Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CCR4-NOT transcription complex subunit 10

Gene

CNOT10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. Is not required for association of CNOT7 to the CCR4-NOT complex.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

RNA-mediated gene silencing, Transcription, Transcription regulation, Translation regulation

Enzyme and pathway databases

BioCyciZFISH:G66-32087-MONOMER.
ReactomeiR-HSA-429947. Deadenylation of mRNA.
R-HSA-6804115. TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain.

Names & Taxonomyi

Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 10
Gene namesi
Name:CNOT10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:23817. CNOT10.

Subcellular locationi

GO - Cellular componenti

  • CCR4-NOT complex Source: UniProtKB
  • cytosol Source: Reactome
  • membrane Source: UniProtKB
  • nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000182973.
PharmGKBiPA134862503.

Polymorphism and mutation databases

BioMutaiCNOT10.
DMDMi74733982.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00003145792 – 744CCR4-NOT transcription complex subunit 10Add BLAST743

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9H9A5.
MaxQBiQ9H9A5.
PaxDbiQ9H9A5.
PeptideAtlasiQ9H9A5.
PRIDEiQ9H9A5.

PTM databases

iPTMnetiQ9H9A5.
PhosphoSitePlusiQ9H9A5.

Expressioni

Gene expression databases

BgeeiENSG00000182973.
CleanExiHS_CNOT10.
ExpressionAtlasiQ9H9A5. baseline and differential.
GenevisibleiQ9H9A5. HS.

Organism-specific databases

HPAiHPA035614.
HPA041450.

Interactioni

Subunit structurei

Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits. CNOT10 and CNOT11 form a subcomplex docked to the CNOT1 scaffold.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CNOT11Q9UKZ14EBI-1054261,EBI-2562014

Protein-protein interaction databases

BioGridi117411. 38 interactors.
DIPiDIP-46839N.
IntActiQ9H9A5. 24 interactors.
MINTiMINT-6781568.
STRINGi9606.ENSP00000330060.

Structurei

3D structure databases

ProteinModelPortaliQ9H9A5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili74 – 107Sequence analysisAdd BLAST34

Sequence similaritiesi

Belongs to the CNOT10 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2471. Eukaryota.
ENOG410XQQJ. LUCA.
GeneTreeiENSGT00390000001827.
HOGENOMiHOG000111843.
HOVERGENiHBG077464.
InParanoidiQ9H9A5.
KOiK12607.
OMAiSDQGAEK.
OrthoDBiEOG091G06Q4.
PhylomeDBiQ9H9A5.
TreeFamiTF323368.

Family and domain databases

Gene3Di1.25.40.10. 5 hits.
InterProiIPR011990. TPR-like_helical_dom.
IPR019734. TPR_repeat.
[Graphical view]
SMARTiSM00028. TPR. 4 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 8 hits.

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H9A5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAADKPADQG AEKHEGTGQS SGITDQEKEL STNAFQAFTS GNYDACLQHL
60 70 80 90 100
ACLQDINKDD YKIILNTAVA EFFKSNQTTT DNLRQTLNQL KNQVHSAVEE
110 120 130 140 150
MDGLDDVENS MLYYNQAVIL YHLRQYTEAI SVGEKLYQFI EPFEEKFAQA
160 170 180 190 200
VCFLLVDLYI LTYQAEKALH LLAVLEKMIS QGNNNKNGKN ETGNNNNKDG
210 220 230 240 250
SNHKAESGAL IEAAKSKIHQ YKVRAYIQMK SLKACKREIK SVMNTAGNSA
260 270 280 290 300
PSLFLKSNFE YLRGNYRKAV KLLNSSNIAE HPGFMKTGEC LRCMFWNNLG
310 320 330 340 350
CIHFAMSKHN LGIFYFKKAL QENDNVCAQL SAGSTDPGKK FSGRPMCTLL
360 370 380 390 400
TNKRYELLYN CGIQLLHIGR PLAAFECLIE AVQVYHANPR LWLRLAECCI
410 420 430 440 450
AANKGTSEQE TKGLPSKKGI VQSIVGQGYH RKIVLASQSI QNTVYNDGQS
460 470 480 490 500
SAIPVASMEF AAICLRNALL LLPEEQQDPK QENGAKNSNQ LGGNTESSES
510 520 530 540 550
SETCSSKSHD GDKFIPAPPS SPLRKQELEN LKCSILACSA YVALALGDNL
560 570 580 590 600
MALNHADKLL QQPKLSGSLK FLGHLYAAEA LISLDRISDA ITHLNPENVT
610 620 630 640 650
DVSLGISSNE QDQGSDKGEN EAMESSGKRA PQCYPSSVNS ARTVMLFNLG
660 670 680 690 700
SAYCLRSEYD KARKCLHQAA SMIHPKEVPP EAILLAVYLE LQNGNTQLAL
710 720 730 740
QIIKRNQLLP AVKTHSEVRK KPVFQPVHPI QPIQMPAFTT VQRK
Length:744
Mass (Da):82,310
Last modified:March 1, 2001 - v1
Checksum:iBA1984B71F0A1E7A
GO
Isoform 2 (identifier: Q9H9A5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-144: Missing.

Show »
Length:743
Mass (Da):82,181
Checksum:i46D04260B4E124E7
GO
Isoform 3 (identifier: Q9H9A5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     505-532: SSKSHDGDKFIPAPPSSPLRKQELENLK → R

Show »
Length:717
Mass (Da):79,377
Checksum:i4981E1632AB0368B
GO
Isoform 4 (identifier: Q9H9A5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     505-532: SSKSHDGDKFIPAPPSSPLRKQELENLK → R
     556-577: Missing.

Show »
Length:695
Mass (Da):76,968
Checksum:iDEA9C9A66A253FE1
GO
Isoform 5 (identifier: Q9H9A5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-293: Missing.

Show »
Length:451
Mass (Da):49,483
Checksum:i8F1BA3511B5863D5
GO
Isoform 6 (identifier: Q9H9A5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAADKPA → MKSIGVKTVKVCGSKSSVRIEGQPCSLGQSRRKVKLMGERSYTLSIGNGDYFWANKEMLWDYVQTLS

Note: No experimental confirmation available.
Show »
Length:804
Mass (Da):89,141
Checksum:iB1B0728C82613355
GO

Sequence cautioni

The sequence BAB13876 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5K → R in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti52C → R in BAB14478 (PubMed:14702039).Curated1
Sequence conflicti270V → M in BAB13876 (PubMed:14702039).Curated1
Sequence conflicti478D → G in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti509H → Y in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti518P → L in BAH13647 (PubMed:14702039).Curated1
Sequence conflicti622A → T in BAB14478 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053982348T → S.1 PublicationCorresponds to variant rs11558687dbSNPEnsembl.1
Natural variantiVAR_037957736P → S.1 PublicationCorresponds to variant rs17849684dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0303111 – 293Missing in isoform 5. 1 PublicationAdd BLAST293
Alternative sequenceiVSP_0455571 – 7MAADKPA → MKSIGVKTVKVCGSKSSVRI EGQPCSLGQSRRKVKLMGER SYTLSIGNGDYFWANKEMLW DYVQTLS in isoform 6. 1 Publication7
Alternative sequenceiVSP_030312144Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_030313505 – 532SSKSH…LENLK → R in isoform 3 and isoform 4. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_030314556 – 577Missing in isoform 4. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021695 mRNA. Translation: BAB13876.1. Different initiation.
AK022576 mRNA. Translation: BAB14108.1.
AK022952 mRNA. Translation: BAB14327.1.
AK023227 mRNA. Translation: BAB14478.1.
AK027026 mRNA. Translation: BAB15629.1.
AK302196 mRNA. Translation: BAH13647.1.
AC138972 Genomic DNA. No translation available.
AC139452 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64435.1.
BC002928 mRNA. Translation: AAH02928.1.
BC002931 mRNA. Translation: AAH02931.1.
AL117639 mRNA. Translation: CAB56027.2.
CCDSiCCDS2655.1. [Q9H9A5-1]
CCDS58821.1. [Q9H9A5-3]
CCDS58822.1. [Q9H9A5-6]
RefSeqiNP_001243670.1. NM_001256741.1. [Q9H9A5-3]
NP_001243671.1. NM_001256742.1. [Q9H9A5-6]
NP_056257.1. NM_015442.2. [Q9H9A5-1]
UniGeneiHs.444851.

Genome annotation databases

EnsembliENST00000328834; ENSP00000330060; ENSG00000182973. [Q9H9A5-1]
ENST00000331889; ENSP00000329376; ENSG00000182973. [Q9H9A5-3]
ENST00000454516; ENSP00000399862; ENSG00000182973. [Q9H9A5-6]
GeneIDi25904.
KEGGihsa:25904.
UCSCiuc003cfc.2. human. [Q9H9A5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021695 mRNA. Translation: BAB13876.1. Different initiation.
AK022576 mRNA. Translation: BAB14108.1.
AK022952 mRNA. Translation: BAB14327.1.
AK023227 mRNA. Translation: BAB14478.1.
AK027026 mRNA. Translation: BAB15629.1.
AK302196 mRNA. Translation: BAH13647.1.
AC138972 Genomic DNA. No translation available.
AC139452 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64435.1.
BC002928 mRNA. Translation: AAH02928.1.
BC002931 mRNA. Translation: AAH02931.1.
AL117639 mRNA. Translation: CAB56027.2.
CCDSiCCDS2655.1. [Q9H9A5-1]
CCDS58821.1. [Q9H9A5-3]
CCDS58822.1. [Q9H9A5-6]
RefSeqiNP_001243670.1. NM_001256741.1. [Q9H9A5-3]
NP_001243671.1. NM_001256742.1. [Q9H9A5-6]
NP_056257.1. NM_015442.2. [Q9H9A5-1]
UniGeneiHs.444851.

3D structure databases

ProteinModelPortaliQ9H9A5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117411. 38 interactors.
DIPiDIP-46839N.
IntActiQ9H9A5. 24 interactors.
MINTiMINT-6781568.
STRINGi9606.ENSP00000330060.

PTM databases

iPTMnetiQ9H9A5.
PhosphoSitePlusiQ9H9A5.

Polymorphism and mutation databases

BioMutaiCNOT10.
DMDMi74733982.

Proteomic databases

EPDiQ9H9A5.
MaxQBiQ9H9A5.
PaxDbiQ9H9A5.
PeptideAtlasiQ9H9A5.
PRIDEiQ9H9A5.

Protocols and materials databases

DNASUi25904.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328834; ENSP00000330060; ENSG00000182973. [Q9H9A5-1]
ENST00000331889; ENSP00000329376; ENSG00000182973. [Q9H9A5-3]
ENST00000454516; ENSP00000399862; ENSG00000182973. [Q9H9A5-6]
GeneIDi25904.
KEGGihsa:25904.
UCSCiuc003cfc.2. human. [Q9H9A5-1]

Organism-specific databases

CTDi25904.
GeneCardsiCNOT10.
HGNCiHGNC:23817. CNOT10.
HPAiHPA035614.
HPA041450.
neXtProtiNX_Q9H9A5.
OpenTargetsiENSG00000182973.
PharmGKBiPA134862503.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2471. Eukaryota.
ENOG410XQQJ. LUCA.
GeneTreeiENSGT00390000001827.
HOGENOMiHOG000111843.
HOVERGENiHBG077464.
InParanoidiQ9H9A5.
KOiK12607.
OMAiSDQGAEK.
OrthoDBiEOG091G06Q4.
PhylomeDBiQ9H9A5.
TreeFamiTF323368.

Enzyme and pathway databases

BioCyciZFISH:G66-32087-MONOMER.
ReactomeiR-HSA-429947. Deadenylation of mRNA.
R-HSA-6804115. TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain.

Miscellaneous databases

ChiTaRSiCNOT10. human.
GenomeRNAii25904.
PROiQ9H9A5.

Gene expression databases

BgeeiENSG00000182973.
CleanExiHS_CNOT10.
ExpressionAtlasiQ9H9A5. baseline and differential.
GenevisibleiQ9H9A5. HS.

Family and domain databases

Gene3Di1.25.40.10. 5 hits.
InterProiIPR011990. TPR-like_helical_dom.
IPR019734. TPR_repeat.
[Graphical view]
SMARTiSM00028. TPR. 4 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 8 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiCNO10_HUMAN
AccessioniPrimary (citable) accession number: Q9H9A5
Secondary accession number(s): B7Z7L1
, F8WAF2, Q9BU30, Q9H5J7, Q9H8X1, Q9H9W0, Q9HAH3, Q9UFJ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: March 1, 2001
Last modified: November 30, 2016
This is version 140 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.