SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9HA47

- UCK1_HUMAN

UniProt

Q9HA47 - UCK1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Uridine-cytidine kinase 1

Gene
UCK1, URK1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.

Catalytic activityi

ATP + uridine = ADP + UMP.
ATP + cytidine = ADP + CMP.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei87 – 871Substrate By similarity
Binding sitei115 – 1151Substrate By similarity
Binding sitei120 – 1201Substrate By similarity
Binding sitei169 – 1691Substrate By similarity
Binding sitei178 – 1781Substrate By similarity
Binding sitei186 – 1861Substrate By similarity
Binding sitei215 – 2151ATP

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi30 – 389ATP

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. nucleoside kinase activity Source: Reactome
  3. uridine kinase activity Source: UniProtKB-EC

GO - Biological processi

  1. CTP salvage Source: UniProtKB-UniPathway
  2. nucleobase-containing small molecule metabolic process Source: Reactome
  3. pyrimidine nucleobase metabolic process Source: Reactome
  4. pyrimidine nucleoside salvage Source: Reactome
  5. small molecule metabolic process Source: Reactome
  6. UMP salvage Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS05429-MONOMER.
ReactomeiREACT_655. Pyrimidine salvage reactions.
SABIO-RKQ9HA47.
UniPathwayiUPA00574; UER00637.
UPA00579; UER00640.

Names & Taxonomyi

Protein namesi
Recommended name:
Uridine-cytidine kinase 1 (EC:2.7.1.48)
Short name:
UCK 1
Alternative name(s):
Cytidine monophosphokinase 1
Uridine monophosphokinase 1
Gene namesi
Name:UCK1
Synonyms:URK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:14859. UCK1.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134861770.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 277277Uridine-cytidine kinase 1PRO_0000164453Add
BLAST

Proteomic databases

MaxQBiQ9HA47.
PaxDbiQ9HA47.
PRIDEiQ9HA47.

PTM databases

PhosphoSiteiQ9HA47.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

ArrayExpressiQ9HA47.
BgeeiQ9HA47.
CleanExiHS_UCK1.
GenevestigatoriQ9HA47.

Organism-specific databases

HPAiHPA050969.

Interactioni

Protein-protein interaction databases

BioGridi123681. 4 interactions.
IntActiQ9HA47. 2 interactions.
MINTiMINT-1392002.
STRINGi9606.ENSP00000361289.

Structurei

Secondary structure

1
277
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi23 – 297
Helixi36 – 4611
Helixi49 – 513
Helixi54 – 563
Beta strandi58 – 636
Helixi64 – 674
Helixi73 – 808
Helixi89 – 913
Helixi94 – 10512
Beta strandi110 – 1123
Turni117 – 1204
Beta strandi127 – 1293
Beta strandi133 – 1386
Turni140 – 1434
Helixi146 – 1494
Beta strandi153 – 1597
Helixi162 – 17312
Helixi180 – 18910
Helixi191 – 1988
Helixi200 – 2056
Beta strandi207 – 2137
Helixi217 – 23216

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2JEOX-ray2.50A22-243[»]
2UVQX-ray3.00A22-243[»]
ProteinModelPortaliQ9HA47.
SMRiQ9HA47. Positions 22-235.

Miscellaneous databases

EvolutionaryTraceiQ9HA47.

Family & Domainsi

Sequence similaritiesi

Belongs to the uridine kinase family.

Phylogenomic databases

eggNOGiCOG0572.
HOGENOMiHOG000262756.
HOVERGENiHBG023339.
KOiK00876.
OrthoDBiEOG7Q8CP2.
PhylomeDBiQ9HA47.
TreeFamiTF316686.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR006083. PRK/URK.
IPR000764. Uridine_kinase_like.
[Graphical view]
PfamiPF00485. PRK. 1 hit.
[Graphical view]
PRINTSiPR00988. URIDINKINASE.
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00235. udk. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9HA47-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MASAGGEDCE SPAPEADRPH QRPFLIGVSG GTASGKSTVC EKIMELLGQN    50
EVEQRQRKVV ILSQDRFYKV LTAEQKAKAL KGQYNFDHPD AFDNDLMHRT 100
LKNIVEGKTV EVPTYDFVTH SRLPETTVVY PADVVLFEGI LVFYSQEIRD 150
MFHLRLFVDT DSDVRLSRRV LRDVRRGRDL EQILTQYTTF VKPAFEEFCL 200
PTKKYADVII PRGVDNMVAI NLIVQHIQDI LNGDICKWHR GGSNGRSYKR 250
TFSEPGDHPG MLTSGKRSHL ESSSRPH 277
Length:277
Mass (Da):31,435
Last modified:March 1, 2001 - v1
Checksum:iAFD9ED92780CD502
GO
Isoform 2 (identifier: Q9HA47-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-277: VLRDVRRGRD...SHLESSSRPH → DKEVCRCDHPARSGQYGCHQPDRAAHPGHSEW

Show »
Length:201
Mass (Da):22,761
Checksum:i0E5F2F00FF6052D3
GO
Isoform 3 (identifier: Q9HA47-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: Missing.

Show »
Length:268
Mass (Da):30,690
Checksum:i3944B9DCF2A0BAE3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei28 – 369Missing in isoform 3. VSP_045174
Alternative sequencei170 – 277108VLRDV…SSRPH → DKEVCRCDHPARSGQYGCHQ PDRAAHPGHSEW in isoform 2. VSP_041269Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti8 – 1710DCESPAPEAD → GARARAGAN in AAL75943. 1 Publication
Sequence conflicti56 – 572QR → HG in AAL75943. 1 Publication
Sequence conflicti175 – 1751R → H in CAG33562. 1 Publication
Sequence conflicti247 – 2471S → T in AAL75943. 1 Publication
Isoform 2 (identifier: Q9HA47-2)
Sequence conflicti180 – 1801A → T in AAH15547. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF237290 mRNA. Translation: AAK28324.1.
AF254133 mRNA. Translation: AAK49122.1.
AF125106 mRNA. Translation: AAL75943.1.
AK022317 mRNA. Translation: BAB14010.1.
AK295471 mRNA. Translation: BAG58400.1.
CR457281 mRNA. Translation: CAG33562.1.
AL358781 Genomic DNA. Translation: CAI40228.1.
AL358781 Genomic DNA. Translation: CAI40229.1.
AL358781 Genomic DNA. Translation: CAI40231.1.
CH471090 Genomic DNA. Translation: EAW87983.1.
BC015547 mRNA. Translation: AAH15547.1.
BC091495 mRNA. Translation: AAH91495.1.
CCDSiCCDS48046.1. [Q9HA47-2]
CCDS59151.1. [Q9HA47-3]
CCDS6944.1. [Q9HA47-1]
RefSeqiNP_001129426.1. NM_001135954.1. [Q9HA47-2]
NP_001248379.1. NM_001261450.1. [Q9HA47-3]
NP_001248380.1. NM_001261451.1.
NP_113620.1. NM_031432.2. [Q9HA47-1]
UniGeneiHs.9597.

Genome annotation databases

EnsembliENST00000372208; ENSP00000361282; ENSG00000130717. [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717. [Q9HA47-3]
ENST00000372215; ENSP00000361289; ENSG00000130717. [Q9HA47-1]
GeneIDi83549.
KEGGihsa:83549.
UCSCiuc004cay.3. human. [Q9HA47-1]
uc004cba.3. human. [Q9HA47-2]
uc010mzk.4. human.

Polymorphism databases

DMDMi20455360.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF237290 mRNA. Translation: AAK28324.1 .
AF254133 mRNA. Translation: AAK49122.1 .
AF125106 mRNA. Translation: AAL75943.1 .
AK022317 mRNA. Translation: BAB14010.1 .
AK295471 mRNA. Translation: BAG58400.1 .
CR457281 mRNA. Translation: CAG33562.1 .
AL358781 Genomic DNA. Translation: CAI40228.1 .
AL358781 Genomic DNA. Translation: CAI40229.1 .
AL358781 Genomic DNA. Translation: CAI40231.1 .
CH471090 Genomic DNA. Translation: EAW87983.1 .
BC015547 mRNA. Translation: AAH15547.1 .
BC091495 mRNA. Translation: AAH91495.1 .
CCDSi CCDS48046.1. [Q9HA47-2 ]
CCDS59151.1. [Q9HA47-3 ]
CCDS6944.1. [Q9HA47-1 ]
RefSeqi NP_001129426.1. NM_001135954.1. [Q9HA47-2 ]
NP_001248379.1. NM_001261450.1. [Q9HA47-3 ]
NP_001248380.1. NM_001261451.1.
NP_113620.1. NM_031432.2. [Q9HA47-1 ]
UniGenei Hs.9597.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2JEO X-ray 2.50 A 22-243 [» ]
2UVQ X-ray 3.00 A 22-243 [» ]
ProteinModelPortali Q9HA47.
SMRi Q9HA47. Positions 22-235.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123681. 4 interactions.
IntActi Q9HA47. 2 interactions.
MINTi MINT-1392002.
STRINGi 9606.ENSP00000361289.

Chemistry

ChEMBLi CHEMBL5682.

PTM databases

PhosphoSitei Q9HA47.

Polymorphism databases

DMDMi 20455360.

Proteomic databases

MaxQBi Q9HA47.
PaxDbi Q9HA47.
PRIDEi Q9HA47.

Protocols and materials databases

DNASUi 83549.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000372208 ; ENSP00000361282 ; ENSG00000130717 . [Q9HA47-2 ]
ENST00000372210 ; ENSP00000361284 ; ENSG00000130717 . [Q9HA47-3 ]
ENST00000372215 ; ENSP00000361289 ; ENSG00000130717 . [Q9HA47-1 ]
GeneIDi 83549.
KEGGi hsa:83549.
UCSCi uc004cay.3. human. [Q9HA47-1 ]
uc004cba.3. human. [Q9HA47-2 ]
uc010mzk.4. human.

Organism-specific databases

CTDi 83549.
GeneCardsi GC09M134399.
HGNCi HGNC:14859. UCK1.
HPAi HPA050969.
MIMi 609328. gene.
neXtProti NX_Q9HA47.
PharmGKBi PA134861770.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0572.
HOGENOMi HOG000262756.
HOVERGENi HBG023339.
KOi K00876.
OrthoDBi EOG7Q8CP2.
PhylomeDBi Q9HA47.
TreeFami TF316686.

Enzyme and pathway databases

UniPathwayi UPA00574 ; UER00637 .
UPA00579 ; UER00640 .
BioCyci MetaCyc:HS05429-MONOMER.
Reactomei REACT_655. Pyrimidine salvage reactions.
SABIO-RK Q9HA47.

Miscellaneous databases

ChiTaRSi UCK1. human.
EvolutionaryTracei Q9HA47.
GenomeRNAii 83549.
NextBioi 72489.
PROi Q9HA47.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9HA47.
Bgeei Q9HA47.
CleanExi HS_UCK1.
Genevestigatori Q9HA47.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR006083. PRK/URK.
IPR000764. Uridine_kinase_like.
[Graphical view ]
Pfami PF00485. PRK. 1 hit.
[Graphical view ]
PRINTSi PR00988. URIDINKINASE.
SUPFAMi SSF52540. SSF52540. 1 hit.
TIGRFAMsi TIGR00235. udk. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Phosphorylation of uridine and cytidine nucleoside analogs by two human uridine-cytidine kinases."
    Van Rompay A.R., Norda A., Linden K., Johansson M., Karlsson A.
    Mol. Pharmacol. 59:1181-1186(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
  2. "Human uridine kinase from prostate cancer cell line (LNCaP)."
    Ho Y.S., Johnson R.K.
    Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Cloning of a new human cDNA similar to Mus musculus uridine kinase mRNA."
    Xin Y.R., Yu L., Zhao S.Y.
    Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Hippocampus and Mammary gland.
  5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Colon.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Structure of human uridine-cytidine kinase 1."
    Northeast structural genomics consortium (NESG)
    Submitted (JAN-2007) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 22-243 IN COMPLEX WITH ADP.

Entry informationi

Entry nameiUCK1_HUMAN
AccessioniPrimary (citable) accession number: Q9HA47
Secondary accession number(s): Q5JT10
, Q5JT12, Q5JT13, Q6IA74, Q96BJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: September 3, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi