Q9H9Q4 (NHEJ1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Non-homologous end-joining factor 1 Alternative name(s): Protein cernunnos XRCC4-like factor | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 299 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA repair protein involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. May serve as a bridge between XRCC4 and the other NHEJ factors located at DNA ends, or may participate in reconfiguration of the end bound NHEJ factors to allow XRCC4 access to the DNA termini. It may act in concert with XRCC6/XRCC5 (Ku) to stimulate XRCC4-mediated joining of blunt ends and several types of mismatched ends that are noncomplementary or partially complementary. Ref.1 Ref.7 Ref.11 |
| Subunit structure | Interacts with XRCC4 and the XRCC4-LIG4 complex. Binds DNA in a length-dependent manner. Ref.7 Ref.8 Ref.10 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed. Ref.1 |
| Involvement in disease | Severe combined immunodeficiency due to NHEJ1 deficiency (NHEJ1-SCID) [MIM:611291]: SCID refers to a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia and low or absent antibody levels. Patients with SCID present in infancy with recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. NHEJ1-SCID is characterized by a profound T- and B-lymphocytopenia associated with increased cellular sensitivity to ionizing radiation, microcephaly and growth retardation. Some patients may manifest SCID with sensitivity to ionizing radiation without microcephaly and mild growth retardation, probably due to hypomorphic NHEJ1 mutations. A chromosomal aberration involving NHEJ1 is found in a patient with polymicrogyria. Translocation t(2;7)(q35;p22). Ref.6 |
| Miscellaneous | Was named 'Cernunnos' after the enigmatic Celtic god of hunting, the underworld and fertility. |
| Sequence similarities | Belongs to the XLF family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| LIG4 | P49917 | 4 | EBI-847807,EBI-847896 | |
| XRCC4 | Q13426 | 5 | EBI-847807,EBI-717592 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H9Q4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H9Q4-2) The sequence of this isoform differs from the canonical sequence as follows: 276-299: GTSGPLQRPQLSKVKRKKPRGLFS → ALCRDLSCQRSRGRSQGVSSVNLLWPQLLRMDLENSFQASP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 299 | 299 | Non-homologous end-joining factor 1 | PRO_0000228654 | ||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 276 – 299 | 24 | GTSGP…RGLFS → ALCRDLSCQRSRGRSQGVSS VNLLWPQLLRMDLENSFQAS P in isoform 2. | VSP_017689 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 14 | 1 | A → T. Corresponds to variant rs34689457 [ dbSNP | Ensembl ]. | VAR_038790 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 57 | 1 | R → G in NHEJ1-SCID; fails to translocate to the nucleus. Ref.1 Ref.10 | VAR_025704 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 89 | 1 | H → R. Corresponds to variant rs1056296 [ dbSNP | Ensembl ]. | VAR_038791 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 123 | 1 | C → R in NHEJ1-SCID. Ref.1 | VAR_025705 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 256 | 1 | Q → L. Corresponds to variant rs35270667 [ dbSNP | Ensembl ]. | VAR_038792 | ||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 256 | 1 | Q → R in CAG33572. Ref.3 | |||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||
| Helix | 1 – 9 | 9 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 14 – 17 | 4 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 19 – 30 | 12 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 33 – 39 | 7 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 49 | 6 | ||||||||||||||||||||||||||||||||||||||
| Helix | 51 – 61 | 11 | ||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 85 | 17 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 100 | 7 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 103 – 112 | 10 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 125 | 11 | ||||||||||||||||||||||||||||||||||||||
| Helix | 128 – 134 | 7 | ||||||||||||||||||||||||||||||||||||||
| Helix | 136 – 169 | 34 | ||||||||||||||||||||||||||||||||||||||
| Helix | 186 – 196 | 11 | ||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 201 | 4 | ||||||||||||||||||||||||||||||||||||||
| Helix | 208 – 213 | 6 | ||||||||||||||||||||||||||||||||||||||
| Helix | 215 – 228 | 14 | ||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cernunnos, a novel nonhomologous end-joining factor, is mutated in human immunodeficiency with microcephaly." Buck D., Malivert L., de Chasseval R., Barraud A., Fondaneche M.-C., Sanal O., Plebani A., Stephan J.-L., Hufnagel M., le Deist F., Fischer A., Durandy A., de Villartay J.-P., Revy P. Cell 124:287-299(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS NHEJ1-SCID GLY-57 AND ARG-123. Tissue: Thymus. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 177-299 (ISOFORM 2). Tissue: Bone marrow and Skin. |
| [6] | "Nonhomologous end joining and V(D)J recombination require an additional factor." Dai Y., Kysela B., Hanakahi L.A., Manolis K., Riballo E., Stumm M., Harville T.O., West S.C., Oettinger M.A., Jeggo P.A. Proc. Natl. Acad. Sci. U.S.A. 100:2462-2467(2003) [PubMed] [Europe PMC] [Abstract] Cited for: DISEASE. |
| [7] | "XLF interacts with the XRCC4-DNA ligase IV complex to promote DNA nonhomologous end-joining." Ahnesorg P., Smith P., Jackson S.P. Cell 124:301-313(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH XRCC4, INVOLVEMENT IN NHEJ1-SCID. |
| [8] | "Cernunnos interacts with the XRCC4 x DNA-ligase IV complex and is homologous to the yeast nonhomologous end-joining factor Nej1." Callebaut I., Malivert L., Fischer A., Mornon J.P., Revy P., de Villartay J.P. J. Biol. Chem. 281:13857-13860(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH XRCC4-LIG4 COMPLEX. |
| [9] | "Truncation of NHEJ1 in a patient with polymicrogyria." Cantagrel V., Lossi A.M., Lisgo S., Missirian C., Borges A., Philip N., Fernandez C., Cardoso C., Figarella-Branger D., Moncla A., Lindsay S., Dobyns W.B., Villard L. Hum. Mutat. 28:356-364(2007) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION. |
| [10] | "Length-dependent binding of human XLF to DNA and stimulation of XRCC4.DNA ligase IV activity." Lu H., Pannicke U., Schwarz K., Lieber M.R. J. Biol. Chem. 282:11155-11162(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH XRCC4-LIG4 COMPLEX, DNA-BINDING, CHARACTERIZATION OF VARIANT NHEJ1-SCID GLY-57. |
| [11] | "Cernunnos/XLF promotes the ligation of mismatched and noncohesive DNA ends." Tsai C.J., Kim S.A., Chu G. Proc. Natl. Acad. Sci. U.S.A. 104:7851-7856(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Web resources
| NHEJ1base NHEJ1 mutation db |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ972687 mRNA. Translation: CAI99410.1. AK022672 mRNA. Translation: BAB14168.1. CR457291 mRNA. Translation: CAG33572.1. AC020575 Genomic DNA. No translation available. AC068946 Genomic DNA. No translation available. AC097468 Genomic DNA. Translation: AAX88921.1. BC008210 mRNA. Translation: AAH08210.2. BC012732 mRNA. Translation: AAH12732.1. BC030986 mRNA. Translation: AAH30986.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00549762. IPI00735288. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_079058.1. NM_024782.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.225988. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-37959N. | ||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9H9Q4. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-5003574. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000349313. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 74734059. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000356853; ENSP00000349313; ENSG00000187736. ENST00000409720; ENSP00000387290; ENSG00000187736. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 79840. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:79840. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002vjp.4. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 79840. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC02M219941. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:25737. NHEJ1. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB012334. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 611290. gene. 611291. phenotype. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 208447. Bilateral generalized polymicrogyria. 169079. Cernunnos-XLF deficiency. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA144596401. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG47408. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000089974. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG080703. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K10980. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | YWNFHCI. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_NHEJ1. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000187736. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 2.170.210.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR015381. XLF/Cernunnos. IPR009089. XRCC4_N. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF09302. XLF. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9H9Q4. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 79840. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 69516. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | NHEJ1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H9Q4 Secondary accession number(s): B8ZZA4 Q96JS9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
