Tissue: Colon.
  3. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 576-1447 (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: VARIANTS SER-247; GLN-465; MET-770 AND VAL-915.

Entry informationi

Entry nameiLPHN3_HUMAN
AccessioniPrimary (citable) accession number: Q9HAR2
Secondary accession number(s): O94867, Q9NWK5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: April 16, 2014
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi