Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uridine-cytidine kinase 1

Gene

UCK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.

Catalytic activityi

ATP + uridine = ADP + UMP.
ATP + cytidine = ADP + CMP.

Pathwayi: CTP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes CTP from cytidine.
Proteins known to be involved in the 3 steps of the subpathway in this organism are:
  1. Uridine-cytidine kinase 2 (UCK2), Uridine kinase (UCK1), Uridine kinase, Uridine-cytidine kinase 1 (UCK1), Uridine-cytidine kinase-like 1 (UCKL1), Uridine kinase (UCK2)
  2. no protein annotated in this organism
  3. no protein annotated in this organism
This subpathway is part of the pathway CTP biosynthesis via salvage pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CTP from cytidine, the pathway CTP biosynthesis via salvage pathway and in Pyrimidine metabolism.

Pathwayi: UMP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes UMP from uridine.
Proteins known to be involved in this subpathway in this organism are:
  1. Uridine-cytidine kinase 2 (UCK2), Uridine kinase (UCK1), Uridine kinase, Uridine-cytidine kinase 1 (UCK1), Uridine-cytidine kinase-like 1 (UCKL1), Uridine kinase (UCK2)
This subpathway is part of the pathway UMP biosynthesis via salvage pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes UMP from uridine, the pathway UMP biosynthesis via salvage pathway and in Pyrimidine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei87SubstrateBy similarity1
Binding sitei115SubstrateBy similarity1
Binding sitei120SubstrateBy similarity1
Binding sitei169SubstrateBy similarity1
Binding sitei178SubstrateBy similarity1
Binding sitei186SubstrateBy similarity1
Binding sitei215ATP1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi30 – 38ATP9

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS05429-MONOMER.
ZFISH:HS05429-MONOMER.
BRENDAi2.7.1.48. 2681.
ReactomeiR-HSA-73614. Pyrimidine salvage reactions.
SABIO-RKQ9HA47.
UniPathwayiUPA00574; UER00637.
UPA00579; UER00640.

Names & Taxonomyi

Protein namesi
Recommended name:
Uridine-cytidine kinase 1 (EC:2.7.1.48)
Short name:
UCK 1
Alternative name(s):
Cytidine monophosphokinase 1
Uridine monophosphokinase 1
Gene namesi
Name:UCK1
Synonyms:URK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:14859. UCK1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi83549.
OpenTargetsiENSG00000130717.
PharmGKBiPA134861770.

Chemistry databases

ChEMBLiCHEMBL5682.

Polymorphism and mutation databases

BioMutaiUCK1.
DMDMi20455360.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001644531 – 277Uridine-cytidine kinase 1Add BLAST277

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei251PhosphothreonineCombined sources1
Modified residuei253PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9HA47.
MaxQBiQ9HA47.
PaxDbiQ9HA47.
PeptideAtlasiQ9HA47.
PRIDEiQ9HA47.

PTM databases

iPTMnetiQ9HA47.
PhosphoSitePlusiQ9HA47.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000130717.
CleanExiHS_UCK1.
ExpressionAtlasiQ9HA47. baseline and differential.
GenevisibleiQ9HA47. HS.

Organism-specific databases

HPAiHPA050969.

Interactioni

Protein-protein interaction databases

BioGridi123681. 7 interactors.
IntActiQ9HA47. 2 interactors.
MINTiMINT-1392002.
STRINGi9606.ENSP00000361289.

Structurei

Secondary structure

1277
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi23 – 29Combined sources7
Helixi36 – 46Combined sources11
Helixi49 – 51Combined sources3
Helixi54 – 56Combined sources3
Beta strandi58 – 63Combined sources6
Helixi64 – 67Combined sources4
Helixi73 – 80Combined sources8
Helixi89 – 91Combined sources3
Helixi94 – 105Combined sources12
Beta strandi110 – 112Combined sources3
Turni117 – 120Combined sources4
Beta strandi127 – 129Combined sources3
Beta strandi133 – 138Combined sources6
Turni140 – 143Combined sources4
Helixi146 – 149Combined sources4
Beta strandi153 – 159Combined sources7
Helixi162 – 173Combined sources12
Helixi180 – 189Combined sources10
Helixi191 – 198Combined sources8
Helixi200 – 205Combined sources6
Beta strandi207 – 213Combined sources7
Helixi217 – 232Combined sources16

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JEOX-ray2.50A22-243[»]
2UVQX-ray3.00A22-243[»]
ProteinModelPortaliQ9HA47.
SMRiQ9HA47.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HA47.

Family & Domainsi

Sequence similaritiesi

Belongs to the uridine kinase family.Curated

Phylogenomic databases

eggNOGiENOG410IMEH. Eukaryota.
COG0572. LUCA.
GeneTreeiENSGT00390000015696.
HOGENOMiHOG000262756.
HOVERGENiHBG023339.
InParanoidiQ9HA47.
KOiK00876.
OMAiIEQPVYS.
OrthoDBiEOG091G07OR.
PhylomeDBiQ9HA47.
TreeFamiTF316686.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR006083. PRK/URK.
IPR029920. UCK-1.
IPR000764. Uridine_kinase-like.
[Graphical view]
PANTHERiPTHR10285:SF66. PTHR10285:SF66. 1 hit.
PfamiPF00485. PRK. 1 hit.
[Graphical view]
PRINTSiPR00988. URIDINKINASE.
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00235. udk. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HA47-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASAGGEDCE SPAPEADRPH QRPFLIGVSG GTASGKSTVC EKIMELLGQN
60 70 80 90 100
EVEQRQRKVV ILSQDRFYKV LTAEQKAKAL KGQYNFDHPD AFDNDLMHRT
110 120 130 140 150
LKNIVEGKTV EVPTYDFVTH SRLPETTVVY PADVVLFEGI LVFYSQEIRD
160 170 180 190 200
MFHLRLFVDT DSDVRLSRRV LRDVRRGRDL EQILTQYTTF VKPAFEEFCL
210 220 230 240 250
PTKKYADVII PRGVDNMVAI NLIVQHIQDI LNGDICKWHR GGSNGRSYKR
260 270
TFSEPGDHPG MLTSGKRSHL ESSSRPH
Length:277
Mass (Da):31,435
Last modified:March 1, 2001 - v1
Checksum:iAFD9ED92780CD502
GO
Isoform 2 (identifier: Q9HA47-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-277: VLRDVRRGRD...SHLESSSRPH → DKEVCRCDHPARSGQYGCHQPDRAAHPGHSEW

Show »
Length:201
Mass (Da):22,761
Checksum:i0E5F2F00FF6052D3
GO
Isoform 3 (identifier: Q9HA47-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: Missing.

Show »
Length:268
Mass (Da):30,690
Checksum:i3944B9DCF2A0BAE3
GO
Isoform 4 (identifier: Q9HA47-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: VSGGTASGK → DERFQAGIPLLCLQ

Show »
Length:282
Mass (Da):32,275
Checksum:i3A379F825B7EAC8A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8 – 17DCESPAPEAD → GARARAGAN in AAL75943 (Ref. 3) Curated10
Sequence conflicti56 – 57QR → HG in AAL75943 (Ref. 3) Curated2
Sequence conflicti175R → H in CAG33562 (Ref. 5) Curated1
Sequence conflicti247S → T in AAL75943 (Ref. 3) Curated1
Isoform 2 (identifier: Q9HA47-2)
Sequence conflicti180A → T in AAH15547 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04517428 – 36Missing in isoform 3. 1 Publication9
Alternative sequenceiVSP_05674828 – 36VSGGTASGK → DERFQAGIPLLCLQ in isoform 4. Curated9
Alternative sequenceiVSP_041269170 – 277VLRDV…SSRPH → DKEVCRCDHPARSGQYGCHQ PDRAAHPGHSEW in isoform 2. 1 PublicationAdd BLAST108

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237290 mRNA. Translation: AAK28324.1.
AF254133 mRNA. Translation: AAK49122.1.
AF125106 mRNA. Translation: AAL75943.1.
AK022317 mRNA. Translation: BAB14010.1.
AK295471 mRNA. Translation: BAG58400.1.
CR457281 mRNA. Translation: CAG33562.1.
AL358781 Genomic DNA. Translation: CAI40228.1.
AL358781 Genomic DNA. Translation: CAI40229.1.
AL358781 Genomic DNA. Translation: CAI40231.1.
CH471090 Genomic DNA. Translation: EAW87983.1.
BC015547 mRNA. Translation: AAH15547.1.
BC091495 mRNA. Translation: AAH91495.1.
CCDSiCCDS48046.1. [Q9HA47-2]
CCDS59151.1. [Q9HA47-3]
CCDS59152.1. [Q9HA47-4]
CCDS6944.1. [Q9HA47-1]
RefSeqiNP_001129426.1. NM_001135954.2. [Q9HA47-2]
NP_001248379.1. NM_001261450.2. [Q9HA47-3]
NP_001248380.1. NM_001261451.2. [Q9HA47-4]
NP_001305448.1. NM_001318519.1.
NP_113620.1. NM_031432.3. [Q9HA47-1]
UniGeneiHs.9597.

Genome annotation databases

EnsembliENST00000372208; ENSP00000361282; ENSG00000130717. [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717. [Q9HA47-3]
ENST00000372211; ENSP00000361285; ENSG00000130717. [Q9HA47-4]
ENST00000372215; ENSP00000361289; ENSG00000130717. [Q9HA47-1]
GeneIDi83549.
KEGGihsa:83549.
UCSCiuc004cay.4. human. [Q9HA47-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237290 mRNA. Translation: AAK28324.1.
AF254133 mRNA. Translation: AAK49122.1.
AF125106 mRNA. Translation: AAL75943.1.
AK022317 mRNA. Translation: BAB14010.1.
AK295471 mRNA. Translation: BAG58400.1.
CR457281 mRNA. Translation: CAG33562.1.
AL358781 Genomic DNA. Translation: CAI40228.1.
AL358781 Genomic DNA. Translation: CAI40229.1.
AL358781 Genomic DNA. Translation: CAI40231.1.
CH471090 Genomic DNA. Translation: EAW87983.1.
BC015547 mRNA. Translation: AAH15547.1.
BC091495 mRNA. Translation: AAH91495.1.
CCDSiCCDS48046.1. [Q9HA47-2]
CCDS59151.1. [Q9HA47-3]
CCDS59152.1. [Q9HA47-4]
CCDS6944.1. [Q9HA47-1]
RefSeqiNP_001129426.1. NM_001135954.2. [Q9HA47-2]
NP_001248379.1. NM_001261450.2. [Q9HA47-3]
NP_001248380.1. NM_001261451.2. [Q9HA47-4]
NP_001305448.1. NM_001318519.1.
NP_113620.1. NM_031432.3. [Q9HA47-1]
UniGeneiHs.9597.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JEOX-ray2.50A22-243[»]
2UVQX-ray3.00A22-243[»]
ProteinModelPortaliQ9HA47.
SMRiQ9HA47.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123681. 7 interactors.
IntActiQ9HA47. 2 interactors.
MINTiMINT-1392002.
STRINGi9606.ENSP00000361289.

Chemistry databases

ChEMBLiCHEMBL5682.

PTM databases

iPTMnetiQ9HA47.
PhosphoSitePlusiQ9HA47.

Polymorphism and mutation databases

BioMutaiUCK1.
DMDMi20455360.

Proteomic databases

EPDiQ9HA47.
MaxQBiQ9HA47.
PaxDbiQ9HA47.
PeptideAtlasiQ9HA47.
PRIDEiQ9HA47.

Protocols and materials databases

DNASUi83549.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372208; ENSP00000361282; ENSG00000130717. [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717. [Q9HA47-3]
ENST00000372211; ENSP00000361285; ENSG00000130717. [Q9HA47-4]
ENST00000372215; ENSP00000361289; ENSG00000130717. [Q9HA47-1]
GeneIDi83549.
KEGGihsa:83549.
UCSCiuc004cay.4. human. [Q9HA47-1]

Organism-specific databases

CTDi83549.
DisGeNETi83549.
GeneCardsiUCK1.
HGNCiHGNC:14859. UCK1.
HPAiHPA050969.
MIMi609328. gene.
neXtProtiNX_Q9HA47.
OpenTargetsiENSG00000130717.
PharmGKBiPA134861770.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMEH. Eukaryota.
COG0572. LUCA.
GeneTreeiENSGT00390000015696.
HOGENOMiHOG000262756.
HOVERGENiHBG023339.
InParanoidiQ9HA47.
KOiK00876.
OMAiIEQPVYS.
OrthoDBiEOG091G07OR.
PhylomeDBiQ9HA47.
TreeFamiTF316686.

Enzyme and pathway databases

UniPathwayiUPA00574; UER00637.
UPA00579; UER00640.
BioCyciMetaCyc:HS05429-MONOMER.
ZFISH:HS05429-MONOMER.
BRENDAi2.7.1.48. 2681.
ReactomeiR-HSA-73614. Pyrimidine salvage reactions.
SABIO-RKQ9HA47.

Miscellaneous databases

ChiTaRSiUCK1. human.
EvolutionaryTraceiQ9HA47.
GenomeRNAii83549.
PROiQ9HA47.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000130717.
CleanExiHS_UCK1.
ExpressionAtlasiQ9HA47. baseline and differential.
GenevisibleiQ9HA47. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR006083. PRK/URK.
IPR029920. UCK-1.
IPR000764. Uridine_kinase-like.
[Graphical view]
PANTHERiPTHR10285:SF66. PTHR10285:SF66. 1 hit.
PfamiPF00485. PRK. 1 hit.
[Graphical view]
PRINTSiPR00988. URIDINKINASE.
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00235. udk. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiUCK1_HUMAN
AccessioniPrimary (citable) accession number: Q9HA47
Secondary accession number(s): Q5JT09
, Q5JT10, Q5JT12, Q5JT13, Q6IA74, Q96BJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: November 2, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.