Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H9Y6

- RPA2_HUMAN

UniProt

Q9H9Y6 - RPA2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

DNA-directed RNA polymerase I subunit RPA2

Gene

POLR1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).By similarity

Catalytic activityi

Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1).

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri1070 – 110132C4-typeSequence AnalysisAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: InterPro
  2. DNA-directed RNA polymerase activity Source: UniProtKB-KW
  3. metal ion binding Source: UniProtKB-KW
  4. ribonucleoside binding Source: InterPro

GO - Biological processi

  1. gene expression Source: Reactome
  2. termination of RNA polymerase I transcription Source: Reactome
  3. transcription elongation from RNA polymerase I promoter Source: Reactome
  4. transcription from RNA polymerase I promoter Source: Reactome
  5. transcription initiation from RNA polymerase I promoter Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Nucleotidyltransferase, Transferase

Keywords - Biological processi

Transcription

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_1074. RNA Polymerase I Transcription Termination.
REACT_1913. RNA Polymerase I Promoter Escape.
REACT_200856. NoRC negatively regulates rRNA expression.
REACT_2204. RNA Polymerase I Chain Elongation.
REACT_953. RNA Polymerase I Transcription Initiation.

Names & Taxonomyi

Protein namesi
Recommended name:
DNA-directed RNA polymerase I subunit RPA2 (EC:2.7.7.6)
Short name:
RNA polymerase I subunit 2
Alternative name(s):
DNA-directed RNA polymerase I 135 kDa polypeptide
Short name:
RPA135
Gene namesi
Name:POLR1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:20454. POLR1B.

Subcellular locationi

Nucleusnucleolus 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleolus Source: HPA
  3. nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

DNA-directed RNA polymerase, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA130601182.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11351135DNA-directed RNA polymerase I subunit RPA2PRO_0000048072Add
BLAST

Proteomic databases

MaxQBiQ9H9Y6.
PaxDbiQ9H9Y6.
PRIDEiQ9H9Y6.

2D gel databases

SWISS-2DPAGEQ9H9Y6.

PTM databases

PhosphoSiteiQ9H9Y6.

Expressioni

Gene expression databases

BgeeiQ9H9Y6.
CleanExiHS_POLR1B.
ExpressionAtlasiQ9H9Y6. baseline and differential.
GenevestigatoriQ9H9Y6.

Organism-specific databases

HPAiHPA037528.

Interactioni

Subunit structurei

Component of the RNA polymerase I (Pol I) complex consisting of at least 13 subunits.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
POLR1AO956022EBI-355441,EBI-359472

Protein-protein interaction databases

BioGridi123926. 34 interactions.
DIPiDIP-27538N.
IntActiQ9H9Y6. 19 interactions.
MINTiMINT-4727878.
STRINGi9606.ENSP00000263331.

Structurei

3D structure databases

ProteinModelPortaliQ9H9Y6.
SMRiQ9H9Y6. Positions 857-1063.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the RNA polymerase beta chain family.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri1070 – 110132C4-typeSequence AnalysisAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiCOG0085.
GeneTreeiENSGT00760000119399.
HOGENOMiHOG000222963.
HOVERGENiHBG017742.
InParanoidiQ9H9Y6.
KOiK03002.
OMAiEVFAGVT.
OrthoDBiEOG77M8MW.
PhylomeDBiQ9H9Y6.
TreeFamiTF103055.

Family and domain databases

Gene3Di2.40.270.10. 2 hits.
2.40.50.150. 1 hit.
3.90.1110.10. 1 hit.
InterProiIPR015712. DNA-dir_RNA_pol_su2.
IPR007120. DNA-dir_RNA_pol_su2_6.
IPR007121. RNA_pol_bsu_CS.
IPR007644. RNA_pol_bsu_protrusion.
IPR009674. RNA_pol_Rpa2-specific.
IPR007642. RNA_pol_Rpb2_2.
IPR007645. RNA_pol_Rpb2_3.
IPR007647. RNA_pol_Rpb2_5.
IPR007641. RNA_pol_Rpb2_7.
IPR014724. RNA_pol_RPB2_OB-fold.
[Graphical view]
PANTHERiPTHR20856. PTHR20856. 1 hit.
PfamiPF06883. RNA_pol_Rpa2_4. 1 hit.
PF04563. RNA_pol_Rpb2_1. 1 hit.
PF04561. RNA_pol_Rpb2_2. 1 hit.
PF04565. RNA_pol_Rpb2_3. 1 hit.
PF04567. RNA_pol_Rpb2_5. 1 hit.
PF00562. RNA_pol_Rpb2_6. 1 hit.
PF04560. RNA_pol_Rpb2_7. 1 hit.
[Graphical view]
PROSITEiPS01166. RNA_POL_BETA. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H9Y6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDPGSRWRNL PSGPSLKHLT DPSYGIPREQ QKAALQELTR AHVESFNYAV
60 70 80 90 100
HEGLGLAVQA IPPFEFAFKD ERISFTILDA VISPPTVPKG TICKEANVYP
110 120 130 140 150
AECRGRRSTY RGKLTADINW AVNGISKGII KQFLGYVPIM VKSKLCNLRN
160 170 180 190 200
LPPQALIEHH EEAEEMGGYF IINGIEKVIR MLIMPRRNFP IAMIRPKWKT
210 220 230 240 250
RGPGYTQYGV SMHCVREEHS AVNMNLHYLE NGTVMLNFIY RKELFFLPLG
260 270 280 290 300
FALKALVSFS DYQIFQELIK GKEDDSFLRN SVSQMLRIVM EEGCSTQKQV
310 320 330 340 350
LNYLGECFRV KLNVPDWYPN EQAAEFLFNQ CICIHLKSNT EKFYMLCLMT
360 370 380 390 400
RKLFALAKGE CMEDNPDSLV NQEVLTPGQL FLMFLKEKLE GWLVSIKIAF
410 420 430 440 450
DKKAQKTSVS MNTDNLMRIF TMGIDLTKPF EYLFATGNLR SKTGLGLLQD
460 470 480 490 500
SGLCVVADKL NFIRYLSHFR CVHRGADFAK MRTTTVRRLL PESWGFLCPV
510 520 530 540 550
HTPDGEPCGL MNHLTAVCEV VTQFVYTASI PALLCNLGVT PIDGAPHRSY
560 570 580 590 600
SECYPVLLDG VMVGWVDKDL APGIADSLRH FKVLREKRIP PWMEVVLIPM
610 620 630 640 650
TGKPSLYPGL FLFTTPCRLV RPVQNLALGK EELIGTMEQI FMNVAIFEDE
660 670 680 690 700
VFAGVTTHQE LFPHSLLSVI ANFIPFSDHN QSPRNMYQCQ MGKQTMGFPL
710 720 730 740 750
LTYQDRSDNK LYRLQTPQSP LVRPSMYDYY DMDNYPIGTN AIVAVISYTG
760 770 780 790 800
YDMEDAMIVN KASWERGFAH GSVYKSEFID LSEKIKQGDS SLVFGIKPGD
810 820 830 840 850
PRVLQKLDDD GLPFIGAKLQ YGDPYYSYLN LNTGESFVMY YKSKENCVVD
860 870 880 890 900
NIKVCSNDTG SGKFKCVCIT MRVPRNPTIG DKFASRHGQK GILSRLWPAE
910 920 930 940 950
DMPFTESGMV PDILFNPHGF PSRMTIGMLI ESMAGKSAAL HGLCHDATPF
960 970 980 990 1000
IFSEENSALE YFGEMLKAAG YNFYGTERLY SGISGLELEA DIFIGVVYYQ
1010 1020 1030 1040 1050
RLRHMVSDKF QVRTTGARDR VTNQPIGGRN VQGGIRFGEM ERDALLAHGT
1060 1070 1080 1090 1100
SFLLHDRLFN CSDRSVAHVC VKCGSLLSPL LEKPPPSWSA MRNRKYNCTL
1110 1120 1130
CSRSDTIDTV SVPYVFRYFV AELAAMNIKV KLDVV
Length:1,135
Mass (Da):128,229
Last modified:April 4, 2006 - v2
Checksum:i1F019E07F866C22E
GO
Isoform 2 (identifier: Q9H9Y6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-116: Missing.

Show »
Length:1,079
Mass (Da):121,988
Checksum:iFC7A4BB26405E435
GO
Isoform 3 (identifier: Q9H9Y6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRAKEAAETGLRPLLPACTERLASGVYRETGVRCAGGHM

Show »
Length:1,173
Mass (Da):132,240
Checksum:iCFB175CCCE5CFBD4
GO
Isoform 4 (identifier: Q9H9Y6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-211: Missing.

Show »
Length:924
Mass (Da):104,500
Checksum:iCEABB0A34AEC4B1E
GO
Isoform 5 (identifier: Q9H9Y6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-582: EKLEGWLVSI...GIADSLRHFK → GSLPLMELPTDHT

Show »
Length:952
Mass (Da):107,858
Checksum:i222B793DAF1E60BE
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti247 – 2471L → R in BAB14082. (PubMed:14702039)Curated
Sequence conflicti360 – 3601E → G in AAI10834. (PubMed:15489334)Curated
Sequence conflicti746 – 7461I → T in BAB14296. (PubMed:14702039)Curated
Sequence conflicti800 – 8001D → G in BAC87247. (PubMed:14702039)Curated
Sequence conflicti868 – 8681C → R in BAB14082. (PubMed:14702039)Curated
Sequence conflicti889 – 8891Q → R in BAB14082. (PubMed:14702039)Curated
Sequence conflicti1039 – 10391E → G in BAH13809. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti295 – 2951S → L.1 Publication
Corresponds to variant rs1545133 [ dbSNP | Ensembl ].
VAR_034476
Natural varianti887 – 8871H → R.
VAR_071195

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 211211Missing in isoform 4. 1 PublicationVSP_056749Add
BLAST
Alternative sequencei1 – 11M → MRAKEAAETGLRPLLPACTE RLASGVYRETGVRCAGGHM in isoform 3. 1 PublicationVSP_056750
Alternative sequencei61 – 11656Missing in isoform 2. 1 PublicationVSP_017823Add
BLAST
Alternative sequencei387 – 582196EKLEG…LRHFK → GSLPLMELPTDHT in isoform 5. 1 PublicationVSP_056751Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK022533 mRNA. Translation: BAB14082.1.
AK022890 mRNA. Translation: BAB14296.1.
AK128044 mRNA. Translation: BAC87247.1.
AK301178 mRNA. Translation: BAH13423.1.
AK302814 mRNA. Translation: BAH13809.1.
AC012442 Genomic DNA. Translation: AAX81999.1.
BC110833 mRNA. Translation: AAI10834.1.
CCDSiCCDS2097.1. [Q9H9Y6-1]
CCDS46395.1. [Q9H9Y6-2]
RefSeqiNP_001131076.1. NM_001137604.2. [Q9H9Y6-2]
NP_001269701.1. NM_001282772.1.
NP_001269703.1. NM_001282774.1.
NP_001269705.1. NM_001282776.1.
NP_001269706.1. NM_001282777.1.
NP_001269708.1. NM_001282779.1.
NP_061887.2. NM_019014.5. [Q9H9Y6-1]
UniGeneiHs.745127.

Genome annotation databases

EnsembliENST00000263331; ENSP00000263331; ENSG00000125630. [Q9H9Y6-1]
ENST00000409894; ENSP00000387143; ENSG00000125630. [Q9H9Y6-5]
ENST00000417433; ENSP00000405358; ENSG00000125630. [Q9H9Y6-2]
ENST00000537335; ENSP00000437914; ENSG00000125630. [Q9H9Y6-4]
ENST00000541869; ENSP00000444136; ENSG00000125630. [Q9H9Y6-3]
GeneIDi84172.
KEGGihsa:84172.
UCSCiuc002thw.2. human. [Q9H9Y6-1]
uc010fkn.2. human. [Q9H9Y6-2]

Polymorphism databases

DMDMi92090637.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK022533 mRNA. Translation: BAB14082.1 .
AK022890 mRNA. Translation: BAB14296.1 .
AK128044 mRNA. Translation: BAC87247.1 .
AK301178 mRNA. Translation: BAH13423.1 .
AK302814 mRNA. Translation: BAH13809.1 .
AC012442 Genomic DNA. Translation: AAX81999.1 .
BC110833 mRNA. Translation: AAI10834.1 .
CCDSi CCDS2097.1. [Q9H9Y6-1 ]
CCDS46395.1. [Q9H9Y6-2 ]
RefSeqi NP_001131076.1. NM_001137604.2. [Q9H9Y6-2 ]
NP_001269701.1. NM_001282772.1.
NP_001269703.1. NM_001282774.1.
NP_001269705.1. NM_001282776.1.
NP_001269706.1. NM_001282777.1.
NP_001269708.1. NM_001282779.1.
NP_061887.2. NM_019014.5. [Q9H9Y6-1 ]
UniGenei Hs.745127.

3D structure databases

ProteinModelPortali Q9H9Y6.
SMRi Q9H9Y6. Positions 857-1063.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123926. 34 interactions.
DIPi DIP-27538N.
IntActi Q9H9Y6. 19 interactions.
MINTi MINT-4727878.
STRINGi 9606.ENSP00000263331.

PTM databases

PhosphoSitei Q9H9Y6.

Polymorphism databases

DMDMi 92090637.

2D gel databases

SWISS-2DPAGE Q9H9Y6.

Proteomic databases

MaxQBi Q9H9Y6.
PaxDbi Q9H9Y6.
PRIDEi Q9H9Y6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263331 ; ENSP00000263331 ; ENSG00000125630 . [Q9H9Y6-1 ]
ENST00000409894 ; ENSP00000387143 ; ENSG00000125630 . [Q9H9Y6-5 ]
ENST00000417433 ; ENSP00000405358 ; ENSG00000125630 . [Q9H9Y6-2 ]
ENST00000537335 ; ENSP00000437914 ; ENSG00000125630 . [Q9H9Y6-4 ]
ENST00000541869 ; ENSP00000444136 ; ENSG00000125630 . [Q9H9Y6-3 ]
GeneIDi 84172.
KEGGi hsa:84172.
UCSCi uc002thw.2. human. [Q9H9Y6-1 ]
uc010fkn.2. human. [Q9H9Y6-2 ]

Organism-specific databases

CTDi 84172.
GeneCardsi GC02P113299.
H-InvDB HIX0002380.
HGNCi HGNC:20454. POLR1B.
HPAi HPA037528.
MIMi 602000. gene.
neXtProti NX_Q9H9Y6.
PharmGKBi PA130601182.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0085.
GeneTreei ENSGT00760000119399.
HOGENOMi HOG000222963.
HOVERGENi HBG017742.
InParanoidi Q9H9Y6.
KOi K03002.
OMAi EVFAGVT.
OrthoDBi EOG77M8MW.
PhylomeDBi Q9H9Y6.
TreeFami TF103055.

Enzyme and pathway databases

Reactomei REACT_1074. RNA Polymerase I Transcription Termination.
REACT_1913. RNA Polymerase I Promoter Escape.
REACT_200856. NoRC negatively regulates rRNA expression.
REACT_2204. RNA Polymerase I Chain Elongation.
REACT_953. RNA Polymerase I Transcription Initiation.

Miscellaneous databases

GeneWikii POLR1B.
GenomeRNAii 84172.
NextBioi 35480101.
PROi Q9H9Y6.
SOURCEi Search...

Gene expression databases

Bgeei Q9H9Y6.
CleanExi HS_POLR1B.
ExpressionAtlasi Q9H9Y6. baseline and differential.
Genevestigatori Q9H9Y6.

Family and domain databases

Gene3Di 2.40.270.10. 2 hits.
2.40.50.150. 1 hit.
3.90.1110.10. 1 hit.
InterProi IPR015712. DNA-dir_RNA_pol_su2.
IPR007120. DNA-dir_RNA_pol_su2_6.
IPR007121. RNA_pol_bsu_CS.
IPR007644. RNA_pol_bsu_protrusion.
IPR009674. RNA_pol_Rpa2-specific.
IPR007642. RNA_pol_Rpb2_2.
IPR007645. RNA_pol_Rpb2_3.
IPR007647. RNA_pol_Rpb2_5.
IPR007641. RNA_pol_Rpb2_7.
IPR014724. RNA_pol_RPB2_OB-fold.
[Graphical view ]
PANTHERi PTHR20856. PTHR20856. 1 hit.
Pfami PF06883. RNA_pol_Rpa2_4. 1 hit.
PF04563. RNA_pol_Rpb2_1. 1 hit.
PF04561. RNA_pol_Rpb2_2. 1 hit.
PF04565. RNA_pol_Rpb2_3. 1 hit.
PF04567. RNA_pol_Rpb2_5. 1 hit.
PF00562. RNA_pol_Rpb2_6. 1 hit.
PF04560. RNA_pol_Rpb2_7. 1 hit.
[Graphical view ]
PROSITEi PS01166. RNA_POL_BETA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANTS LEU-295 AND ARG-887 (ISOFORM 4).
    Tissue: Spleen and Testis.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANT LEU-295.
    Tissue: Pancreas.
  4. "hRRN3 is essential in the SL1-mediated recruitment of RNA polymerase I to rRNA gene promoters."
    Miller G., Panov K.I., Friedrich J.K., Trinkle-Mulcahy L., Lamond A.I., Zomerdijk J.C.B.M.
    EMBO J. 20:1373-1382(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  5. "RNA polymerase I-specific subunit CAST/hPAF49 has a role in the activation of transcription by upstream binding factor."
    Panov K.I., Panova T.B., Gadal O., Nishiyama K., Saito T., Russell J., Zomerdijk J.C.B.M.
    Mol. Cell. Biol. 26:5436-5448(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE RNA POL I COMPLEX.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRPA2_HUMAN
AccessioniPrimary (citable) accession number: Q9H9Y6
Secondary accession number(s): B7Z6Y7
, B7Z823, F5GZX4, F8W898, Q2TAM4, Q585T5, Q6ZRR2, Q9H9D3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 4, 2001
Last sequence update: April 4, 2006
Last modified: October 29, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3