Q9HA72 (CAHM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium homeostasis modulator protein 2 Alternative name(s): Protein FAM26B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 323 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Pore-forming subunit of a voltage-gated ion channel By similarity. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the FAM26 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Ion channel |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | ion transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HA72-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HA72-2) The sequence of this isoform differs from the canonical sequence as follows: 186-218: LFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEA → VRSCAKGSSSSLVVAGERSGDGLVLKLGLVLRG 219-323: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9HA72-3) The sequence of this isoform differs from the canonical sequence as follows: 181-196: RYESQLFGWLLIGVVA → SSLDGCSSAWWPSWCS 197-323: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 323 | 323 | Calcium homeostasis modulator protein 2 | PRO_0000186720 | |||||
Regions | |||||||||
| Transmembrane | 21 – 41 | 21 | Helical; Potential | ||||||
| Transmembrane | 55 – 75 | 21 | Helical; Potential | ||||||
| Transmembrane | 100 – 120 | 21 | Helical; Potential | ||||||
| Transmembrane | 185 – 205 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 181 – 196 | 16 | RYESQ…IGVVA → SSLDGCSSAWWPSWCS in isoform 3. | VSP_013856 | |||||
| Alternative sequence | 186 – 218 | 33 | LFGWL…YRQEA → VRSCAKGSSSSLVVAGERSG DGLVLKLGLVLRG in isoform 2. | VSP_013853 | |||||
| Alternative sequence | 197 – 323 | 127 | Missing in isoform 3. | VSP_013855 | |||||
| Alternative sequence | 219 – 323 | 105 | Missing in isoform 2. | VSP_013854 | |||||
| Natural variant | 136 | 1 | V → G. Corresponds to variant rs2232660 [ dbSNP | Ensembl ]. | VAR_053084 | |||||
| Natural variant | 194 | 1 | V → M. Corresponds to variant rs2232662 [ dbSNP | Ensembl ]. | VAR_033924 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK022195 mRNA. Translation: BAB13983.1. AK125276 mRNA. No translation available. AF131810 mRNA. Translation: AAD20050.1. AL139339 Genomic DNA. Translation: CAH71483.1. CH471066 Genomic DNA. Translation: EAW49634.1. CH471066 Genomic DNA. Translation: EAW49635.1. CH471066 Genomic DNA. Translation: EAW49636.1. CH471066 Genomic DNA. Translation: EAW49637.1. CH471066 Genomic DNA. Translation: EAW49638.1. BC000039 mRNA. Translation: AAH00039.1. |
| IPI | IPI00153050. IPI00383878. IPI00445902. |
| RefSeq | NP_057000.2. NM_015916.4. |
| UniGene | Hs.241545. |
3D structure databases | |
| ProteinModelPortal | Q9HA72. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000260743. |
Polymorphism databases | |
| DMDM | 67461081. |
Proteomic databases | |
| PaxDb | Q9HA72. |
| PRIDE | Q9HA72. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000260743; ENSP00000260743; ENSG00000138172. ENST00000369788; ENSP00000358803; ENSG00000138172. ENST00000393235; ENSP00000376927; ENSG00000138172. |
| GeneID | 51063. |
| KEGG | hsa:51063. |
| UCSC | uc001kxa.3. human. uc001kxc.3. human. uc001kxd.1. human. |
Organism-specific databases | |
| CTD | 51063. |
| GeneCards | GC10M105206. |
| HGNC | HGNC:23493. CALHM2. |
| HPA | HPA014706. |
| MIM | 612235. gene. |
| neXtProt | NX_Q9HA72. |
| PharmGKB | PA162380963. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG68441. |
| HOGENOM | HOG000294134. |
| HOVERGEN | HBG057802. |
| InParanoid | Q9HA72. |
| OMA | SAAPNFL. |
| OrthoDB | EOG4CJVHG. |
Gene expression databases | |
| Bgee | Q9HA72. |
| CleanEx | HS_CALHM2. |
| Genevestigator | Q9HA72. |
| GermOnline | ENSG00000138172. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CALHM2. human. |
| GenomeRNAi | 51063. |
| NextBio | 53655. |
| SOURCE | Search... |
Entry information
| Entry name | CAHM2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HA72 Secondary accession number(s): D3DR94, O95893, Q6ZUV9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
