Q9HA47 (UCK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uridine-cytidine kinase 1 Short name=UCK 1 EC=2.7.1.48 Alternative name(s): Cytidine monophosphokinase 1 Uridine monophosphokinase 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 277 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine. |
| Catalytic activity | ATP + uridine = ADP + UMP. ATP + cytidine = ADP + CMP. |
| Pathway | Pyrimidine metabolism; CTP biosynthesis via salvage pathway; CTP from cytidine: step 1/3. Pyrimidine metabolism; UMP biosynthesis via salvage pathway; UMP from uridine: step 1/1. |
| Tissue specificity | Ubiquitous. |
| Sequence similarities | Belongs to the uridine kinase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | CTP salvage Inferred from electronic annotation. Source: UniProtKB-UniPathway UMP salvageInferred from electronic annotation. Source: UniProtKB-UniPathway pyrimidine nucleobase metabolic processTraceable author statement. Source: Reactome pyrimidine nucleoside salvageTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW nucleoside kinase activityInferred from experiment. Source: Reactome phosphotransferase activity, alcohol group as acceptorInferred from electronic annotation. Source: InterPro uridine kinase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9HA47-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9HA47-2) The sequence of this isoform differs from the canonical sequence as follows: 170-277: VLRDVRRGRD...SHLESSSRPH → DKEVCRCDHPARSGQYGCHQPDRAAHPGHSEW | ||||||
| Isoform 3 (identifier: Q9HA47-3) The sequence of this isoform differs from the canonical sequence as follows: 28-36: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 277 | 277 | Uridine-cytidine kinase 1 | PRO_0000164453 | ||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 30 – 38 | 9 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 87 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 115 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 120 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 169 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 178 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 186 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 215 | 1 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 28 – 36 | 9 | Missing in isoform 3. | VSP_045174 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 170 – 277 | 108 | VLRDV…SSRPH → DKEVCRCDHPARSGQYGCHQ PDRAAHPGHSEW in isoform 2. | VSP_041269 | ||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 8 – 17 | 10 | DCESPAPEAD → GARARAGAN in AAL75943. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 56 – 57 | 2 | QR → HG in AAL75943. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 175 | 1 | R → H in CAG33562. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 247 | 1 | S → T in AAL75943. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Isoform 2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 180 | 1 | A → T in AAH15547. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 23 – 29 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 36 – 46 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 49 – 51 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 54 – 56 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 58 – 63 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 64 – 67 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 73 – 80 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 89 – 91 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 105 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 112 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 117 – 120 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 129 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 138 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 140 – 143 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 149 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 153 – 159 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 173 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 189 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 191 – 198 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 205 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 207 – 213 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 217 – 232 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Phosphorylation of uridine and cytidine nucleoside analogs by two human uridine-cytidine kinases." Van Rompay A.R., Norda A., Linden K., Johansson M., Karlsson A. Mol. Pharmacol. 59:1181-1186(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. |
| [2] | "Human uridine kinase from prostate cancer cell line (LNCaP)." Ho Y.S., Johnson R.K. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Cloning of a new human cDNA similar to Mus musculus uridine kinase mRNA." Xin Y.R., Yu L., Zhao S.Y. Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Hippocampus and Mammary gland. |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Colon. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [10] | "Structure of human uridine-cytidine kinase 1." Northeast structural genomics consortium (NESG) Submitted (JAN-2007) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 22-243 IN COMPLEX WITH ADP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF237290 mRNA. Translation: AAK28324.1. AF254133 mRNA. Translation: AAK49122.1. AF125106 mRNA. Translation: AAL75943.1. AK022317 mRNA. Translation: BAB14010.1. AK295471 mRNA. Translation: BAG58400.1. CR457281 mRNA. Translation: CAG33562.1. AL358781 Genomic DNA. Translation: CAI40228.1. AL358781 Genomic DNA. Translation: CAI40229.1. AL358781 Genomic DNA. Translation: CAI40231.1. CH471090 Genomic DNA. Translation: EAW87983.1. BC015547 mRNA. Translation: AAH15547.1. BC091495 mRNA. Translation: AAH91495.1. | ||||||||||||||||||
| IPI | IPI00027771. IPI00303595. | ||||||||||||||||||
| RefSeq | NP_001129426.1. NM_001135954.1. NP_001248379.1. NM_001261450.1. NP_001248380.1. NM_001261451.1. NP_113620.1. NM_031432.2. | ||||||||||||||||||
| UniGene | Hs.9597. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9HA47. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q9HA47. 2 interactions. | ||||||||||||||||||
| MINT | MINT-1392002. | ||||||||||||||||||
| STRING | 9606.ENSP00000361289. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9HA47. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 20455360. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9HA47. | ||||||||||||||||||
| PRIDE | Q9HA47. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 83549. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000372208; ENSP00000361282; ENSG00000130717. ENST00000372210; ENSP00000361284; ENSG00000130717. ENST00000372215; ENSP00000361289; ENSG00000130717. | ||||||||||||||||||
| GeneID | 83549. | ||||||||||||||||||
| KEGG | hsa:83549. | ||||||||||||||||||
| UCSC | uc004cay.3. human. uc004cba.3. human. uc010mzk.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 83549. | ||||||||||||||||||
| GeneCards | GC09M134399. | ||||||||||||||||||
| HGNC | HGNC:14859. UCK1. | ||||||||||||||||||
| HPA | HPA050969. | ||||||||||||||||||
| MIM | 609328. gene. | ||||||||||||||||||
| neXtProt | NX_Q9HA47. | ||||||||||||||||||
| PharmGKB | PA134861770. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0572. | ||||||||||||||||||
| HOGENOM | HOG000262756. | ||||||||||||||||||
| HOVERGEN | HBG023339. | ||||||||||||||||||
| KO | K00876. | ||||||||||||||||||
| OrthoDB | EOG4R7VBB. | ||||||||||||||||||
| PhylomeDB | Q9HA47. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BioCyc | MetaCyc:HS05429-MONOMER. | ||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||
| SABIO-RK | Q9HA47. | ||||||||||||||||||
| UniPathway | UPA00574; UER00637. UPA00579; UER00640. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9HA47. | ||||||||||||||||||
| Bgee | Q9HA47. | ||||||||||||||||||
| CleanEx | HS_UCK1. | ||||||||||||||||||
| Genevestigator | Q9HA47. | ||||||||||||||||||
| GermOnline | ENSG00000130717. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR027417. P-loop_NTPase. IPR006083. PRK/URK. IPR000764. Uridine_kinase. [Graphical view] | ||||||||||||||||||
| Pfam | PF00485. PRK. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00988. URIDINKINASE. | ||||||||||||||||||
| SUPFAM | SSF52540. SSF52540. 1 hit. | ||||||||||||||||||
| TIGRFAMs | TIGR00235. udk. 1 hit. | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChEMBL | CHEMBL5682. | ||||||||||||||||||
| ChiTaRS | UCK1. human. | ||||||||||||||||||
| EvolutionaryTrace | Q9HA47. | ||||||||||||||||||
| GenomeRNAi | 83549. | ||||||||||||||||||
| NextBio | 72489. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | UCK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9HA47 Secondary accession number(s): Q5JT10 Q96BJ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
