Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9HA47

- UCK1_HUMAN

UniProt

Q9HA47 - UCK1_HUMAN

Protein

Uridine-cytidine kinase 1

Gene

UCK1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.

    Catalytic activityi

    ATP + uridine = ADP + UMP.
    ATP + cytidine = ADP + CMP.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei87 – 871SubstrateBy similarity
    Binding sitei115 – 1151SubstrateBy similarity
    Binding sitei120 – 1201SubstrateBy similarity
    Binding sitei169 – 1691SubstrateBy similarity
    Binding sitei178 – 1781SubstrateBy similarity
    Binding sitei186 – 1861SubstrateBy similarity
    Binding sitei215 – 2151ATP

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi30 – 389ATP

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. nucleoside kinase activity Source: Reactome
    3. uridine kinase activity Source: UniProtKB-EC

    GO - Biological processi

    1. CTP salvage Source: UniProtKB-UniPathway
    2. nucleobase-containing small molecule metabolic process Source: Reactome
    3. pyrimidine nucleobase metabolic process Source: Reactome
    4. pyrimidine nucleoside salvage Source: Reactome
    5. small molecule metabolic process Source: Reactome
    6. UMP salvage Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS05429-MONOMER.
    ReactomeiREACT_655. Pyrimidine salvage reactions.
    SABIO-RKQ9HA47.
    UniPathwayiUPA00574; UER00637.
    UPA00579; UER00640.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Uridine-cytidine kinase 1 (EC:2.7.1.48)
    Short name:
    UCK 1
    Alternative name(s):
    Cytidine monophosphokinase 1
    Uridine monophosphokinase 1
    Gene namesi
    Name:UCK1
    Synonyms:URK1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:14859. UCK1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134861770.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 277277Uridine-cytidine kinase 1PRO_0000164453Add
    BLAST

    Proteomic databases

    MaxQBiQ9HA47.
    PaxDbiQ9HA47.
    PRIDEiQ9HA47.

    PTM databases

    PhosphoSiteiQ9HA47.

    Expressioni

    Tissue specificityi

    Ubiquitous.

    Gene expression databases

    ArrayExpressiQ9HA47.
    BgeeiQ9HA47.
    CleanExiHS_UCK1.
    GenevestigatoriQ9HA47.

    Organism-specific databases

    HPAiHPA050969.

    Interactioni

    Protein-protein interaction databases

    BioGridi123681. 4 interactions.
    IntActiQ9HA47. 2 interactions.
    MINTiMINT-1392002.
    STRINGi9606.ENSP00000361289.

    Structurei

    Secondary structure

    1
    277
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi23 – 297
    Helixi36 – 4611
    Helixi49 – 513
    Helixi54 – 563
    Beta strandi58 – 636
    Helixi64 – 674
    Helixi73 – 808
    Helixi89 – 913
    Helixi94 – 10512
    Beta strandi110 – 1123
    Turni117 – 1204
    Beta strandi127 – 1293
    Beta strandi133 – 1386
    Turni140 – 1434
    Helixi146 – 1494
    Beta strandi153 – 1597
    Helixi162 – 17312
    Helixi180 – 18910
    Helixi191 – 1988
    Helixi200 – 2056
    Beta strandi207 – 2137
    Helixi217 – 23216

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2JEOX-ray2.50A22-243[»]
    2UVQX-ray3.00A22-243[»]
    ProteinModelPortaliQ9HA47.
    SMRiQ9HA47. Positions 22-235.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9HA47.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the uridine kinase family.Curated

    Phylogenomic databases

    eggNOGiCOG0572.
    HOGENOMiHOG000262756.
    HOVERGENiHBG023339.
    KOiK00876.
    OMAiHFGDRSI.
    OrthoDBiEOG7Q8CP2.
    PhylomeDBiQ9HA47.
    TreeFamiTF316686.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR006083. PRK/URK.
    IPR000764. Uridine_kinase_like.
    [Graphical view]
    PfamiPF00485. PRK. 1 hit.
    [Graphical view]
    PRINTSiPR00988. URIDINKINASE.
    SUPFAMiSSF52540. SSF52540. 1 hit.
    TIGRFAMsiTIGR00235. udk. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9HA47-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASAGGEDCE SPAPEADRPH QRPFLIGVSG GTASGKSTVC EKIMELLGQN    50
    EVEQRQRKVV ILSQDRFYKV LTAEQKAKAL KGQYNFDHPD AFDNDLMHRT 100
    LKNIVEGKTV EVPTYDFVTH SRLPETTVVY PADVVLFEGI LVFYSQEIRD 150
    MFHLRLFVDT DSDVRLSRRV LRDVRRGRDL EQILTQYTTF VKPAFEEFCL 200
    PTKKYADVII PRGVDNMVAI NLIVQHIQDI LNGDICKWHR GGSNGRSYKR 250
    TFSEPGDHPG MLTSGKRSHL ESSSRPH 277
    Length:277
    Mass (Da):31,435
    Last modified:March 1, 2001 - v1
    Checksum:iAFD9ED92780CD502
    GO
    Isoform 2 (identifier: Q9HA47-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         170-277: VLRDVRRGRD...SHLESSSRPH → DKEVCRCDHPARSGQYGCHQPDRAAHPGHSEW

    Show »
    Length:201
    Mass (Da):22,761
    Checksum:i0E5F2F00FF6052D3
    GO
    Isoform 3 (identifier: Q9HA47-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         28-36: Missing.

    Show »
    Length:268
    Mass (Da):30,690
    Checksum:i3944B9DCF2A0BAE3
    GO
    Isoform 4 (identifier: Q9HA47-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         28-36: VSGGTASGK → DERFQAGIPLLCLQ

    Show »
    Length:282
    Mass (Da):32,275
    Checksum:i3A379F825B7EAC8A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti8 – 1710DCESPAPEAD → GARARAGAN in AAL75943. 1 PublicationCurated
    Sequence conflicti56 – 572QR → HG in AAL75943. 1 PublicationCurated
    Sequence conflicti175 – 1751R → H in CAG33562. 1 PublicationCurated
    Sequence conflicti247 – 2471S → T in AAL75943. 1 PublicationCurated
    Isoform 2 (identifier: Q9HA47-2)
    Sequence conflicti180 – 1801A → T in AAH15547. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei28 – 369Missing in isoform 3. 1 PublicationVSP_045174
    Alternative sequencei28 – 369VSGGTASGK → DERFQAGIPLLCLQ in isoform 4. CuratedVSP_056748
    Alternative sequencei170 – 277108VLRDV…SSRPH → DKEVCRCDHPARSGQYGCHQ PDRAAHPGHSEW in isoform 2. 1 PublicationVSP_041269Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF237290 mRNA. Translation: AAK28324.1.
    AF254133 mRNA. Translation: AAK49122.1.
    AF125106 mRNA. Translation: AAL75943.1.
    AK022317 mRNA. Translation: BAB14010.1.
    AK295471 mRNA. Translation: BAG58400.1.
    CR457281 mRNA. Translation: CAG33562.1.
    AL358781 Genomic DNA. Translation: CAI40228.1.
    AL358781 Genomic DNA. Translation: CAI40229.1.
    AL358781 Genomic DNA. Translation: CAI40231.1.
    CH471090 Genomic DNA. Translation: EAW87983.1.
    BC015547 mRNA. Translation: AAH15547.1.
    BC091495 mRNA. Translation: AAH91495.1.
    CCDSiCCDS48046.1. [Q9HA47-2]
    CCDS59151.1. [Q9HA47-3]
    CCDS6944.1. [Q9HA47-1]
    RefSeqiNP_001129426.1. NM_001135954.1. [Q9HA47-2]
    NP_001248379.1. NM_001261450.1. [Q9HA47-3]
    NP_001248380.1. NM_001261451.1.
    NP_113620.1. NM_031432.2. [Q9HA47-1]
    UniGeneiHs.9597.

    Genome annotation databases

    EnsembliENST00000372208; ENSP00000361282; ENSG00000130717. [Q9HA47-2]
    ENST00000372210; ENSP00000361284; ENSG00000130717. [Q9HA47-3]
    ENST00000372211; ENSP00000361285; ENSG00000130717.
    ENST00000372215; ENSP00000361289; ENSG00000130717. [Q9HA47-1]
    GeneIDi83549.
    KEGGihsa:83549.
    UCSCiuc004cay.3. human. [Q9HA47-1]
    uc004cba.3. human. [Q9HA47-2]
    uc010mzk.4. human.
    uc031tfj.1. human.

    Polymorphism databases

    DMDMi20455360.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF237290 mRNA. Translation: AAK28324.1 .
    AF254133 mRNA. Translation: AAK49122.1 .
    AF125106 mRNA. Translation: AAL75943.1 .
    AK022317 mRNA. Translation: BAB14010.1 .
    AK295471 mRNA. Translation: BAG58400.1 .
    CR457281 mRNA. Translation: CAG33562.1 .
    AL358781 Genomic DNA. Translation: CAI40228.1 .
    AL358781 Genomic DNA. Translation: CAI40229.1 .
    AL358781 Genomic DNA. Translation: CAI40231.1 .
    CH471090 Genomic DNA. Translation: EAW87983.1 .
    BC015547 mRNA. Translation: AAH15547.1 .
    BC091495 mRNA. Translation: AAH91495.1 .
    CCDSi CCDS48046.1. [Q9HA47-2 ]
    CCDS59151.1. [Q9HA47-3 ]
    CCDS6944.1. [Q9HA47-1 ]
    RefSeqi NP_001129426.1. NM_001135954.1. [Q9HA47-2 ]
    NP_001248379.1. NM_001261450.1. [Q9HA47-3 ]
    NP_001248380.1. NM_001261451.1.
    NP_113620.1. NM_031432.2. [Q9HA47-1 ]
    UniGenei Hs.9597.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2JEO X-ray 2.50 A 22-243 [» ]
    2UVQ X-ray 3.00 A 22-243 [» ]
    ProteinModelPortali Q9HA47.
    SMRi Q9HA47. Positions 22-235.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123681. 4 interactions.
    IntActi Q9HA47. 2 interactions.
    MINTi MINT-1392002.
    STRINGi 9606.ENSP00000361289.

    Chemistry

    ChEMBLi CHEMBL5682.

    PTM databases

    PhosphoSitei Q9HA47.

    Polymorphism databases

    DMDMi 20455360.

    Proteomic databases

    MaxQBi Q9HA47.
    PaxDbi Q9HA47.
    PRIDEi Q9HA47.

    Protocols and materials databases

    DNASUi 83549.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372208 ; ENSP00000361282 ; ENSG00000130717 . [Q9HA47-2 ]
    ENST00000372210 ; ENSP00000361284 ; ENSG00000130717 . [Q9HA47-3 ]
    ENST00000372211 ; ENSP00000361285 ; ENSG00000130717 .
    ENST00000372215 ; ENSP00000361289 ; ENSG00000130717 . [Q9HA47-1 ]
    GeneIDi 83549.
    KEGGi hsa:83549.
    UCSCi uc004cay.3. human. [Q9HA47-1 ]
    uc004cba.3. human. [Q9HA47-2 ]
    uc010mzk.4. human.
    uc031tfj.1. human.

    Organism-specific databases

    CTDi 83549.
    GeneCardsi GC09M134399.
    HGNCi HGNC:14859. UCK1.
    HPAi HPA050969.
    MIMi 609328. gene.
    neXtProti NX_Q9HA47.
    PharmGKBi PA134861770.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0572.
    HOGENOMi HOG000262756.
    HOVERGENi HBG023339.
    KOi K00876.
    OMAi HFGDRSI.
    OrthoDBi EOG7Q8CP2.
    PhylomeDBi Q9HA47.
    TreeFami TF316686.

    Enzyme and pathway databases

    UniPathwayi UPA00574 ; UER00637 .
    UPA00579 ; UER00640 .
    BioCyci MetaCyc:HS05429-MONOMER.
    Reactomei REACT_655. Pyrimidine salvage reactions.
    SABIO-RK Q9HA47.

    Miscellaneous databases

    ChiTaRSi UCK1. human.
    EvolutionaryTracei Q9HA47.
    GenomeRNAii 83549.
    NextBioi 72489.
    PROi Q9HA47.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9HA47.
    Bgeei Q9HA47.
    CleanExi HS_UCK1.
    Genevestigatori Q9HA47.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR006083. PRK/URK.
    IPR000764. Uridine_kinase_like.
    [Graphical view ]
    Pfami PF00485. PRK. 1 hit.
    [Graphical view ]
    PRINTSi PR00988. URIDINKINASE.
    SUPFAMi SSF52540. SSF52540. 1 hit.
    TIGRFAMsi TIGR00235. udk. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Phosphorylation of uridine and cytidine nucleoside analogs by two human uridine-cytidine kinases."
      Van Rompay A.R., Norda A., Linden K., Johansson M., Karlsson A.
      Mol. Pharmacol. 59:1181-1186(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    2. "Human uridine kinase from prostate cancer cell line (LNCaP)."
      Ho Y.S., Johnson R.K.
      Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Cloning of a new human cDNA similar to Mus musculus uridine kinase mRNA."
      Xin Y.R., Yu L., Zhao S.Y.
      Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Hippocampus and Mammary gland.
    5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Colon.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Structure of human uridine-cytidine kinase 1."
      Northeast structural genomics consortium (NESG)
      Submitted (JAN-2007) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 22-243 IN COMPLEX WITH ADP.

    Entry informationi

    Entry nameiUCK1_HUMAN
    AccessioniPrimary (citable) accession number: Q9HA47
    Secondary accession number(s): Q5JT09
    , Q5JT10, Q5JT12, Q5JT13, Q6IA74, Q96BJ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 2, 2002
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 115 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3