Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative E3 ubiquitin-protein ligase UNKL

Gene

UNKL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May participate in a protein complex showing an E3 ligase activity regulated by RAC1. Ubiquitination is directed towards itself and possibly other substrates, such as SMARCD2/BAF60b. Intrinsic E3 ligase activity has not been proven.1 Publication

Caution

Was termed Unkempt.1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri75 – 104C3H1-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri115 – 145C3H1-type 2PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri243 – 277C3H1-type 3PROSITE-ProRule annotationAdd BLAST35
Zinc fingeri283 – 310C3H1-type 4PROSITE-ProRule annotationAdd BLAST28
Zinc fingeri639 – 674RING-typePROSITE-ProRule annotationAdd BLAST36

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayiUPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Putative E3 ubiquitin-protein ligase UNKL (EC:2.3.2.-)
Alternative name(s):
RING finger protein unkempt-like
Zinc finger CCCH domain-containing protein 5-like
Gene namesi
Name:UNKL
Synonyms:C16orf28, ZC3H5L, ZC3HDC5L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000059145.18
HGNCiHGNC:14184 UNKL
MIMi617463 gene
neXtProtiNX_Q9H9P5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi639C → A: No effects on the interaction with RAC1 or SMARCD2; when associated with A-670. 1 Publication1
Mutagenesisi670C → A: No effects on the interaction with RAC1 or SMARCD2; when associated with A-639. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000059145
PharmGKBiPA37855

Polymorphism and mutation databases

DMDMi300669704

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002786671 – 680Putative E3 ubiquitin-protein ligase UNKLAdd BLAST680

Post-translational modificationi

Isoform 4 is ubiquitinated in the C-terminal. Ubiquitination is enhanced by activated RAC1. The presence of the RING finger domain is not essential for ubiquitination to occur.

Keywords - PTMi

Ubl conjugation

Proteomic databases

PaxDbiQ9H9P5
PeptideAtlasiQ9H9P5
PRIDEiQ9H9P5

PTM databases

iPTMnetiQ9H9P5
PhosphoSitePlusiQ9H9P5

Expressioni

Gene expression databases

BgeeiENSG00000059145
CleanExiHS_UNKL
ExpressionAtlasiQ9H9P5 baseline and differential
GenevisibleiQ9H9P5 HS

Organism-specific databases

HPAiHPA055801
HPA073949

Interactioni

Subunit structurei

Isoform 4 (C-terminal) interacts with the GTP-bound form of RAC1. Isoform 4 (C-terminal) interacts with SMARCD2/BAF60b.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122243, 7 interactors
IntActiQ9H9P5, 24 interactors
MINTiQ9H9P5
STRINGi9606.ENSP00000373873

Structurei

3D structure databases

ProteinModelPortaliQ9H9P5
SMRiQ9H9P5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili563 – 619Sequence analysisAdd BLAST57

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi7 – 11Poly-Ala5
Compositional biasi61 – 64Poly-Arg4
Compositional biasi374 – 561Ser-richAdd BLAST188

Domaini

Although this protein contains a RING domain, intrinsic E3 ligase activity has not been proven.1 Publication

Sequence similaritiesi

Belongs to the unkempt family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri75 – 104C3H1-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri115 – 145C3H1-type 2PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri243 – 277C3H1-type 3PROSITE-ProRule annotationAdd BLAST35
Zinc fingeri283 – 310C3H1-type 4PROSITE-ProRule annotationAdd BLAST28
Zinc fingeri639 – 674RING-typePROSITE-ProRule annotationAdd BLAST36

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1100 Eukaryota
KOG1595 Eukaryota
ENOG410XR0Z LUCA
GeneTreeiENSGT00390000012005
HOVERGENiHBG061441
InParanoidiQ9H9P5
PhylomeDBiQ9H9P5
TreeFamiTF314982

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR000571 Znf_CCCH
IPR036855 Znf_CCCH_sf
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00642 zf-CCCH, 1 hit
SMARTiView protein in SMART
SM00356 ZnF_C3H1, 4 hits
SUPFAMiSSF90229 SSF90229, 1 hit
PROSITEiView protein in PROSITE
PS50103 ZF_C3H1, 4 hits
PS50089 ZF_RING_2, 1 hit

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 4 (identifier: Q9H9P5-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSVSKAAAA ALSGSPPQTE KPTHYRYLKE FRTEQCPLFS QHKCAQHRPF
60 70 80 90 100
TCFHWHFLNQ RRRRPLRRRD GTFNYSPDVY CSKYNEATGV CPDGDECPYL
110 120 130 140 150
HRTTGDTERK YHLRYYKTGT CIHETDARGH CVKNGLHCAF AHGPLDLRPP
160 170 180 190 200
VCDVRELQAQ EALQNGQLGG GEGVPDLQPG VLASQAMIEK ILSEDPRWQD
210 220 230 240 250
ANFVLGSYKT EQCPKPPRLC RQGYACPHYH NSRDRRRNPR RFQYRSTPCP
260 270 280 290 300
SVKHGDEWGE PSRCDGGDGC QYCHSRTEQQ FHPESTKCND MRQTGYCPRG
310 320 330 340 350
PFCAFAHVEK SLGMVNEWGC HDLHLTSPSS TGSGQPGNAK RRDSPAEGGP
360 370 380 390 400
RGSEQDSKQN HLAVFAAVHP PAPSVSSSVA SSLASSAGSG SSSPTALPAP
410 420 430 440 450
PARALPLGPA SSTVEAVLGS ALDLHLSNVN IASLEKDLEE QDGHDLGAAG
460 470 480 490 500
PRSLAGSAPV AIPGSLPRAP SLHSPSSAST SPLGSLSQPL PGPVGSSAMT
510 520 530 540 550
PPQQPPPLRS EPGTLGSAAS SYSPLGLNGV PGSIWDFVSG SFSPSPSPIL
560 570 580 590 600
SAGPPSSSSA SPNGAELARV RRQLDEAKRK IRQWEESWQQ VKQVCDAWQR
610 620 630 640 650
EAQEAKERAR VADSDRQLAL QKKEEVEAQV IFQLRAKQCV ACRERAHGAV
660 670 680
LRPCQHHILC EPCAATAPEC PYCKGQPLQW
Note: Splice site between exons 6 and 7 is non-canonical.
Length:680
Mass (Da):73,828
Last modified:July 13, 2010 - v3
Checksum:iFC3205EB1616075E
GO
Isoform 1 (identifier: Q9H9P5-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-498: Missing.
     630-630: V → VKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGV

Show »
Length:232
Mass (Da):25,229
Checksum:iFAE1860922258EE2
GO
Isoform 2 (identifier: Q9H9P5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-498: Missing.

Show »
Length:182
Mass (Da):19,981
Checksum:iAAB878A688027506
GO
Isoform 3 (identifier: Q9H9P5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-501: Missing.
     502-525: PQQPPPLRSEPGTLGSAASSYSPL → MTCCSQVPPRRRPSLALSPRLDCN
     630-630: V → VKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGV

Show »
Length:229
Mass (Da):25,163
Checksum:i09E116107AE15BBB
GO
Isoform 5 (identifier: Q9H9P5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-277: RSTPCPSVKHGDEWGEPSRCDGGDGCQYCHSRT → SWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA
     278-680: Missing.

Show »
Length:277
Mass (Da):31,752
Checksum:iE2BBA5DFC89DA3AF
GO
Isoform 6 (identifier: Q9H9P5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-96: E → ESLLGVLYPL...GVWWTLLGFR
     199-199: Q → QALLPVALLRHRVAHFS
     284-284: E → EGPVGSPVSG...PHVCVFPIYK
     359-359: Q → QGVRAHGVYVFEQ
     419-554: GSALDLHLSN...SPSPILSAGP → ALEPTPSSPT...HRQDTRPVPS
     555-680: Missing.

Note: No experimental confirmation available.
Show »
Length:756
Mass (Da):81,571
Checksum:iD724666951448E24
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti541S → R in CAQ16184 (PubMed:20148946).Curated1
Sequence conflicti549I → V in BAB14178 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0394321 – 501Missing in isoform 3. 1 PublicationAdd BLAST501
Alternative sequenceiVSP_0394331 – 498Missing in isoform 1 and isoform 2. 1 PublicationAdd BLAST498
Alternative sequenceiVSP_03943496E → ESLLGVLYPLWAPPPVPAPV GAPTVHPFLARWFSHVPWEP AGSADPRASSTPAGGTTWAT GLLGDFDACGSQSRECVKGV WWTLLGFR in isoform 6. Curated1
Alternative sequenceiVSP_039435199Q → QALLPVALLRHRVAHFS in isoform 6. Curated1
Alternative sequenceiVSP_039436245 – 277RSTPC…CHSRT → SWQLGRRVLRLSPRANNPRV ALPRVHTGPSSTA in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_039437278 – 680Missing in isoform 5. 1 PublicationAdd BLAST403
Alternative sequenceiVSP_039438284E → EGPVGSPVSGAFSVFSHAGL VADPSLWYPAEWSWHHVGHS RTINPEGDKPSRLGPAPENI KRGNDFACDGRADAAGMAPH VCVFPIYK in isoform 6. Curated1
Alternative sequenceiVSP_039439359Q → QGVRAHGVYVFEQ in isoform 6. Curated1
Alternative sequenceiVSP_039440419 – 554GSALD…LSAGP → ALEPTPSSPTSSAVQGVAGE LGMGSGGQGCWSHVVGALAA VPAWTHSGDLEWDPSTIRTR VNVGGGPAARPAMTLAREPQ LLVVGGCPTRNCSGPAASPQ QLLDDAGQGGRGERDSSQRP LRPQTTHRQDTRPVPS in isoform 6. CuratedAdd BLAST136
Alternative sequenceiVSP_039441502 – 525PQQPP…SYSPL → MTCCSQVPPRRRPSLALSPR LDCN in isoform 3. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_039442555 – 680Missing in isoform 6. CuratedAdd BLAST126
Alternative sequenceiVSP_039443630V → VKQLQEELEGLGVASTLPGL RGCGDIGTIPLPKLHSLQSQ LRLDLEAVDGV in isoform 1 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM944365 mRNA Translation: CAQ16184.1
AK022685 mRNA Translation: BAB14178.1
AK027013 mRNA Translation: BAB15626.1
AE006467 Genomic DNA Translation: AAK61278.1
AE006467 Genomic DNA Translation: AAK61279.1
AL031709 Genomic DNA No translation available.
AL031721 Genomic DNA No translation available.
AL032819 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85659.1
CH471112 Genomic DNA Translation: EAW85660.1
CH471112 Genomic DNA Translation: EAW85662.1
BC000150 mRNA Translation: AAH00150.1
BC011924 mRNA Translation: AAH11924.1
CCDSiCCDS32359.1 [Q9H9P5-5]
CCDS53980.1 [Q9H9P5-2]
CCDS61787.1 [Q9H9P5-3]
PIRiT45063
RefSeqiNP_001032202.1, NM_001037125.3 [Q9H9P5-5]
NP_001180317.2, NM_001193388.3
NP_001180318.1, NM_001193389.1 [Q9H9P5-2]
NP_001263343.1, NM_001276414.1 [Q9H9P5-3]
XP_016879057.1, XM_017023568.1 [Q9H9P5-1]
XP_016879058.1, XM_017023569.1 [Q9H9P5-1]
UniGeneiHs.643536
Hs.745452

Genome annotation databases

EnsembliENST00000248104; ENSP00000248104; ENSG00000059145 [Q9H9P5-3]
ENST00000301712; ENSP00000301712; ENSG00000059145 [Q9H9P5-5]
ENST00000397464; ENSP00000380606; ENSG00000059145 [Q9H9P5-2]
GeneIDi64718
KEGGihsa:64718
UCSCiuc002clo.3 human [Q9H9P5-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiUNKL_HUMAN
AccessioniPrimary (citable) accession number: Q9H9P5
Secondary accession number(s): B0QYN6
, B1GXI8, Q96EV1, Q96RZ1, Q9BWL5, Q9H5K0, Q9UJJ8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: July 13, 2010
Last modified: May 23, 2018
This is version 133 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health