Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HAR2

- LPHN3_HUMAN

UniProt

Q9HAR2 - LPHN3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Latrophilin-3

Gene

LPHN3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be involved in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei841 – 8422CleavageBy similarity

GO - Molecular functioni

  1. carbohydrate binding Source: UniProtKB-KW
  2. G-protein coupled receptor activity Source: UniProtKB

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: UniProtKB
  2. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Lectin

Protein family/group databases

MEROPSiS63.014.

Names & Taxonomyi

Protein namesi
Recommended name:
Latrophilin-3
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 3
Short name:
CIRL-3
Lectomedin-3
Gene namesi
Name:LPHN3
Synonyms:KIAA0768, LEC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:20974. LPHN3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 866847ExtracellularSequence AnalysisAdd
BLAST
Transmembranei867 – 88923Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini890 – 90112CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei902 – 91918Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini920 – 93314ExtracellularSequence AnalysisAdd
BLAST
Transmembranei934 – 95623Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini957 – 96812CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei969 – 98820Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini989 – 100719ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1008 – 103023Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini1031 – 104919CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei1050 – 107223Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini1073 – 10819ExtracellularSequence Analysis
Transmembranei1082 – 110423Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini1105 – 1447343CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134968284.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 14471428Latrophilin-3PRO_0000012913Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi93 – 931N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi135 ↔ 317PROSITE-ProRule annotation
Glycosylationi464 – 4641N-linked (GlcNAc...)Sequence Analysis
Glycosylationi549 – 5491N-linked (GlcNAc...)Sequence Analysis
Glycosylationi746 – 7461N-linked (GlcNAc...)Sequence Analysis
Glycosylationi759 – 7591N-linked (GlcNAc...)Sequence Analysis
Glycosylationi804 – 8041N-linked (GlcNAc...)Sequence Analysis
Glycosylationi830 – 8301N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1076 – 10761N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity
O-glycosylated (major) and N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9HAR2.
PRIDEiQ9HAR2.

PTM databases

PhosphoSiteiQ9HAR2.

Expressioni

Gene expression databases

BgeeiQ9HAR2.
CleanExiHS_LPHN3.
ExpressionAtlasiQ9HAR2. baseline and differential.
GenevestigatoriQ9HAR2.

Organism-specific databases

HPAiCAB022698.
HPA015027.
HPA015762.

Interactioni

Subunit structurei

Interacts with FLRT3 and TEN1.By similarity

Protein-protein interaction databases

BioGridi116882. 2 interactions.
IntActiQ9HAR2. 1 interaction.
STRINGi9606.ENSP00000295349.

Structurei

3D structure databases

ProteinModelPortaliQ9HAR2.
SMRiQ9HAR2. Positions 25-129.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 12490SUEL-type lectinPROSITE-ProRule annotationAdd
BLAST
Domaini134 – 393260Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST
Domaini802 – 85352GPSPROSITE-ProRule annotationAdd
BLAST

Domaini

The Olfactomedin-like domain is required for the synapse-promoting function and the interaction with FLRT3. The Olfactomedin-like and the SUEL-type lectin domains are required for the interaction with TEN1 (By similarity).By similarity

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation
Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation
Contains 1 SUEL-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253931.
GeneTreeiENSGT00760000118787.
HOGENOMiHOG000049065.
HOVERGENiHBG052337.
InParanoidiQ9HAR2.
KOiK04594.
PhylomeDBiQ9HAR2.
TreeFamiTF351999.

Family and domain databases

InterProiIPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view]
PANTHERiPTHR12011:SF60. PTHR12011:SF60. 1 hit.
PfamiPF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTiSM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HAR2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWPSQLLIFM MLLAPIIHAF SRAPIPMAVV RRELSCESYP IELRCPGTDV
60 70 80 90 100
IMIESANYGR TDDKICDSDP AQMENIRCYL PDAYKIMSQR CNNRTQCAVV
110 120 130 140 150
AGPDVFPDPC PGTYKYLEVQ YECVPYKVEQ KVFLCPGLLK GVYQSEHLFE
160 170 180 190 200
SDHQSGAWCK DPLQASDKIY YMPWTPYRTD TLTEYSSKDD FIAGRPTTTY
210 220 230 240 250
KLPHRVDGTG FVVYDGALFF NKERTRNIVK FDLRTRIKSG EAIIANANYH
260 270 280 290 300
DTSPYRWGGK SDIDLAVDEN GLWVIYATEQ NNGKIVISQL NPYTLRIEGT
310 320 330 340 350
WDTAYDKRSA SNAFMICGIL YVVKSVYEDD DNEATGNKID YIYNTDQSKD
360 370 380 390 400
SLVDVPFPNS YQYIAAVDYN PRDNLLYVWN NYHVVKYSLD FGPLDSRSGQ
410 420 430 440 450
AHHGQVSYIS PPIHLDSELE RPSVKDISTT GPLGMGSTTT STTLRTTTLS
460 470 480 490 500
PGRSTTPSVS GRRNRSTSTP SPAVEVLDDM TTHLPSASSQ IPALEESCEA
510 520 530 540 550
VEAREIMWFK TRQGQIAKQP CPAGTIGVST YLCLAPDGIW DPQGPDLSNC
560 570 580 590 600
SSPWVNHITQ KLKSGETAAN IARELAEQTR NHLNAGDITY SVRAMDQLVG
610 620 630 640 650
LLDVQLRNLT PGGKDSAARS LNKAMVETVN NLLQPQALNA WRDLTTSDQL
660 670 680 690 700
RAATMLLHTV EESAFVLADN LLKTDIVREN TDNIKLEVAR LSTEGNLEDL
710 720 730 740 750
KFPENMGHGS TIQLSANTLK QNGRNGEIRV AFVLYNNLGP YLSTENASMK
760 770 780 790 800
LGTEALSTNH SVIVNSPVIT AAINKEFSNK VYLADPVVFT VKHIKQSEEN
810 820 830 840 850
FNPNCSFWSY SKRTMTGYWS TQGCRLLTTN KTHTTCSCNH LTNFAVLMAH
860 870 880 890 900
VEVKHSDAVH DLLLDVITWV GILLSLVCLL ICIFTFCFFR GLQSDRNTIH
910 920 930 940 950
KNLCISLFVA ELLFLIGINR TDQPIACAVF AALLHFFFLA AFTWMFLEGV
960 970 980 990 1000
QLYIMLVEVF ESEHSRRKYF YLVGYGMPAL IVAVSAAVDY RSYGTDKVCW
1010 1020 1030 1040 1050
LRLDTYFIWS FIGPATLIIM LNVIFLGIAL YKMFHHTAIL KPESGCLDNI
1060 1070 1080 1090 1100
KSWVIGAIAL LCLLGLTWAF GLMYINESTV IMAYLFTIFN SLQGMFIFIF
1110 1120 1130 1140 1150
HCVLQKKVRK EYGKCLRTHC CSGKSTESSI GSGKTSGSRT PGRYSTGSQS
1160 1170 1180 1190 1200
RIRRMWNDTV RKQSESSFIT GDINSSASLN REGLLNNARD TSVMDTLPLN
1210 1220 1230 1240 1250
GNHGNSYSIA SGEYLSNCVQ IIDRGYNHNE TALEKKILKE LTSNYIPSYL
1260 1270 1280 1290 1300
NNHERSSEQN RNLMNKLVNN LGSGREDDAI VLDDATSFNH EESLGLELIH
1310 1320 1330 1340 1350
EESDAPLLPP RVYSTENHQP HHYTRRRIPQ DHSESFFPLL TNEHTEDLQS
1360 1370 1380 1390 1400
PHRDSLYTSM PTLAGVAATE SVTTSTQTEP PPAKCGDAED VYYKSMPNLG
1410 1420 1430 1440
SRNHVHQLHT YYQLGRGSSD GFIVPPNKDG TPPEGSSKGP AHLVTSL
Length:1,447
Mass (Da):161,812
Last modified:May 10, 2004 - v2
Checksum:i54B7E7DBE516447A
GO
Isoform 2 (identifier: Q9HAR2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     623-623: K → KLQKRERSCRAYVQ
     1050-1050: I → INYEDNRPFI
     1183-1218: GLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC → PYRETSMGVKLNIAYQIGASEQCQGYKCHGYSTTEW
     1219-1447: Missing.

Show »
Length:1,240
Mass (Da):139,280
Checksum:iE357F856B07AE142
GO
Isoform 3 (identifier: Q9HAR2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     668-707: ADNLLKTDIV...EDLKFPENMG → VLQVCLPVRE...PLKFRLAKNK
     708-1447: Missing.

Note: No experimental confirmation available.

Show »
Length:707
Mass (Da):79,337
Checksum:i0AB57B9A7361496E
GO
Isoform 4 (identifier: Q9HAR2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     623-623: K → KLQKRERSCRAYVQ
     1050-1050: I → INYEDNRPFI

Show »
Length:1,469
Mass (Da):164,580
Checksum:i660D0446D584C7F4
GO

Sequence cautioni

The sequence BAA91375.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti247 – 2471A → S.1 Publication
VAR_064477
Natural varianti465 – 4651R → Q.1 Publication
Corresponds to variant rs35106420 [ dbSNP | Ensembl ].
VAR_055934
Natural varianti770 – 7701T → M.1 Publication
VAR_064478
Natural varianti915 – 9151L → V.1 Publication
VAR_064479

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei623 – 6231K → KLQKRERSCRAYVQ in isoform 2 and isoform 4. 1 PublicationVSP_010235
Alternative sequencei668 – 70740ADNLL…PENMG → VLQVCLPVREQSFLPFFSFF IFFFSFLPFIPLKFRLAKNK in isoform 3. 1 PublicationVSP_010236Add
BLAST
Alternative sequencei708 – 1447740Missing in isoform 3. 1 PublicationVSP_010237Add
BLAST
Alternative sequencei1050 – 10501I → INYEDNRPFI in isoform 2 and isoform 4. 1 PublicationVSP_010238
Alternative sequencei1183 – 121836GLLNN…YLSNC → PYRETSMGVKLNIAYQIGAS EQCQGYKCHGYSTTEW in isoform 2. 1 PublicationVSP_010239Add
BLAST
Alternative sequencei1219 – 1447229Missing in isoform 2. 1 PublicationVSP_010240Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF307080 mRNA. Translation: AAG27462.1.
AK000781 mRNA. Translation: BAA91375.1. Different initiation.
AC007511 Genomic DNA. No translation available.
AC020741 Genomic DNA. No translation available.
AC092643 Genomic DNA. No translation available.
AC092663 Genomic DNA. No translation available.
AC092668 Genomic DNA. No translation available.
AC096723 Genomic DNA. No translation available.
AC104813 Genomic DNA. No translation available.
AC108161 Genomic DNA. No translation available.
AB018311 mRNA. Translation: BAA34488.1.
RefSeqiNP_056051.2. NM_015236.4. [Q9HAR2-4]
UniGeneiHs.28391.
Hs.570770.

Genome annotation databases

EnsembliENST00000512091; ENSP00000423388; ENSG00000150471. [Q9HAR2-2]
ENST00000514591; ENSP00000422533; ENSG00000150471. [Q9HAR2-4]
GeneIDi23284.
KEGGihsa:23284.
UCSCiuc003hcq.4. human. [Q9HAR2-2]
uc003hcs.1. human. [Q9HAR2-3]
uc003hct.3. human. [Q9HAR2-1]

Polymorphism databases

DMDMi47116772.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF307080 mRNA. Translation: AAG27462.1 .
AK000781 mRNA. Translation: BAA91375.1 . Different initiation.
AC007511 Genomic DNA. No translation available.
AC020741 Genomic DNA. No translation available.
AC092643 Genomic DNA. No translation available.
AC092663 Genomic DNA. No translation available.
AC092668 Genomic DNA. No translation available.
AC096723 Genomic DNA. No translation available.
AC104813 Genomic DNA. No translation available.
AC108161 Genomic DNA. No translation available.
AB018311 mRNA. Translation: BAA34488.1 .
RefSeqi NP_056051.2. NM_015236.4. [Q9HAR2-4 ]
UniGenei Hs.28391.
Hs.570770.

3D structure databases

ProteinModelPortali Q9HAR2.
SMRi Q9HAR2. Positions 25-129.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116882. 2 interactions.
IntActi Q9HAR2. 1 interaction.
STRINGi 9606.ENSP00000295349.

Protein family/group databases

MEROPSi S63.014.
GPCRDBi Search...

PTM databases

PhosphoSitei Q9HAR2.

Polymorphism databases

DMDMi 47116772.

Proteomic databases

PaxDbi Q9HAR2.
PRIDEi Q9HAR2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000512091 ; ENSP00000423388 ; ENSG00000150471 . [Q9HAR2-2 ]
ENST00000514591 ; ENSP00000422533 ; ENSG00000150471 . [Q9HAR2-4 ]
GeneIDi 23284.
KEGGi hsa:23284.
UCSCi uc003hcq.4. human. [Q9HAR2-2 ]
uc003hcs.1. human. [Q9HAR2-3 ]
uc003hct.3. human. [Q9HAR2-1 ]

Organism-specific databases

CTDi 23284.
GeneCardsi GC04P062070.
H-InvDB HIX0004247.
HGNCi HGNC:20974. LPHN3.
HPAi CAB022698.
HPA015027.
HPA015762.
neXtProti NX_Q9HAR2.
PharmGKBi PA134968284.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG253931.
GeneTreei ENSGT00760000118787.
HOGENOMi HOG000049065.
HOVERGENi HBG052337.
InParanoidi Q9HAR2.
KOi K04594.
PhylomeDBi Q9HAR2.
TreeFami TF351999.

Miscellaneous databases

ChiTaRSi LPHN3. human.
GenomeRNAii 23284.
NextBioi 45084.
PROi Q9HAR2.

Gene expression databases

Bgeei Q9HAR2.
CleanExi HS_LPHN3.
ExpressionAtlasi Q9HAR2. baseline and differential.
Genevestigatori Q9HAR2.

Family and domain databases

InterProi IPR022624. DUF3497.
IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR003924. GPCR_2_latrophilin.
IPR015630. GPCR_2_latrophilin3.
IPR003334. GPCR_2_latrophilin_rcpt_C.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR000922. Lectin_gal-bd_dom.
IPR003112. Olfac-like.
[Graphical view ]
PANTHERi PTHR12011:SF60. PTHR12011:SF60. 1 hit.
Pfami PF00002. 7tm_2. 1 hit.
PF12003. DUF3497. 1 hit.
PF02140. Gal_Lectin. 1 hit.
PF01825. GPS. 1 hit.
PF02793. HRM. 1 hit.
PF02354. Latrophilin. 2 hits.
PF02191. OLF. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
PR01444. LATROPHILIN.
SMARTi SM00303. GPS. 1 hit.
SM00008. HormR. 1 hit.
SM00284. OLF. 1 hit.
[Graphical view ]
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51132. OLF. 1 hit.
PS50228. SUEL_LECTIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Douangpanya J., Puri K., Hayflick J.
    Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 279-707 (ISOFORM 3).
    Tissue: Colon.
  4. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 576-1447 (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: VARIANTS SER-247; GLN-465; MET-770 AND VAL-915.

Entry informationi

Entry nameiLPHN3_HUMAN
AccessioniPrimary (citable) accession number: Q9HAR2
Secondary accession number(s): E9PE04, O94867, Q9NWK5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: November 26, 2014
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3