Q9H9R9 (DBND1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 56.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dysbindin domain-containing protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 158 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the dysbindin family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H9R9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H9R9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-10: MEPPEGAGTG → MGETWKNICSTVRHGWWLRDHRMAGLPIPP | ||||||
| Isoform 3 (identifier: Q9H9R9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-11: MEPPEGAGTGE → MTQQWREVNE...RGRQRARPPK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 158 | 158 | Dysbindin domain-containing protein 1 | PRO_0000292438 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 11 | 11 | MEPPEGAGTGE → MTQQWREVNEDREAVAQARS WQSLNLGDRDMGVSFIETAL ALSAARARRPLLTSHPPSRP FQPPKHTPSPPPAPRVNSRH PGRSVSLSLPSASQAPPVPL ASPEGRPHTVGAPHASTWKR TRGRQRARPPK in isoform 3. | VSP_037541 | |||||
| Alternative sequence | 1 – 10 | 10 | MEPPEGAGTG → MGETWKNICSTVRHGWWLRD HRMAGLPIPP in isoform 2. | VSP_026214 | |||||
Experimental info | |||||||||
| Sequence conflict | 26 | 1 | P → S in BAB14152. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK022644 mRNA. Translation: BAB14152.1. AK298932 mRNA. Translation: BAG61035.1. AC092143 Genomic DNA. No translation available. BC000700 mRNA. Translation: AAH00700.2. AL713678 mRNA. Translation: CAH10640.1. |
| IPI | IPI00031533. IPI00304285. IPI00872543. |
| RefSeq | NP_001036075.1. NM_001042610.1. NP_076948.2. NM_024043.2. |
| UniGene | Hs.301394. |
3D structure databases | |
| ProteinModelPortal | Q9H9R9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9H9R9. |
Polymorphism databases | |
| DMDM | 239938618. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000002501; ENSP00000002501; ENSG00000003249. |
| GeneID | 79007. |
| KEGG | hsa:79007. |
| UCSC | uc002fqe.1. human. uc002fqf.1. human. |
Organism-specific databases | |
| CTD | 79007. |
| GeneCards | GC16M090071. |
| HGNC | HGNC:28455. DBNDD1. |
| HPA | HPA043018. |
| neXtProt | NX_Q9H9R9. |
| PharmGKB | PA144596443. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18885. |
| GeneTree | ENSGT00390000018903. |
| HOVERGEN | HBG056558. |
| OMA | PAIVDTF. |
| OrthoDB | EOG4GB77R. |
Gene expression databases | |
| ArrayExpress | Q9H9R9. |
| Bgee | Q9H9R9. |
| CleanEx | HS_DBNDD1. |
| Genevestigator | Q9H9R9. |
Family and domain databases | |
| InterPro | IPR007531. Dysbindin. [Graphical view] |
| PANTHER | PTHR16294. Dysbindin. 1 hit. |
| Pfam | PF04440. Dysbindin. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 67641. |
Entry information
| Entry name | DBND1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H9R9 Secondary accession number(s): B4DQS3, Q69YT2, Q9BW25 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with