Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9HAR2 (LPHN3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Latrophilin-3
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 3
Short name=CIRL-3
Lectomedin-3
Gene names
Name:LPHN3
Synonyms:KIAA0768, LEC3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1447 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85) By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Post-translational modification

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit By similarity.

Sequence similarities

Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.

Contains 1 GPS domain.

Contains 1 olfactomedin-like domain.

Contains 1 SUEL-type lectin domain.

Sequence caution

The sequence BAA91375.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9HAR2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9HAR2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     623-623: K → KLQKRERSCRAYVQ
     1050-1050: I → INYEDNRPFI
     1183-1218: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1219-1447: Missing.
Isoform 3 (identifier: Q9HAR2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     668-707: ADNLLKTDIV...EDLKFPENMG → VLQVCLPVRE...PLKFRLAKNK
     708-1447: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Potential
Chain20 – 14471428Latrophilin-3
PRO_0000012913

Regions

Topological domain20 – 866847Extracellular Potential
Transmembrane867 – 88923Helical; Name=1; Potential
Topological domain890 – 90112Cytoplasmic Potential
Transmembrane902 – 91918Helical; Name=2; Potential
Topological domain920 – 93314Extracellular Potential
Transmembrane934 – 95623Helical; Name=3; Potential
Topological domain957 – 96812Cytoplasmic Potential
Transmembrane969 – 98820Helical; Name=4; Potential
Topological domain989 – 100719Extracellular Potential
Transmembrane1008 – 103023Helical; Name=5; Potential
Topological domain1031 – 104919Cytoplasmic Potential
Transmembrane1050 – 107223Helical; Name=6; Potential
Topological domain1073 – 10819Extracellular Potential
Transmembrane1082 – 110423Helical; Name=7; Potential
Topological domain1105 – 1447343Cytoplasmic Potential
Domain35 – 12490SUEL-type lectin
Domain134 – 393260Olfactomedin-like
Domain802 – 85352GPS

Sites

Site841 – 8422Cleavage By similarity

Amino acid modifications

Glycosylation931N-linked (GlcNAc...) Potential
Glycosylation4641N-linked (GlcNAc...) Potential
Glycosylation5491N-linked (GlcNAc...) Potential
Glycosylation7461N-linked (GlcNAc...) Potential
Glycosylation7591N-linked (GlcNAc...) Potential
Glycosylation8041N-linked (GlcNAc...) Potential
Glycosylation8301N-linked (GlcNAc...) Potential
Glycosylation10761N-linked (GlcNAc...) Potential
Disulfide bond135 ↔ 317 By similarity

Natural variations

Alternative sequence6231K → KLQKRERSCRAYVQ in isoform 2.
VSP_010235
Alternative sequence668 – 70740ADNLL…PENMG → VLQVCLPVREQSFLPFFSFF IFFFSFLPFIPLKFRLAKNK in isoform 3.
VSP_010236
Alternative sequence708 – 1447740Missing in isoform 3.
VSP_010237
Alternative sequence10501I → INYEDNRPFI in isoform 2.
VSP_010238
Alternative sequence1183 – 121836GLLNN…YLSNC → PYRETSMGVKLNIAYQIGAS EQCQGYKCHGYSTTEW in isoform 2.
VSP_010239
Alternative sequence1219 – 1447229Missing in isoform 2.
VSP_010240
Natural variant2471A → S. Ref.4
VAR_064477
Natural variant4651R → Q. Ref.4
Corresponds to variant rs35106420 [ dbSNP | Ensembl ].
VAR_055934
Natural variant7701T → M. Ref.4
VAR_064478
Natural variant9151L → V. Ref.4
VAR_064479

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 10, 2004. Version 2.
Checksum: 54B7E7DBE516447A

FASTA1,447161,812
        10         20         30         40         50         60 
MWPSQLLIFM MLLAPIIHAF SRAPIPMAVV RRELSCESYP IELRCPGTDV IMIESANYGR 

        70         80         90        100        110        120 
TDDKICDSDP AQMENIRCYL PDAYKIMSQR CNNRTQCAVV AGPDVFPDPC PGTYKYLEVQ 

       130        140        150        160        170        180 
YECVPYKVEQ KVFLCPGLLK GVYQSEHLFE SDHQSGAWCK DPLQASDKIY YMPWTPYRTD 

       190        200        210        220        230        240 
TLTEYSSKDD FIAGRPTTTY KLPHRVDGTG FVVYDGALFF NKERTRNIVK FDLRTRIKSG 

       250        260        270        280        290        300 
EAIIANANYH DTSPYRWGGK SDIDLAVDEN GLWVIYATEQ NNGKIVISQL NPYTLRIEGT 

       310        320        330        340        350        360 
WDTAYDKRSA SNAFMICGIL YVVKSVYEDD DNEATGNKID YIYNTDQSKD SLVDVPFPNS 

       370        380        390        400        410        420 
YQYIAAVDYN PRDNLLYVWN NYHVVKYSLD FGPLDSRSGQ AHHGQVSYIS PPIHLDSELE 

       430        440        450        460        470        480 
RPSVKDISTT GPLGMGSTTT STTLRTTTLS PGRSTTPSVS GRRNRSTSTP SPAVEVLDDM 

       490        500        510        520        530        540 
TTHLPSASSQ IPALEESCEA VEAREIMWFK TRQGQIAKQP CPAGTIGVST YLCLAPDGIW 

       550        560        570        580        590        600 
DPQGPDLSNC SSPWVNHITQ KLKSGETAAN IARELAEQTR NHLNAGDITY SVRAMDQLVG 

       610        620        630        640        650        660 
LLDVQLRNLT PGGKDSAARS LNKAMVETVN NLLQPQALNA WRDLTTSDQL RAATMLLHTV 

       670        680        690        700        710        720 
EESAFVLADN LLKTDIVREN TDNIKLEVAR LSTEGNLEDL KFPENMGHGS TIQLSANTLK 

       730        740        750        760        770        780 
QNGRNGEIRV AFVLYNNLGP YLSTENASMK LGTEALSTNH SVIVNSPVIT AAINKEFSNK 

       790        800        810        820        830        840 
VYLADPVVFT VKHIKQSEEN FNPNCSFWSY SKRTMTGYWS TQGCRLLTTN KTHTTCSCNH 

       850        860        870        880        890        900 
LTNFAVLMAH VEVKHSDAVH DLLLDVITWV GILLSLVCLL ICIFTFCFFR GLQSDRNTIH 

       910        920        930        940        950        960 
KNLCISLFVA ELLFLIGINR TDQPIACAVF AALLHFFFLA AFTWMFLEGV QLYIMLVEVF 

       970        980        990       1000       1010       1020 
ESEHSRRKYF YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW LRLDTYFIWS FIGPATLIIM 

      1030       1040       1050       1060       1070       1080 
LNVIFLGIAL YKMFHHTAIL KPESGCLDNI KSWVIGAIAL LCLLGLTWAF GLMYINESTV 

      1090       1100       1110       1120       1130       1140 
IMAYLFTIFN SLQGMFIFIF HCVLQKKVRK EYGKCLRTHC CSGKSTESSI GSGKTSGSRT 

      1150       1160       1170       1180       1190       1200 
PGRYSTGSQS RIRRMWNDTV RKQSESSFIT GDINSSASLN REGLLNNARD TSVMDTLPLN 

      1210       1220       1230       1240       1250       1260 
GNHGNSYSIA SGEYLSNCVQ IIDRGYNHNE TALEKKILKE LTSNYIPSYL NNHERSSEQN 

      1270       1280       1290       1300       1310       1320 
RNLMNKLVNN LGSGREDDAI VLDDATSFNH EESLGLELIH EESDAPLLPP RVYSTENHQP 

      1330       1340       1350       1360       1370       1380 
HHYTRRRIPQ DHSESFFPLL TNEHTEDLQS PHRDSLYTSM PTLAGVAATE SVTTSTQTEP 

      1390       1400       1410       1420       1430       1440 
PPAKCGDAED VYYKSMPNLG SRNHVHQLHT YYQLGRGSSD GFIVPPNKDG TPPEGSSKGP 


AHLVTSL 

« Hide

Isoform 2 [UniParc].

Checksum: E357F856B07AE142
Show »

FASTA1,240139,280
Isoform 3 [UniParc].

Checksum: 0AB57B9A7361496E
Show »

FASTA70779,337

References

« Hide 'large scale' references
[1]Douangpanya J., Puri K., Hayflick J.
Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 279-707 (ISOFORM 3).
Tissue: Colon.
[3]"Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 576-1447 (ISOFORM 1).
Tissue: Brain.
[4]"Screening of human LPHN3 for variants with a potential impact on ADHD susceptibility."
Domene S., Stanescu H., Wallis D., Tinloy B., Pineda D.E., Kleta R., Arcos-Burgos M., Roessler E., Muenke M.
Am. J. Med. Genet. B Neuropsychiatr. Genet. 156:11-18(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS SER-247; GLN-465; MET-770 AND VAL-915.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF307080 mRNA. Translation: AAG27462.1.
AK000781 mRNA. Translation: BAA91375.1. Different initiation.
AB018311 mRNA. Translation: BAA34488.1.
RefSeqNP_056051.2. NM_015236.4.
UniGeneHs.28391.
Hs.570770.

3D structure databases

ProteinModelPortalQ9HAR2.
SMRQ9HAR2. Positions 25-129, 498-841, 866-1104.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116882. 1 interaction.
IntActQ9HAR2. 1 interaction.
STRING9606.ENSP00000295349.

Protein family/group databases

MEROPSS63.014.
GPCRDBSearch...

PTM databases

PhosphoSiteQ9HAR2.

Polymorphism databases

DMDM47116772.

Proteomic databases

PaxDbQ9HAR2.
PRIDEQ9HAR2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000512091; ENSP00000423388; ENSG00000150471. [Q9HAR2-2]
ENST00000570545; ENSP00000459702; ENSG00000262515. [Q9HAR2-2]
GeneID23284.
KEGGhsa:23284.
UCSCuc003hcq.4. human. [Q9HAR2-2]
uc003hcs.1. human. [Q9HAR2-3]
uc003hct.3. human. [Q9HAR2-1]

Organism-specific databases

CTD23284.
GeneCardsGC04P062070.
H-InvDBHIX0004247.
HGNCHGNC:20974. LPHN3.
HPACAB022698.
HPA015027.
HPA015762.
neXtProtNX_Q9HAR2.
PharmGKBPA134968284.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG253931.
HOGENOMHOG000049065.
HOVERGENHBG052337.
InParanoidQ9HAR2.
KOK04594.
PhylomeDBQ9HAR2.

Gene expression databases

ArrayExpressQ9HAR2.
BgeeQ9HAR2.
CleanExHS_LPHN3.
GenevestigatorQ9HAR2.

Family and domain databases

InterProIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view]
PANTHERPTHR12011:SF60. PTHR12011:SF60. 1 hit.
PfamPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSLPHN3. human.
GenomeRNAi23284.
NextBio45084.
PROQ9HAR2.

Entry information

Entry nameLPHN3_HUMAN
AccessionPrimary (citable) accession number: Q9HAR2
Secondary accession number(s): O94867, Q9NWK5
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: April 16, 2014
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries