Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H9Y6

- RPA2_HUMAN

UniProt

Q9H9Y6 - RPA2_HUMAN

Protein

DNA-directed RNA polymerase I subunit RPA2

Gene

POLR1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 128 (01 Oct 2014)
      Sequence version 2 (04 Apr 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft By similarity.By similarity

    Catalytic activityi

    Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1).

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri1070 – 110132C4-typeSequence AnalysisAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: InterPro
    2. DNA-directed RNA polymerase activity Source: UniProtKB-KW
    3. metal ion binding Source: UniProtKB-KW
    4. protein binding Source: UniProtKB
    5. ribonucleoside binding Source: InterPro

    GO - Biological processi

    1. embryo development Source: Ensembl
    2. embryo implantation Source: Ensembl
    3. gene expression Source: Reactome
    4. nucleologenesis Source: Ensembl
    5. rRNA transcription Source: Ensembl
    6. termination of RNA polymerase I transcription Source: Reactome
    7. transcription elongation from RNA polymerase I promoter Source: Reactome
    8. transcription from RNA polymerase I promoter Source: Reactome
    9. transcription initiation from RNA polymerase I promoter Source: Reactome

    Keywords - Molecular functioni

    Nucleotidyltransferase, Transferase

    Keywords - Biological processi

    Transcription

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_1074. RNA Polymerase I Transcription Termination.
    REACT_1913. RNA Polymerase I Promoter Escape.
    REACT_200856. NoRC negatively regulates rRNA expression.
    REACT_2204. RNA Polymerase I Chain Elongation.
    REACT_953. RNA Polymerase I Transcription Initiation.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DNA-directed RNA polymerase I subunit RPA2 (EC:2.7.7.6)
    Short name:
    RNA polymerase I subunit 2
    Alternative name(s):
    DNA-directed RNA polymerase I 135 kDa polypeptide
    Short name:
    RPA135
    Gene namesi
    Name:POLR1B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:20454. POLR1B.

    Subcellular locationi

    Nucleusnucleolus 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. DNA-directed RNA polymerase I complex Source: Ensembl
    3. nucleolus Source: HPA
    4. nucleoplasm Source: Reactome

    Keywords - Cellular componenti

    DNA-directed RNA polymerase, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA130601182.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11351135DNA-directed RNA polymerase I subunit RPA2PRO_0000048072Add
    BLAST

    Proteomic databases

    MaxQBiB7Z823.
    Q9H9Y6.
    PaxDbiQ9H9Y6.
    PRIDEiQ9H9Y6.

    2D gel databases

    SWISS-2DPAGEQ9H9Y6.

    PTM databases

    PhosphoSiteiQ9H9Y6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9H9Y6.
    BgeeiQ9H9Y6.
    CleanExiHS_POLR1B.
    GenevestigatoriQ9H9Y6.

    Organism-specific databases

    HPAiHPA037528.

    Interactioni

    Subunit structurei

    Component of the RNA polymerase I (Pol I) complex consisting of at least 13 subunits.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    POLR1AO956022EBI-355441,EBI-359472

    Protein-protein interaction databases

    BioGridi123926. 29 interactions.
    DIPiDIP-27538N.
    IntActiQ9H9Y6. 19 interactions.
    MINTiMINT-4727878.
    STRINGi9606.ENSP00000263331.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H9Y6.
    SMRiQ9H9Y6. Positions 857-1063.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the RNA polymerase beta chain family.Curated

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri1070 – 110132C4-typeSequence AnalysisAdd
    BLAST

    Keywords - Domaini

    Zinc-finger

    Phylogenomic databases

    eggNOGiCOG0085.
    HOGENOMiHOG000222963.
    HOVERGENiHBG017742.
    InParanoidiQ9H9Y6.
    KOiK03002.
    OMAiEVFAGVT.
    OrthoDBiEOG77M8MW.
    PhylomeDBiQ9H9Y6.
    TreeFamiTF103055.

    Family and domain databases

    Gene3Di2.40.270.10. 2 hits.
    2.40.50.150. 1 hit.
    3.90.1110.10. 1 hit.
    InterProiIPR015712. DNA-dir_RNA_pol_su2.
    IPR007120. DNA-dir_RNA_pol_su2_6.
    IPR007121. RNA_pol_bsu_CS.
    IPR007644. RNA_pol_bsu_protrusion.
    IPR009674. RNA_pol_Rpa2-specific.
    IPR007642. RNA_pol_Rpb2_2.
    IPR007645. RNA_pol_Rpb2_3.
    IPR007647. RNA_pol_Rpb2_5.
    IPR007641. RNA_pol_Rpb2_7.
    IPR014724. RNA_pol_RPB2_OB-fold.
    [Graphical view]
    PANTHERiPTHR20856. PTHR20856. 1 hit.
    PfamiPF06883. RNA_pol_Rpa2_4. 1 hit.
    PF04563. RNA_pol_Rpb2_1. 1 hit.
    PF04561. RNA_pol_Rpb2_2. 1 hit.
    PF04565. RNA_pol_Rpb2_3. 1 hit.
    PF04567. RNA_pol_Rpb2_5. 1 hit.
    PF00562. RNA_pol_Rpb2_6. 1 hit.
    PF04560. RNA_pol_Rpb2_7. 1 hit.
    [Graphical view]
    PROSITEiPS01166. RNA_POL_BETA. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H9Y6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDPGSRWRNL PSGPSLKHLT DPSYGIPREQ QKAALQELTR AHVESFNYAV     50
    HEGLGLAVQA IPPFEFAFKD ERISFTILDA VISPPTVPKG TICKEANVYP 100
    AECRGRRSTY RGKLTADINW AVNGISKGII KQFLGYVPIM VKSKLCNLRN 150
    LPPQALIEHH EEAEEMGGYF IINGIEKVIR MLIMPRRNFP IAMIRPKWKT 200
    RGPGYTQYGV SMHCVREEHS AVNMNLHYLE NGTVMLNFIY RKELFFLPLG 250
    FALKALVSFS DYQIFQELIK GKEDDSFLRN SVSQMLRIVM EEGCSTQKQV 300
    LNYLGECFRV KLNVPDWYPN EQAAEFLFNQ CICIHLKSNT EKFYMLCLMT 350
    RKLFALAKGE CMEDNPDSLV NQEVLTPGQL FLMFLKEKLE GWLVSIKIAF 400
    DKKAQKTSVS MNTDNLMRIF TMGIDLTKPF EYLFATGNLR SKTGLGLLQD 450
    SGLCVVADKL NFIRYLSHFR CVHRGADFAK MRTTTVRRLL PESWGFLCPV 500
    HTPDGEPCGL MNHLTAVCEV VTQFVYTASI PALLCNLGVT PIDGAPHRSY 550
    SECYPVLLDG VMVGWVDKDL APGIADSLRH FKVLREKRIP PWMEVVLIPM 600
    TGKPSLYPGL FLFTTPCRLV RPVQNLALGK EELIGTMEQI FMNVAIFEDE 650
    VFAGVTTHQE LFPHSLLSVI ANFIPFSDHN QSPRNMYQCQ MGKQTMGFPL 700
    LTYQDRSDNK LYRLQTPQSP LVRPSMYDYY DMDNYPIGTN AIVAVISYTG 750
    YDMEDAMIVN KASWERGFAH GSVYKSEFID LSEKIKQGDS SLVFGIKPGD 800
    PRVLQKLDDD GLPFIGAKLQ YGDPYYSYLN LNTGESFVMY YKSKENCVVD 850
    NIKVCSNDTG SGKFKCVCIT MRVPRNPTIG DKFASRHGQK GILSRLWPAE 900
    DMPFTESGMV PDILFNPHGF PSRMTIGMLI ESMAGKSAAL HGLCHDATPF 950
    IFSEENSALE YFGEMLKAAG YNFYGTERLY SGISGLELEA DIFIGVVYYQ 1000
    RLRHMVSDKF QVRTTGARDR VTNQPIGGRN VQGGIRFGEM ERDALLAHGT 1050
    SFLLHDRLFN CSDRSVAHVC VKCGSLLSPL LEKPPPSWSA MRNRKYNCTL 1100
    CSRSDTIDTV SVPYVFRYFV AELAAMNIKV KLDVV 1135
    Length:1,135
    Mass (Da):128,229
    Last modified:April 4, 2006 - v2
    Checksum:i1F019E07F866C22E
    GO
    Isoform 2 (identifier: Q9H9Y6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         61-116: Missing.

    Show »
    Length:1,079
    Mass (Da):121,988
    Checksum:iFC7A4BB26405E435
    GO
    Isoform 3 (identifier: Q9H9Y6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRAKEAAETGLRPLLPACTERLASGVYRETGVRCAGGHM

    Show »
    Length:1,173
    Mass (Da):132,240
    Checksum:iCFB175CCCE5CFBD4
    GO
    Isoform 4 (identifier: Q9H9Y6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-211: Missing.

    Show »
    Length:924
    Mass (Da):104,500
    Checksum:iCEABB0A34AEC4B1E
    GO
    Isoform 5 (identifier: Q9H9Y6-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         387-582: EKLEGWLVSI...GIADSLRHFK → GSLPLMELPTDHT

    Show »
    Length:952
    Mass (Da):107,858
    Checksum:i222B793DAF1E60BE
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti247 – 2471L → R in BAB14082. (PubMed:14702039)Curated
    Sequence conflicti360 – 3601E → G in AAI10834. (PubMed:15489334)Curated
    Sequence conflicti746 – 7461I → T in BAB14296. (PubMed:14702039)Curated
    Sequence conflicti800 – 8001D → G in BAC87247. (PubMed:14702039)Curated
    Sequence conflicti868 – 8681C → R in BAB14082. (PubMed:14702039)Curated
    Sequence conflicti889 – 8891Q → R in BAB14082. (PubMed:14702039)Curated
    Sequence conflicti1039 – 10391E → G in BAH13809. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti295 – 2951S → L.1 Publication
    Corresponds to variant rs1545133 [ dbSNP | Ensembl ].
    VAR_034476
    Natural varianti887 – 8871H → R.
    VAR_071195

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 211211Missing in isoform 4. 1 PublicationVSP_056749Add
    BLAST
    Alternative sequencei1 – 11M → MRAKEAAETGLRPLLPACTE RLASGVYRETGVRCAGGHM in isoform 3. 1 PublicationVSP_056750
    Alternative sequencei61 – 11656Missing in isoform 2. 1 PublicationVSP_017823Add
    BLAST
    Alternative sequencei387 – 582196EKLEG…LRHFK → GSLPLMELPTDHT in isoform 5. 1 PublicationVSP_056751Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022533 mRNA. Translation: BAB14082.1.
    AK022890 mRNA. Translation: BAB14296.1.
    AK128044 mRNA. Translation: BAC87247.1.
    AK301178 mRNA. Translation: BAH13423.1.
    AK302814 mRNA. Translation: BAH13809.1.
    AC012442 Genomic DNA. Translation: AAX81999.1.
    BC110833 mRNA. Translation: AAI10834.1.
    CCDSiCCDS2097.1. [Q9H9Y6-1]
    CCDS46395.1. [Q9H9Y6-2]
    RefSeqiNP_001131076.1. NM_001137604.2. [Q9H9Y6-2]
    NP_001269701.1. NM_001282772.1.
    NP_001269703.1. NM_001282774.1.
    NP_001269705.1. NM_001282776.1.
    NP_001269706.1. NM_001282777.1.
    NP_001269708.1. NM_001282779.1.
    NP_061887.2. NM_019014.5. [Q9H9Y6-1]
    UniGeneiHs.745127.

    Genome annotation databases

    EnsembliENST00000263331; ENSP00000263331; ENSG00000125630. [Q9H9Y6-1]
    ENST00000409894; ENSP00000387143; ENSG00000125630.
    ENST00000417433; ENSP00000405358; ENSG00000125630. [Q9H9Y6-2]
    ENST00000541869; ENSP00000444136; ENSG00000125630.
    GeneIDi84172.
    KEGGihsa:84172.
    UCSCiuc002thw.2. human. [Q9H9Y6-1]
    uc010fkn.2. human. [Q9H9Y6-2]
    uc010fko.2. human.

    Polymorphism databases

    DMDMi92090637.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022533 mRNA. Translation: BAB14082.1 .
    AK022890 mRNA. Translation: BAB14296.1 .
    AK128044 mRNA. Translation: BAC87247.1 .
    AK301178 mRNA. Translation: BAH13423.1 .
    AK302814 mRNA. Translation: BAH13809.1 .
    AC012442 Genomic DNA. Translation: AAX81999.1 .
    BC110833 mRNA. Translation: AAI10834.1 .
    CCDSi CCDS2097.1. [Q9H9Y6-1 ]
    CCDS46395.1. [Q9H9Y6-2 ]
    RefSeqi NP_001131076.1. NM_001137604.2. [Q9H9Y6-2 ]
    NP_001269701.1. NM_001282772.1.
    NP_001269703.1. NM_001282774.1.
    NP_001269705.1. NM_001282776.1.
    NP_001269706.1. NM_001282777.1.
    NP_001269708.1. NM_001282779.1.
    NP_061887.2. NM_019014.5. [Q9H9Y6-1 ]
    UniGenei Hs.745127.

    3D structure databases

    ProteinModelPortali Q9H9Y6.
    SMRi Q9H9Y6. Positions 857-1063.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123926. 29 interactions.
    DIPi DIP-27538N.
    IntActi Q9H9Y6. 19 interactions.
    MINTi MINT-4727878.
    STRINGi 9606.ENSP00000263331.

    PTM databases

    PhosphoSitei Q9H9Y6.

    Polymorphism databases

    DMDMi 92090637.

    2D gel databases

    SWISS-2DPAGE Q9H9Y6.

    Proteomic databases

    MaxQBi B7Z823.
    Q9H9Y6.
    PaxDbi Q9H9Y6.
    PRIDEi Q9H9Y6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263331 ; ENSP00000263331 ; ENSG00000125630 . [Q9H9Y6-1 ]
    ENST00000409894 ; ENSP00000387143 ; ENSG00000125630 .
    ENST00000417433 ; ENSP00000405358 ; ENSG00000125630 . [Q9H9Y6-2 ]
    ENST00000541869 ; ENSP00000444136 ; ENSG00000125630 .
    GeneIDi 84172.
    KEGGi hsa:84172.
    UCSCi uc002thw.2. human. [Q9H9Y6-1 ]
    uc010fkn.2. human. [Q9H9Y6-2 ]
    uc010fko.2. human.

    Organism-specific databases

    CTDi 84172.
    GeneCardsi GC02P113299.
    H-InvDB HIX0002380.
    HGNCi HGNC:20454. POLR1B.
    HPAi HPA037528.
    MIMi 602000. gene.
    neXtProti NX_Q9H9Y6.
    PharmGKBi PA130601182.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0085.
    HOGENOMi HOG000222963.
    HOVERGENi HBG017742.
    InParanoidi Q9H9Y6.
    KOi K03002.
    OMAi EVFAGVT.
    OrthoDBi EOG77M8MW.
    PhylomeDBi Q9H9Y6.
    TreeFami TF103055.

    Enzyme and pathway databases

    Reactomei REACT_1074. RNA Polymerase I Transcription Termination.
    REACT_1913. RNA Polymerase I Promoter Escape.
    REACT_200856. NoRC negatively regulates rRNA expression.
    REACT_2204. RNA Polymerase I Chain Elongation.
    REACT_953. RNA Polymerase I Transcription Initiation.

    Miscellaneous databases

    GeneWikii POLR1B.
    GenomeRNAii 84172.
    NextBioi 73536.
    PROi Q9H9Y6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9H9Y6.
    Bgeei Q9H9Y6.
    CleanExi HS_POLR1B.
    Genevestigatori Q9H9Y6.

    Family and domain databases

    Gene3Di 2.40.270.10. 2 hits.
    2.40.50.150. 1 hit.
    3.90.1110.10. 1 hit.
    InterProi IPR015712. DNA-dir_RNA_pol_su2.
    IPR007120. DNA-dir_RNA_pol_su2_6.
    IPR007121. RNA_pol_bsu_CS.
    IPR007644. RNA_pol_bsu_protrusion.
    IPR009674. RNA_pol_Rpa2-specific.
    IPR007642. RNA_pol_Rpb2_2.
    IPR007645. RNA_pol_Rpb2_3.
    IPR007647. RNA_pol_Rpb2_5.
    IPR007641. RNA_pol_Rpb2_7.
    IPR014724. RNA_pol_RPB2_OB-fold.
    [Graphical view ]
    PANTHERi PTHR20856. PTHR20856. 1 hit.
    Pfami PF06883. RNA_pol_Rpa2_4. 1 hit.
    PF04563. RNA_pol_Rpb2_1. 1 hit.
    PF04561. RNA_pol_Rpb2_2. 1 hit.
    PF04565. RNA_pol_Rpb2_3. 1 hit.
    PF04567. RNA_pol_Rpb2_5. 1 hit.
    PF00562. RNA_pol_Rpb2_6. 1 hit.
    PF04560. RNA_pol_Rpb2_7. 1 hit.
    [Graphical view ]
    PROSITEi PS01166. RNA_POL_BETA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANTS LEU-295 AND ARG-887 (ISOFORM 4).
      Tissue: Spleen and Testis.
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANT LEU-295.
      Tissue: Pancreas.
    4. "hRRN3 is essential in the SL1-mediated recruitment of RNA polymerase I to rRNA gene promoters."
      Miller G., Panov K.I., Friedrich J.K., Trinkle-Mulcahy L., Lamond A.I., Zomerdijk J.C.B.M.
      EMBO J. 20:1373-1382(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    5. "RNA polymerase I-specific subunit CAST/hPAF49 has a role in the activation of transcription by upstream binding factor."
      Panov K.I., Panova T.B., Gadal O., Nishiyama K., Saito T., Russell J., Zomerdijk J.C.B.M.
      Mol. Cell. Biol. 26:5436-5448(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE RNA POL I COMPLEX.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRPA2_HUMAN
    AccessioniPrimary (citable) accession number: Q9H9Y6
    Secondary accession number(s): B7Z6Y7
    , B7Z823, F5GZX4, F8W898, Q2TAM4, Q585T5, Q6ZRR2, Q9H9D3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 4, 2001
    Last sequence update: April 4, 2006
    Last modified: October 1, 2014
    This is version 128 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3