Q9HAR2 (LPHN3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Latrophilin-3 Alternative name(s): Calcium-independent alpha-latrotoxin receptor 3 Short name=CIRL-3 Lectomedin-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1447 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Forms a heterodimer, consisting of a large extracellular region (p120) non-covalently linked to a seven-transmembrane moiety (p85) By similarity. |
| Subcellular location | |
| Post-translational modification | Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit By similarity. |
| Sequence similarities | Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. Contains 1 GPS domain. Contains 1 olfactomedin-like domain. Contains 1 SUEL-type lectin domain. |
| Sequence caution | The sequence BAA91375.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| Ligand | Lectin |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | neuropeptide signaling pathway Inferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Non-traceable author statement PubMed 10994649. Source: UniProtKB plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | G-protein coupled receptor activity Non-traceable author statement PubMed 10994649. Source: UniProtKB carbohydrate bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HAR2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HAR2-2) The sequence of this isoform differs from the canonical sequence as follows: 623-623: K → KLQKRERSCRAYVQ 1050-1050: I → INYEDNRPFI 1183-1218: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW 1219-1447: Missing. | ||||||
| Isoform 3 (identifier: Q9HAR2-3) The sequence of this isoform differs from the canonical sequence as follows: 668-707: ADNLLKTDIV...EDLKFPENMG → VLQVCLPVRE...PLKFRLAKNK 708-1447: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 1447 | 1428 | Latrophilin-3 | PRO_0000012913 | |||||||
Regions | |||||||||||
| Topological domain | 20 – 866 | 847 | Extracellular Potential | ||||||||
| Transmembrane | 867 – 889 | 23 | Helical; Name=1; Potential | ||||||||
| Topological domain | 890 – 901 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 902 – 919 | 18 | Helical; Name=2; Potential | ||||||||
| Topological domain | 920 – 933 | 14 | Extracellular Potential | ||||||||
| Transmembrane | 934 – 956 | 23 | Helical; Name=3; Potential | ||||||||
| Topological domain | 957 – 968 | 12 | Cytoplasmic Potential | ||||||||
| Transmembrane | 969 – 988 | 20 | Helical; Name=4; Potential | ||||||||
| Topological domain | 989 – 1007 | 19 | Extracellular Potential | ||||||||
| Transmembrane | 1008 – 1030 | 23 | Helical; Name=5; Potential | ||||||||
| Topological domain | 1031 – 1049 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 1050 – 1072 | 23 | Helical; Name=6; Potential | ||||||||
| Topological domain | 1073 – 1081 | 9 | Extracellular Potential | ||||||||
| Transmembrane | 1082 – 1104 | 23 | Helical; Name=7; Potential | ||||||||
| Topological domain | 1105 – 1447 | 343 | Cytoplasmic Potential | ||||||||
| Domain | 35 – 124 | 90 | SUEL-type lectin | ||||||||
| Domain | 134 – 393 | 260 | Olfactomedin-like | ||||||||
| Domain | 802 – 853 | 52 | GPS | ||||||||
Sites | |||||||||||
| Site | 841 – 842 | 2 | Cleavage By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 1445 | 1 | Phosphothreonine By similarity | ||||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 464 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 549 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 746 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 759 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 804 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 830 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1076 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 135 ↔ 317 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 623 | 1 | K → KLQKRERSCRAYVQ in isoform 2. | VSP_010235 | |||||||
| Alternative sequence | 668 – 707 | 40 | ADNLL…PENMG → VLQVCLPVREQSFLPFFSFF IFFFSFLPFIPLKFRLAKNK in isoform 3. | VSP_010236 | |||||||
| Alternative sequence | 708 – 1447 | 740 | Missing in isoform 3. | VSP_010237 | |||||||
| Alternative sequence | 1050 | 1 | I → INYEDNRPFI in isoform 2. | VSP_010238 | |||||||
| Alternative sequence | 1183 – 1218 | 36 | GLLNN…YLSNC → PYRETSMGVKLNIAYQIGAS EQCQGYKCHGYSTTEW in isoform 2. | VSP_010239 | |||||||
| Alternative sequence | 1219 – 1447 | 229 | Missing in isoform 2. | VSP_010240 | |||||||
| Natural variant | 247 | 1 | A → S. Ref.4 | VAR_064477 | |||||||
| Natural variant | 465 | 1 | R → Q. Ref.4 Corresponds to variant rs35106420 [ dbSNP | Ensembl ]. | VAR_055934 | |||||||
| Natural variant | 770 | 1 | T → M. Ref.4 | VAR_064478 | |||||||
| Natural variant | 915 | 1 | L → V. Ref.4 | VAR_064479 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Douangpanya J., Puri K., Hayflick J. Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 279-707 (ISOFORM 3). Tissue: Colon. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 576-1447 (ISOFORM 1). Tissue: Brain. |
| [4] | "Screening of human LPHN3 for variants with a potential impact on ADHD susceptibility." Domene S., Stanescu H., Wallis D., Tinloy B., Pineda D.E., Kleta R., Arcos-Burgos M., Roessler E., Muenke M. Am. J. Med. Genet. B Neuropsychiatr. Genet. 0:0-0(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SER-247; GLN-465; MET-770 AND VAL-915. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF307080 mRNA. Translation: AAG27462.1. AK000781 mRNA. Translation: BAA91375.1. Different initiation. AB018311 mRNA. Translation: BAA34488.1. |
| IPI | IPI00162547. IPI00410312. IPI00965650. |
| RefSeq | NP_056051.2. NM_015236.4. |
| UniGene | Hs.28391. Hs.570770. |
3D structure databases | |
| ProteinModelPortal | Q9HAR2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9HAR2. 1 interaction. |
| STRING | 9606.ENSP00000295349. |
Protein family/group databases | |
| MEROPS | S63.014. |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | Q9HAR2. |
Polymorphism databases | |
| DMDM | 47116772. |
Proteomic databases | |
| PaxDb | Q9HAR2. |
| PRIDE | Q9HAR2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000512091; ENSP00000423388; ENSG00000150471. ENST00000570545; ENSP00000459702; ENSG00000262515. |
| GeneID | 23284. |
| KEGG | hsa:23284. |
| UCSC | uc003hcq.4. human. uc003hct.3. human. uc010ihg.1. human. |
Organism-specific databases | |
| CTD | 23284. |
| GeneCards | GC04P062070. |
| H-InvDB | HIX0004247. |
| HGNC | HGNC:20974. LPHN3. |
| HPA | CAB022698. HPA015027. HPA015762. |
| neXtProt | NX_Q9HAR2. |
| PharmGKB | PA134968284. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG253931. |
| HOGENOM | HOG000049065. |
| HOVERGEN | HBG052337. |
| InParanoid | Q9HAR2. |
| KO | K04594. |
Gene expression databases | |
| ArrayExpress | Q9HAR2. |
| Bgee | Q9HAR2. |
| CleanEx | HS_LPHN3. |
| Genevestigator | Q9HAR2. |
Family and domain databases | |
| InterPro | IPR022624. DUF3497. IPR017981. GPCR_2-like. IPR001879. GPCR_2_extracellular_dom. IPR003924. GPCR_2_latrophilin. IPR015630. GPCR_2_latrophilin3. IPR003334. GPCR_2_latrophilin_rcpt_C. IPR000832. GPCR_2_secretin-like. IPR017983. GPCR_2_secretin-like_CS. IPR000203. GPS_dom. IPR000922. Lectin_gal-bd_dom. IPR003112. Olfac-like. [Graphical view] |
| PANTHER | PTHR12011:SF60. PTHR12011:SF60. 1 hit. |
| Pfam | PF00002. 7tm_2. 1 hit. PF12003. DUF3497. 1 hit. PF02140. Gal_Lectin. 1 hit. PF01825. GPS. 1 hit. PF02793. HRM. 1 hit. PF02354. Latrophilin. 2 hits. PF02191. OLF. 1 hit. [Graphical view] |
| PRINTS | PR00249. GPCRSECRETIN. PR01444. LATROPHILIN. |
| SMART | SM00303. GPS. 1 hit. SM00008. HormR. 1 hit. SM00284. OLF. 1 hit. [Graphical view] |
| PROSITE | PS00649. G_PROTEIN_RECEP_F2_1. False negative. PS00650. G_PROTEIN_RECEP_F2_2. 1 hit. PS50227. G_PROTEIN_RECEP_F2_3. 1 hit. PS50261. G_PROTEIN_RECEP_F2_4. 1 hit. PS50221. GPS. 1 hit. PS51132. OLF. 1 hit. PS50228. SUEL_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LPHN3. human. |
| GenomeRNAi | 23284. |
| NextBio | 45084. |
Entry information
| Entry name | LPHN3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HAR2 Secondary accession number(s): O94867, Q9NWK5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
