Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9HA47 (UCK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Uridine-cytidine kinase 1

Short name=UCK 1
EC=2.7.1.48
Alternative name(s):
Cytidine monophosphokinase 1
Uridine monophosphokinase 1
Gene names
Name:UCK1
Synonyms:URK1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length277 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.

Catalytic activity

ATP + uridine = ADP + UMP.

ATP + cytidine = ADP + CMP.

Pathway

Pyrimidine metabolism; CTP biosynthesis via salvage pathway; CTP from cytidine: step 1/3.

Pyrimidine metabolism; UMP biosynthesis via salvage pathway; UMP from uridine: step 1/1.

Tissue specificity

Ubiquitous.

Sequence similarities

Belongs to the uridine kinase family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9HA47-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9HA47-2)

The sequence of this isoform differs from the canonical sequence as follows:
     170-277: VLRDVRRGRD...SHLESSSRPH → DKEVCRCDHPARSGQYGCHQPDRAAHPGHSEW
Isoform 3 (identifier: Q9HA47-3)

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 277277Uridine-cytidine kinase 1
PRO_0000164453

Regions

Nucleotide binding30 – 389ATP

Sites

Binding site871Substrate By similarity
Binding site1151Substrate By similarity
Binding site1201Substrate By similarity
Binding site1691Substrate By similarity
Binding site1781Substrate By similarity
Binding site1861Substrate By similarity
Binding site2151ATP

Natural variations

Alternative sequence28 – 369Missing in isoform 3.
VSP_045174
Alternative sequence170 – 277108VLRDV…SSRPH → DKEVCRCDHPARSGQYGCHQ PDRAAHPGHSEW in isoform 2.
VSP_041269

Experimental info

Sequence conflict8 – 1710DCESPAPEAD → GARARAGAN in AAL75943. Ref.3
Sequence conflict56 – 572QR → HG in AAL75943. Ref.3
Sequence conflict1751R → H in CAG33562. Ref.5
Sequence conflict2471S → T in AAL75943. Ref.3
Isoform 2:
Sequence conflict1801A → T in AAH15547. Ref.8

Secondary structure

............................................ 277
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: AFD9ED92780CD502

FASTA27731,435
        10         20         30         40         50         60 
MASAGGEDCE SPAPEADRPH QRPFLIGVSG GTASGKSTVC EKIMELLGQN EVEQRQRKVV 

        70         80         90        100        110        120 
ILSQDRFYKV LTAEQKAKAL KGQYNFDHPD AFDNDLMHRT LKNIVEGKTV EVPTYDFVTH 

       130        140        150        160        170        180 
SRLPETTVVY PADVVLFEGI LVFYSQEIRD MFHLRLFVDT DSDVRLSRRV LRDVRRGRDL 

       190        200        210        220        230        240 
EQILTQYTTF VKPAFEEFCL PTKKYADVII PRGVDNMVAI NLIVQHIQDI LNGDICKWHR 

       250        260        270 
GGSNGRSYKR TFSEPGDHPG MLTSGKRSHL ESSSRPH 

« Hide

Isoform 2 [UniParc].

Checksum: 0E5F2F00FF6052D3
Show »

FASTA20122,761
Isoform 3 [UniParc].

Checksum: 3944B9DCF2A0BAE3
Show »

FASTA26830,690

References

« Hide 'large scale' references
[1]"Phosphorylation of uridine and cytidine nucleoside analogs by two human uridine-cytidine kinases."
Van Rompay A.R., Norda A., Linden K., Johansson M., Karlsson A.
Mol. Pharmacol. 59:1181-1186(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
[2]"Human uridine kinase from prostate cancer cell line (LNCaP)."
Ho Y.S., Johnson R.K.
Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Cloning of a new human cDNA similar to Mus musculus uridine kinase mRNA."
Xin Y.R., Yu L., Zhao S.Y.
Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Hippocampus and Mammary gland.
[5]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[6]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Colon.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Structure of human uridine-cytidine kinase 1."
Northeast structural genomics consortium (NESG)
Submitted (JAN-2007) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 22-243 IN COMPLEX WITH ADP.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF237290 mRNA. Translation: AAK28324.1.
AF254133 mRNA. Translation: AAK49122.1.
AF125106 mRNA. Translation: AAL75943.1.
AK022317 mRNA. Translation: BAB14010.1.
AK295471 mRNA. Translation: BAG58400.1.
CR457281 mRNA. Translation: CAG33562.1.
AL358781 Genomic DNA. Translation: CAI40228.1.
AL358781 Genomic DNA. Translation: CAI40229.1.
AL358781 Genomic DNA. Translation: CAI40231.1.
CH471090 Genomic DNA. Translation: EAW87983.1.
BC015547 mRNA. Translation: AAH15547.1.
BC091495 mRNA. Translation: AAH91495.1.
CCDSCCDS48046.1. [Q9HA47-2]
CCDS59151.1. [Q9HA47-3]
CCDS6944.1. [Q9HA47-1]
RefSeqNP_001129426.1. NM_001135954.1. [Q9HA47-2]
NP_001248379.1. NM_001261450.1. [Q9HA47-3]
NP_001248380.1. NM_001261451.1.
NP_113620.1. NM_031432.2. [Q9HA47-1]
UniGeneHs.9597.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2JEOX-ray2.50A22-243[»]
2UVQX-ray3.00A22-243[»]
ProteinModelPortalQ9HA47.
SMRQ9HA47. Positions 22-235.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123681. 4 interactions.
IntActQ9HA47. 2 interactions.
MINTMINT-1392002.
STRING9606.ENSP00000361289.

Chemistry

ChEMBLCHEMBL5682.

PTM databases

PhosphoSiteQ9HA47.

Polymorphism databases

DMDM20455360.

Proteomic databases

MaxQBQ9HA47.
PaxDbQ9HA47.
PRIDEQ9HA47.

Protocols and materials databases

DNASU83549.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000372208; ENSP00000361282; ENSG00000130717. [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717. [Q9HA47-3]
ENST00000372215; ENSP00000361289; ENSG00000130717. [Q9HA47-1]
GeneID83549.
KEGGhsa:83549.
UCSCuc004cay.3. human. [Q9HA47-1]
uc004cba.3. human. [Q9HA47-2]
uc010mzk.4. human.

Organism-specific databases

CTD83549.
GeneCardsGC09M134399.
HGNCHGNC:14859. UCK1.
HPAHPA050969.
MIM609328. gene.
neXtProtNX_Q9HA47.
PharmGKBPA134861770.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0572.
HOGENOMHOG000262756.
HOVERGENHBG023339.
KOK00876.
OrthoDBEOG7Q8CP2.
PhylomeDBQ9HA47.
TreeFamTF316686.

Enzyme and pathway databases

BioCycMetaCyc:HS05429-MONOMER.
ReactomeREACT_111217. Metabolism.
SABIO-RKQ9HA47.
UniPathwayUPA00574; UER00637.
UPA00579; UER00640.

Gene expression databases

ArrayExpressQ9HA47.
BgeeQ9HA47.
CleanExHS_UCK1.
GenevestigatorQ9HA47.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR027417. P-loop_NTPase.
IPR006083. PRK/URK.
IPR000764. Uridine_kinase_like.
[Graphical view]
PfamPF00485. PRK. 1 hit.
[Graphical view]
PRINTSPR00988. URIDINKINASE.
SUPFAMSSF52540. SSF52540. 1 hit.
TIGRFAMsTIGR00235. udk. 1 hit.
ProtoNetSearch...

Other

ChiTaRSUCK1. human.
EvolutionaryTraceQ9HA47.
GenomeRNAi83549.
NextBio72489.
PROQ9HA47.
SOURCESearch...

Entry information

Entry nameUCK1_HUMAN
AccessionPrimary (citable) accession number: Q9HA47
Secondary accession number(s): Q5JT10 expand/collapse secondary AC list , Q5JT12, Q5JT13, Q6IA74, Q96BJ0
Entry history
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM