Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative E3 ubiquitin-protein ligase UNKL

Gene

UNKL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May participate in a protein complex showing an E3 ligase activity regulated by RAC1. Ubiquitination is directed towards itself and possibly other substrates, such as SMARCD2/BAF60b. Intrinsic E3 ligase activity has not been proven.1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri75 – 10430C3H1-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri115 – 14531C3H1-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri243 – 27735C3H1-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri283 – 31028C3H1-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri639 – 67436RING-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Putative E3 ubiquitin-protein ligase UNKL (EC:6.3.2.-)
Alternative name(s):
RING finger protein unkempt-like
Zinc finger CCCH domain-containing protein 5-like
Gene namesi
Name:UNKL
Synonyms:C16orf28, ZC3H5L, ZC3HDC5L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:14184. UNKL.

Subcellular locationi

Isoform 4 :
  • Cytoplasm
  • Nucleus

  • Note: Isoform 4 is primarily localized in the cytoplasm but has the ability to shuttle between the nucleus and the cytoplasm.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi639 – 6391C → A: No effects on the interaction with RAC1 or SMARCD2; when associated with A-670. 1 Publication
Mutagenesisi670 – 6701C → A: No effects on the interaction with RAC1 or SMARCD2; when associated with A-639. 1 Publication

Organism-specific databases

PharmGKBiPA37855.

Polymorphism and mutation databases

DMDMi300669704.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 680680Putative E3 ubiquitin-protein ligase UNKLPRO_0000278667Add
BLAST

Post-translational modificationi

Isoform 4 is ubiquitinated in the C-terminal. Ubiquitination is enhanced by activated RAC1. The presence of the RING finger domain is not essential for ubiquitination to occur.

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ9H9P5.
MaxQBiQ9H9P5.
PaxDbiQ9H9P5.
PeptideAtlasiQ9H9P5.
PRIDEiQ9H9P5.

PTM databases

iPTMnetiQ9H9P5.

Expressioni

Gene expression databases

BgeeiQ9H9P5.
CleanExiHS_UNKL.
ExpressionAtlasiQ9H9P5. baseline and differential.
GenevisibleiQ9H9P5. HS.

Organism-specific databases

HPAiHPA055801.

Interactioni

Subunit structurei

Isoform 4 (C-terminal) interacts with the GTP-bound form of RAC1. Isoform 4 (C-terminal) interacts with SMARCD2/BAF60b.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
RAC1P630002EBI-7797561,EBI-413628
SMARCD2Q929252EBI-7797561,EBI-358441

Protein-protein interaction databases

BioGridi122243. 7 interactions.
IntActiQ9H9P5. 5 interactions.
MINTiMINT-7543031.
STRINGi9606.ENSP00000373873.

Structurei

3D structure databases

ProteinModelPortaliQ9H9P5.
SMRiQ9H9P5. Positions 635-678.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili563 – 61957Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi7 – 115Poly-Ala
Compositional biasi61 – 644Poly-Arg
Compositional biasi374 – 561188Ser-richAdd
BLAST

Domaini

Although this protein contains a RING domain, intrinsic E3 ligase activity has not been proven.1 Publication

Sequence similaritiesi

Belongs to the unkempt family.Curated
Contains 4 C3H1-type zinc fingers.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri75 – 10430C3H1-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri115 – 14531C3H1-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri243 – 27735C3H1-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri283 – 31028C3H1-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri639 – 67436RING-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1100. Eukaryota.
KOG1595. Eukaryota.
ENOG410XR0Z. LUCA.
GeneTreeiENSGT00390000012005.
HOVERGENiHBG061441.
InParanoidiQ9H9P5.
PhylomeDBiQ9H9P5.
TreeFamiTF314982.

Family and domain databases

Gene3Di4.10.1000.10. 1 hit.
InterProiIPR000571. Znf_CCCH.
IPR001841. Znf_RING.
[Graphical view]
PfamiPF00642. zf-CCCH. 1 hit.
[Graphical view]
SMARTiSM00356. ZnF_C3H1. 4 hits.
[Graphical view]
SUPFAMiSSF90229. SSF90229. 1 hit.
PROSITEiPS50103. ZF_C3H1. 4 hits.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 4 (identifier: Q9H9P5-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSVSKAAAA ALSGSPPQTE KPTHYRYLKE FRTEQCPLFS QHKCAQHRPF
60 70 80 90 100
TCFHWHFLNQ RRRRPLRRRD GTFNYSPDVY CSKYNEATGV CPDGDECPYL
110 120 130 140 150
HRTTGDTERK YHLRYYKTGT CIHETDARGH CVKNGLHCAF AHGPLDLRPP
160 170 180 190 200
VCDVRELQAQ EALQNGQLGG GEGVPDLQPG VLASQAMIEK ILSEDPRWQD
210 220 230 240 250
ANFVLGSYKT EQCPKPPRLC RQGYACPHYH NSRDRRRNPR RFQYRSTPCP
260 270 280 290 300
SVKHGDEWGE PSRCDGGDGC QYCHSRTEQQ FHPESTKCND MRQTGYCPRG
310 320 330 340 350
PFCAFAHVEK SLGMVNEWGC HDLHLTSPSS TGSGQPGNAK RRDSPAEGGP
360 370 380 390 400
RGSEQDSKQN HLAVFAAVHP PAPSVSSSVA SSLASSAGSG SSSPTALPAP
410 420 430 440 450
PARALPLGPA SSTVEAVLGS ALDLHLSNVN IASLEKDLEE QDGHDLGAAG
460 470 480 490 500
PRSLAGSAPV AIPGSLPRAP SLHSPSSAST SPLGSLSQPL PGPVGSSAMT
510 520 530 540 550
PPQQPPPLRS EPGTLGSAAS SYSPLGLNGV PGSIWDFVSG SFSPSPSPIL
560 570 580 590 600
SAGPPSSSSA SPNGAELARV RRQLDEAKRK IRQWEESWQQ VKQVCDAWQR
610 620 630 640 650
EAQEAKERAR VADSDRQLAL QKKEEVEAQV IFQLRAKQCV ACRERAHGAV
660 670 680
LRPCQHHILC EPCAATAPEC PYCKGQPLQW
Note: Splice site between exons 6 and 7 is non-canonical.
Length:680
Mass (Da):73,828
Last modified:July 13, 2010 - v3
Checksum:iFC3205EB1616075E
GO
Isoform 1 (identifier: Q9H9P5-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-498: Missing.
     630-630: V → VKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGV

Show »
Length:232
Mass (Da):25,229
Checksum:iFAE1860922258EE2
GO
Isoform 2 (identifier: Q9H9P5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-498: Missing.

Show »
Length:182
Mass (Da):19,981
Checksum:iAAB878A688027506
GO
Isoform 3 (identifier: Q9H9P5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-501: Missing.
     502-525: PQQPPPLRSEPGTLGSAASSYSPL → MTCCSQVPPRRRPSLALSPRLDCN
     630-630: V → VKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGV

Show »
Length:229
Mass (Da):25,163
Checksum:i09E116107AE15BBB
GO
Isoform 5 (identifier: Q9H9P5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-277: RSTPCPSVKHGDEWGEPSRCDGGDGCQYCHSRT → SWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA
     278-680: Missing.

Show »
Length:277
Mass (Da):31,752
Checksum:iE2BBA5DFC89DA3AF
GO
Isoform 6 (identifier: Q9H9P5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-96: E → ESLLGVLYPL...GVWWTLLGFR
     199-199: Q → QALLPVALLRHRVAHFS
     284-284: E → EGPVGSPVSG...PHVCVFPIYK
     359-359: Q → QGVRAHGVYVFEQ
     419-554: GSALDLHLSN...SPSPILSAGP → ALEPTPSSPT...HRQDTRPVPS
     555-680: Missing.

Note: No experimental confirmation available.
Show »
Length:756
Mass (Da):81,571
Checksum:iD724666951448E24
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti541 – 5411S → R in CAQ16184 (PubMed:20148946).Curated
Sequence conflicti549 – 5491I → V in BAB14178 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 501501Missing in isoform 3. 1 PublicationVSP_039432Add
BLAST
Alternative sequencei1 – 498498Missing in isoform 1 and isoform 2. 1 PublicationVSP_039433Add
BLAST
Alternative sequencei96 – 961E → ESLLGVLYPLWAPPPVPAPV GAPTVHPFLARWFSHVPWEP AGSADPRASSTPAGGTTWAT GLLGDFDACGSQSRECVKGV WWTLLGFR in isoform 6. CuratedVSP_039434
Alternative sequencei199 – 1991Q → QALLPVALLRHRVAHFS in isoform 6. CuratedVSP_039435
Alternative sequencei245 – 27733RSTPC…CHSRT → SWQLGRRVLRLSPRANNPRV ALPRVHTGPSSTA in isoform 5. 1 PublicationVSP_039436Add
BLAST
Alternative sequencei278 – 680403Missing in isoform 5. 1 PublicationVSP_039437Add
BLAST
Alternative sequencei284 – 2841E → EGPVGSPVSGAFSVFSHAGL VADPSLWYPAEWSWHHVGHS RTINPEGDKPSRLGPAPENI KRGNDFACDGRADAAGMAPH VCVFPIYK in isoform 6. CuratedVSP_039438
Alternative sequencei359 – 3591Q → QGVRAHGVYVFEQ in isoform 6. CuratedVSP_039439
Alternative sequencei419 – 554136GSALD…LSAGP → ALEPTPSSPTSSAVQGVAGE LGMGSGGQGCWSHVVGALAA VPAWTHSGDLEWDPSTIRTR VNVGGGPAARPAMTLAREPQ LLVVGGCPTRNCSGPAASPQ QLLDDAGQGGRGERDSSQRP LRPQTTHRQDTRPVPS in isoform 6. CuratedVSP_039440Add
BLAST
Alternative sequencei502 – 52524PQQPP…SYSPL → MTCCSQVPPRRRPSLALSPR LDCN in isoform 3. 1 PublicationVSP_039441Add
BLAST
Alternative sequencei555 – 680126Missing in isoform 6. CuratedVSP_039442Add
BLAST
Alternative sequencei630 – 6301V → VKQLQEELEGLGVASTLPGL RGCGDIGTIPLPKLHSLQSQ LRLDLEAVDGV in isoform 1 and isoform 3. 2 PublicationsVSP_039443

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM944365 mRNA. Translation: CAQ16184.1.
AK022685 mRNA. Translation: BAB14178.1.
AK027013 mRNA. Translation: BAB15626.1.
AE006467 Genomic DNA. Translation: AAK61278.1.
AE006467 Genomic DNA. Translation: AAK61279.1.
AL031709, AL031721 Genomic DNA. Translation: CAM26360.1.
AL031721, AL031709 Genomic DNA. Translation: CAM26438.1.
AL031709, AL031721 Genomic DNA. Translation: CAM26361.1.
AL031721, AL031709 Genomic DNA. Translation: CAM26439.1.
AL031709, AL031721 Genomic DNA. Translation: CAQ08606.1.
AL031721, AL031709 Genomic DNA. Translation: CAQ10206.1.
AL032819, AL031721 Genomic DNA. Translation: CAM26346.1.
AL031721, AL032819 Genomic DNA. Translation: CAM26441.1.
CH471112 Genomic DNA. Translation: EAW85659.1.
CH471112 Genomic DNA. Translation: EAW85660.1.
CH471112 Genomic DNA. Translation: EAW85662.1.
BC000150 mRNA. Translation: AAH00150.1.
BC011924 mRNA. Translation: AAH11924.1.
CCDSiCCDS32359.1. [Q9H9P5-5]
CCDS53980.1. [Q9H9P5-2]
CCDS61787.1. [Q9H9P5-3]
PIRiT45063.
RefSeqiNP_001032202.1. NM_001037125.3. [Q9H9P5-5]
NP_001180317.2. NM_001193388.3.
NP_001180318.1. NM_001193389.1. [Q9H9P5-2]
NP_001263343.1. NM_001276414.1. [Q9H9P5-3]
UniGeneiHs.643536.
Hs.745452.

Genome annotation databases

EnsembliENST00000248104; ENSP00000248104; ENSG00000059145. [Q9H9P5-3]
ENST00000301712; ENSP00000301712; ENSG00000059145. [Q9H9P5-5]
ENST00000397464; ENSP00000380606; ENSG00000059145. [Q9H9P5-2]
GeneIDi64718.
KEGGihsa:64718.
UCSCiuc002clo.3. human. [Q9H9P5-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM944365 mRNA. Translation: CAQ16184.1.
AK022685 mRNA. Translation: BAB14178.1.
AK027013 mRNA. Translation: BAB15626.1.
AE006467 Genomic DNA. Translation: AAK61278.1.
AE006467 Genomic DNA. Translation: AAK61279.1.
AL031709, AL031721 Genomic DNA. Translation: CAM26360.1.
AL031721, AL031709 Genomic DNA. Translation: CAM26438.1.
AL031709, AL031721 Genomic DNA. Translation: CAM26361.1.
AL031721, AL031709 Genomic DNA. Translation: CAM26439.1.
AL031709, AL031721 Genomic DNA. Translation: CAQ08606.1.
AL031721, AL031709 Genomic DNA. Translation: CAQ10206.1.
AL032819, AL031721 Genomic DNA. Translation: CAM26346.1.
AL031721, AL032819 Genomic DNA. Translation: CAM26441.1.
CH471112 Genomic DNA. Translation: EAW85659.1.
CH471112 Genomic DNA. Translation: EAW85660.1.
CH471112 Genomic DNA. Translation: EAW85662.1.
BC000150 mRNA. Translation: AAH00150.1.
BC011924 mRNA. Translation: AAH11924.1.
CCDSiCCDS32359.1. [Q9H9P5-5]
CCDS53980.1. [Q9H9P5-2]
CCDS61787.1. [Q9H9P5-3]
PIRiT45063.
RefSeqiNP_001032202.1. NM_001037125.3. [Q9H9P5-5]
NP_001180317.2. NM_001193388.3.
NP_001180318.1. NM_001193389.1. [Q9H9P5-2]
NP_001263343.1. NM_001276414.1. [Q9H9P5-3]
UniGeneiHs.643536.
Hs.745452.

3D structure databases

ProteinModelPortaliQ9H9P5.
SMRiQ9H9P5. Positions 635-678.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122243. 7 interactions.
IntActiQ9H9P5. 5 interactions.
MINTiMINT-7543031.
STRINGi9606.ENSP00000373873.

PTM databases

iPTMnetiQ9H9P5.

Polymorphism and mutation databases

DMDMi300669704.

Proteomic databases

EPDiQ9H9P5.
MaxQBiQ9H9P5.
PaxDbiQ9H9P5.
PeptideAtlasiQ9H9P5.
PRIDEiQ9H9P5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248104; ENSP00000248104; ENSG00000059145. [Q9H9P5-3]
ENST00000301712; ENSP00000301712; ENSG00000059145. [Q9H9P5-5]
ENST00000397464; ENSP00000380606; ENSG00000059145. [Q9H9P5-2]
GeneIDi64718.
KEGGihsa:64718.
UCSCiuc002clo.3. human. [Q9H9P5-4]

Organism-specific databases

CTDi64718.
GeneCardsiUNKL.
HGNCiHGNC:14184. UNKL.
HPAiHPA055801.
neXtProtiNX_Q9H9P5.
PharmGKBiPA37855.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1100. Eukaryota.
KOG1595. Eukaryota.
ENOG410XR0Z. LUCA.
GeneTreeiENSGT00390000012005.
HOVERGENiHBG061441.
InParanoidiQ9H9P5.
PhylomeDBiQ9H9P5.
TreeFamiTF314982.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

ChiTaRSiUNKL. human.
GeneWikiiUNKL.
GenomeRNAii64718.
PROiQ9H9P5.

Gene expression databases

BgeeiQ9H9P5.
CleanExiHS_UNKL.
ExpressionAtlasiQ9H9P5. baseline and differential.
GenevisibleiQ9H9P5. HS.

Family and domain databases

Gene3Di4.10.1000.10. 1 hit.
InterProiIPR000571. Znf_CCCH.
IPR001841. Znf_RING.
[Graphical view]
PfamiPF00642. zf-CCCH. 1 hit.
[Graphical view]
SMARTiSM00356. ZnF_C3H1. 4 hits.
[Graphical view]
SUPFAMiSSF90229. SSF90229. 1 hit.
PROSITEiPS50103. ZF_C3H1. 4 hits.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The SWI/SNF protein BAF60b is ubiquitinated through a signalling process involving Rac GTPase and the RING finger protein Unkempt."
    Lores P., Visvikis O., Luna R., Lemichez E., Gacon G.
    FEBS J. 277:1453-1464(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), FUNCTION, INTERACTION WITH RAC1 AND SMARCD2, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-639 AND CYS-670.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  3. "Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16."
    Daniels R.J., Peden J.F., Lloyd C., Horsley S.W., Clark K., Tufarelli C., Kearney L., Buckle V.J., Doggett N.A., Flint J., Higgs D.R.
    Hum. Mol. Genet. 10:339-352(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 2 AND 6).
  4. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
    Tissue: Placenta.
  7. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiUNKL_HUMAN
AccessioniPrimary (citable) accession number: Q9H9P5
Secondary accession number(s): B0QYN6
, B1GXI8, Q96EV1, Q96RZ1, Q9BWL5, Q9H5K0, Q9UJJ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: July 13, 2010
Last modified: July 6, 2016
This is version 117 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Was termed Unkempt.1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.