Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium homeostasis modulator protein 2

Gene

CALHM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Pore-forming subunit of a voltage-gated ion channel.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Transport

Protein family/group databases

TCDBi1.A.84.1.2. the calcium homeostasis modulator ca(2+) channel (calhm-c) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium homeostasis modulator protein 2
Alternative name(s):
Protein FAM26B
Gene namesi
Name:CALHM2
Synonyms:FAM26B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23493. CALHM2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei21 – 41HelicalSequence analysisAdd BLAST21
Transmembranei55 – 75HelicalSequence analysisAdd BLAST21
Transmembranei100 – 120HelicalSequence analysisAdd BLAST21
Transmembranei185 – 205HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi51063.
OpenTargetsiENSG00000138172.
PharmGKBiPA162380963.

Polymorphism and mutation databases

BioMutaiCALHM2.
DMDMi67461081.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001867201 – 323Calcium homeostasis modulator protein 2Add BLAST323

Proteomic databases

PaxDbiQ9HA72.
PeptideAtlasiQ9HA72.
PRIDEiQ9HA72.

PTM databases

SwissPalmiQ9HA72.

Expressioni

Gene expression databases

BgeeiENSG00000138172.
CleanExiHS_CALHM2.
GenevisibleiQ9HA72. HS.

Organism-specific databases

HPAiHPA014706.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000260743.

Structurei

3D structure databases

ProteinModelPortaliQ9HA72.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM26 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJ7Y. Eukaryota.
ENOG410XQ8H. LUCA.
GeneTreeiENSGT00530000062796.
HOGENOMiHOG000294134.
HOVERGENiHBG057802.
InParanoidiQ9HA72.
KOiK19739.
OMAiSAAPNFL.
OrthoDBiEOG091G0BN1.
PhylomeDBiQ9HA72.
TreeFamiTF329085.

Family and domain databases

InterProiIPR029570. CALHM2.
IPR029569. FAM26.
[Graphical view]
PANTHERiPTHR32261. PTHR32261. 1 hit.
PTHR32261:SF3. PTHR32261:SF3. 1 hit.
PfamiPF14798. Ca_hom_mod. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HA72-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALIAENFR FLSLFFKSKD VMIFNGLVAL GTVGSQELFS VVAFHCPCSP
60 70 80 90 100
ARNYLYGLAA IGVPALVLFI IGIILNNHTW NLVAECQHRR TKNCSAAPTF
110 120 130 140 150
LLLSSILGRA AVAPVTWSVI SLLRGEAYVC ALSEFVDPSS LTAREEHFPS
160 170 180 190 200
AHATEILARF PCKENPDNLS DFREEVSRRL RYESQLFGWL LIGVVAILVF
210 220 230 240 250
LTKCLKHYCS PLSYRQEAYW AQYRANEDQL FQRTAEVHSR VLAANNVRRF
260 270 280 290 300
FGFVALNKDD EELIANFPVE GTQPRPQWNA ITGVYLYREN QGLPLYSRLH
310 320
KWAQGLAGNG AAPDNVEMAL LPS
Length:323
Mass (Da):36,175
Last modified:March 1, 2001 - v1
Checksum:i20A4BC58F6763926
GO
Isoform 2 (identifier: Q9HA72-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     186-218: LFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEA → VRSCAKGSSSSLVVAGERSGDGLVLKLGLVLRG
     219-323: Missing.

Note: No experimental confirmation available.
Show »
Length:218
Mass (Da):23,718
Checksum:i569EBDD40662D5D5
GO
Isoform 3 (identifier: Q9HA72-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     181-196: RYESQLFGWLLIGVVA → SSLDGCSSAWWPSWCS
     197-323: Missing.

Note: No experimental confirmation available.
Show »
Length:196
Mass (Da):21,542
Checksum:i1523996B86D6DA74
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053084136V → G.Corresponds to variant rs2232660dbSNPEnsembl.1
Natural variantiVAR_033924194V → M.Corresponds to variant rs2232662dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013856181 – 196RYESQ…IGVVA → SSLDGCSSAWWPSWCS in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_013853186 – 218LFGWL…YRQEA → VRSCAKGSSSSLVVAGERSG DGLVLKLGLVLRG in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_013855197 – 323Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_013854219 – 323Missing in isoform 2. 1 PublicationAdd BLAST105

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022195 mRNA. Translation: BAB13983.1.
AK125276 mRNA. No translation available.
AF131810 mRNA. Translation: AAD20050.1.
AL139339 Genomic DNA. Translation: CAH71483.1.
CH471066 Genomic DNA. Translation: EAW49634.1.
CH471066 Genomic DNA. Translation: EAW49635.1.
CH471066 Genomic DNA. Translation: EAW49636.1.
CH471066 Genomic DNA. Translation: EAW49637.1.
CH471066 Genomic DNA. Translation: EAW49638.1.
BC000039 mRNA. Translation: AAH00039.1.
CCDSiCCDS7549.1. [Q9HA72-1]
RefSeqiNP_057000.2. NM_015916.4. [Q9HA72-1]
XP_006717943.1. XM_006717880.2. [Q9HA72-1]
XP_006717946.1. XM_006717883.2. [Q9HA72-1]
XP_006717947.1. XM_006717884.3. [Q9HA72-3]
XP_011538150.1. XM_011539848.2. [Q9HA72-1]
XP_016871795.1. XM_017016306.1. [Q9HA72-1]
XP_016871796.1. XM_017016307.1. [Q9HA72-1]
XP_016871797.1. XM_017016308.1. [Q9HA72-3]
XP_016871798.1. XM_017016309.1. [Q9HA72-3]
UniGeneiHs.241545.

Genome annotation databases

EnsembliENST00000260743; ENSP00000260743; ENSG00000138172. [Q9HA72-1]
ENST00000369788; ENSP00000358803; ENSG00000138172. [Q9HA72-1]
GeneIDi51063.
KEGGihsa:51063.
UCSCiuc001kxa.4. human. [Q9HA72-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022195 mRNA. Translation: BAB13983.1.
AK125276 mRNA. No translation available.
AF131810 mRNA. Translation: AAD20050.1.
AL139339 Genomic DNA. Translation: CAH71483.1.
CH471066 Genomic DNA. Translation: EAW49634.1.
CH471066 Genomic DNA. Translation: EAW49635.1.
CH471066 Genomic DNA. Translation: EAW49636.1.
CH471066 Genomic DNA. Translation: EAW49637.1.
CH471066 Genomic DNA. Translation: EAW49638.1.
BC000039 mRNA. Translation: AAH00039.1.
CCDSiCCDS7549.1. [Q9HA72-1]
RefSeqiNP_057000.2. NM_015916.4. [Q9HA72-1]
XP_006717943.1. XM_006717880.2. [Q9HA72-1]
XP_006717946.1. XM_006717883.2. [Q9HA72-1]
XP_006717947.1. XM_006717884.3. [Q9HA72-3]
XP_011538150.1. XM_011539848.2. [Q9HA72-1]
XP_016871795.1. XM_017016306.1. [Q9HA72-1]
XP_016871796.1. XM_017016307.1. [Q9HA72-1]
XP_016871797.1. XM_017016308.1. [Q9HA72-3]
XP_016871798.1. XM_017016309.1. [Q9HA72-3]
UniGeneiHs.241545.

3D structure databases

ProteinModelPortaliQ9HA72.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000260743.

Protein family/group databases

TCDBi1.A.84.1.2. the calcium homeostasis modulator ca(2+) channel (calhm-c) family.

PTM databases

SwissPalmiQ9HA72.

Polymorphism and mutation databases

BioMutaiCALHM2.
DMDMi67461081.

Proteomic databases

PaxDbiQ9HA72.
PeptideAtlasiQ9HA72.
PRIDEiQ9HA72.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000260743; ENSP00000260743; ENSG00000138172. [Q9HA72-1]
ENST00000369788; ENSP00000358803; ENSG00000138172. [Q9HA72-1]
GeneIDi51063.
KEGGihsa:51063.
UCSCiuc001kxa.4. human. [Q9HA72-1]

Organism-specific databases

CTDi51063.
DisGeNETi51063.
GeneCardsiCALHM2.
HGNCiHGNC:23493. CALHM2.
HPAiHPA014706.
MIMi612235. gene.
neXtProtiNX_Q9HA72.
OpenTargetsiENSG00000138172.
PharmGKBiPA162380963.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ7Y. Eukaryota.
ENOG410XQ8H. LUCA.
GeneTreeiENSGT00530000062796.
HOGENOMiHOG000294134.
HOVERGENiHBG057802.
InParanoidiQ9HA72.
KOiK19739.
OMAiSAAPNFL.
OrthoDBiEOG091G0BN1.
PhylomeDBiQ9HA72.
TreeFamiTF329085.

Miscellaneous databases

ChiTaRSiCALHM2. human.
GenomeRNAii51063.
PROiQ9HA72.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138172.
CleanExiHS_CALHM2.
GenevisibleiQ9HA72. HS.

Family and domain databases

InterProiIPR029570. CALHM2.
IPR029569. FAM26.
[Graphical view]
PANTHERiPTHR32261. PTHR32261. 1 hit.
PTHR32261:SF3. PTHR32261:SF3. 1 hit.
PfamiPF14798. Ca_hom_mod. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAHM2_HUMAN
AccessioniPrimary (citable) accession number: Q9HA72
Secondary accession number(s): D3DR94, O95893, Q6ZUV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2001
Last modified: November 2, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.