Q9H9P8 (L2HDH_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: L-2-hydroxyglutarate dehydrogenase, mitochondrial EC=1.1.99.2 Alternative name(s): Duranin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 463 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | (S)-2-hydroxyglutarate + acceptor = 2-oxoglutarate + reduced acceptor. Ref.5 |
| Cofactor | FAD. Ref.5 |
| Subcellular location | |
| Tissue specificity | Widely expressed. Highly expressed in brain, testis and muscle. Expressed to a lower extent in lymphocytes, fibroblasts, keratinocytes, placenta, bladder, small intestine, liver and bone marrow. Ref.8 |
| Involvement in disease | Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA) [MIM:236792]. L2HGA is a rare autosomal recessive disorder clinically characterized by mild psychomotor delay in the first years of life, followed by progressive cerebellar ataxia, dysarthria and moderate to severe mental retardation. Diagnosis is based on the presence of an excess of L-2-hydroxyglutaric acid in urine, blood and cerebrospinal fluid. Ref.1 Ref.8 Ref.9 |
| Miscellaneous | Was named 'duranin' in honor of Marinus Duran, who first described L-2-hydroxyglutaric aciduria. |
| Sequence similarities | Belongs to the L2HGDH family. |
| Biophysicochemical properties | Kinetic parameters: KM=800 µM for L-2-hydroxyglutarate Ref.5 |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Transit peptide |
| Ligand | FAD Flavoprotein |
| Molecular function | Oxidoreductase |
| PTM | Acetylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | 2-oxoglutarate metabolic process Traceable author statement. Source: Reactome cellular protein metabolic processInferred from direct assay Ref.5. Source: HGNC |
| Cellular component | integral to mitochondrial inner membrane Non-traceable author statement Ref.5. Source: HGNC |
| Molecular function | 2-hydroxyglutarate dehydrogenase activity Inferred from direct assay Ref.5. Source: HGNC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H9P8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H9P8-2) The sequence of this isoform differs from the canonical sequence as follows: 400-400: G → QVAVRGPSWLWQQPMKVSDNNIYCFLWRCFALLLTGSTCSFK 401-463: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 51 | 51 | Mitochondrion Potential | ||||||
| Chain | 52 – 463 | 412 | L-2-hydroxyglutarate dehydrogenase, mitochondrial | PRO_0000228129 | |||||
Amino acid modifications | |||||||||
| Modified residue | 155 | 1 | N6-acetyllysine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 400 | 1 | G → QVAVRGPSWLWQQPMKVSDN NIYCFLWRCFALLLTGSTCS FK in isoform 2. | VSP_017662 | |||||
| Alternative sequence | 401 – 463 | 63 | Missing in isoform 2. | VSP_017663 | |||||
| Natural variant | 18 | 1 | L → R. Ref.4 Ref.9 Corresponds to variant rs2275591 [ dbSNP | Ensembl ]. | VAR_025681 | |||||
| Natural variant | 33 | 1 | R → S. Corresponds to variant rs35710558 [ dbSNP | Ensembl ]. | VAR_057808 | |||||
| Natural variant | 55 | 1 | G → D in L2HGA. Ref.8 | VAR_025682 | |||||
| Natural variant | 57 | 1 | G → R in L2HGA. Ref.9 | VAR_025683 | |||||
| Natural variant | 81 | 1 | K → E in L2HGA; alters protein processing and abolishes catalytic activity. Ref.1 | VAR_025684 | |||||
| Natural variant | 98 | 1 | H → R in L2HGA. Ref.9 | VAR_025685 | |||||
| Natural variant | 98 | 1 | H → Y in L2HGA. Ref.8 | VAR_025686 | |||||
| Natural variant | 176 | 1 | E → D in L2HGA; alters protein processing and abolishes catalytic activity. Ref.1 | VAR_025687 | |||||
| Natural variant | 178 | 1 | Y → F. Ref.9 | VAR_025688 | |||||
| Natural variant | 302 | 1 | P → L in L2HGA. Ref.8 Ref.9 | VAR_025689 | |||||
| Natural variant | 434 | 1 | H → P in L2HGA. Ref.9 | VAR_025690 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A gene encoding a putative FAD-dependent L-2-hydroxyglutarate dehydrogenase is mutated in L-2-hydroxyglutaric aciduria." Rzem R., Veiga-da-Cunha M., Noel G., Goffette S., Nassogne M.-C., Tabarki B., Schoeller C., Marquardt T., Vikkula M., van Schaftingen E. Proc. Natl. Acad. Sci. U.S.A. 101:16849-16854(2004) [PubMed: 15548604] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS L2HGA GLU-81 AND ASP-176, CHARACTERIZATION OF VARIANTS L2HGA GLU-81 AND ASP-176. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed: 12508121] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-18. Tissue: Placenta. |
| [5] | "The gene mutated in L-2-hydroxyglutaric aciduria encodes L-2-hydroxyglutarate dehydrogenase." Rzem R., Van Schaftingen E., Veiga-da-Cunha M. Biochimie 88:113-116(2006) [PubMed: 16005139] [Abstract] Cited for: CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, COFACTOR. |
| [6] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-155, MASS SPECTROMETRY. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [8] | "L-2-hydroxyglutaric aciduria: identification of a mutant gene C14orf160, localized on chromosome 14q22.1." Topcu M., Jobard F., Halliez S., Coskun T., Yalcinkayal C., Gerceker F.O., Wanders R.J.A., Prud'homme J.-F., Lathrop M., Ozguc M., Fischer J. Hum. Mol. Genet. 13:2803-2811(2004) [PubMed: 15385440] [Abstract] Cited for: VARIANTS L2HGA ASP-55; TYR-98 AND LEU-302, TISSUE SPECIFICITY. |
| [9] | "Novel L2HGDH mutations in 21 patients with L-2-hydroxyglutaric aciduria of Portuguese origin." Vilarinho L., Cardoso M.L., Gaspar P., Barbot C., Azevedo L., Diogo L., Santos M., Carrilho I., Fineza I., Kok F., Chorao R., Alegria P., Martins E., Teixeira J., Cabral-Fernandes H., Verhoeven N.M., Salomons G.S., Santorelli F.M. Jakobs C.Hum. Mutat. 26:395-396(2005) [PubMed: 16134148] [Abstract] Cited for: VARIANTS L2HGA ARG-57; ARG-98; LEU-302 AND PRO-434, VARIANTS ARG-18 AND PHE-178. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY757363 mRNA. Translation: AAV52330.1. AK022680 mRNA. Translation: BAB14174.1. AL109758 Genomic DNA. No translation available. AL359397 Genomic DNA. No translation available. BC006117 mRNA. Translation: AAH06117.1. |
| IPI | IPI00016458. IPI00029239. |
| RefSeq | NP_079160.1. NM_024884.2. |
| UniGene | Hs.256034. |
3D structure databases | |
| ProteinModelPortal | Q9H9P8. |
| SMR | Q9H9P8. Positions 47-458. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9H9P8. |
PTM databases | |
| PhosphoSite | Q9H9P8. |
Polymorphism databases | |
| DMDM | 90101396. |
Proteomic databases | |
| PRIDE | Q9H9P8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000267436; ENSP00000267436; ENSG00000087299. |
| GeneID | 79944. |
| KEGG | hsa:79944. |
| UCSC | uc001wxu.1. human. |
Organism-specific databases | |
| CTD | 79944. |
| GeneCards | GC14M050704. |
| H-InvDB | HIX0011640. |
| HGNC | HGNC:20499. L2HGDH. |
| MIM | 236792. phenotype. 609584. gene. |
| neXtProt | NX_Q9H9P8. |
| Orphanet | 19. 2-hydroxyglutaricaciduria. |
| PharmGKB | PA134971279. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11693. |
| GeneTree | ENSGT00490000043421. |
| HOGENOM | HBG525746. |
| HOVERGEN | HBG081883. |
| InParanoid | Q9H9P8. |
| OMA | GVHFTRM. |
| PhylomeDB | Q9H9P8. |
Enzyme and pathway databases | |
| BRENDA | 1.1.99.2. 2681. |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | Q9H9P8. |
| Bgee | Q9H9P8. |
| CleanEx | HS_L2HGDH. |
| Genevestigator | Q9H9P8. |
| GermOnline | ENSG00000087299. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006076. FAD-dep_OxRdtase. [Graphical view] |
| KO | K00109. |
| Pfam | PF01266. DAO. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 69898. |
| SOURCE | Search... |
Entry information
| Entry name | L2HDH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H9P8 Secondary accession number(s): Q9BRR1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with