Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptopodin 2-like protein

Gene

SYNPO2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Actin-associated protein that may play a role in modulating actin-based shape.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166317-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptopodin 2-like protein
Gene namesi
Name:SYNPO2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23532. SYNPO2L.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000166317.
PharmGKBiPA134889033.

Polymorphism and mutation databases

BioMutaiSYNPO2L.
DMDMi212276492.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001876751 – 977Synaptopodin 2-like proteinAdd BLAST977

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei108PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1
Modified residuei141PhosphothreonineBy similarity1
Modified residuei143PhosphoserineBy similarity1
Modified residuei178PhosphoserineBy similarity1
Modified residuei180PhosphoserineBy similarity1
Modified residuei345PhosphoserineBy similarity1
Modified residuei350PhosphoserineBy similarity1
Modified residuei374PhosphoserineBy similarity1
Modified residuei381PhosphoserineBy similarity1
Modified residuei384PhosphoserineBy similarity1
Modified residuei386Omega-N-methylarginineBy similarity1
Modified residuei466Omega-N-methylarginineBy similarity1
Modified residuei469Omega-N-methylarginineBy similarity1
Modified residuei479Omega-N-methylarginineBy similarity1
Modified residuei670PhosphoserineBy similarity1
Modified residuei678PhosphoserineBy similarity1
Modified residuei705PhosphothreonineBy similarity1
Modified residuei713PhosphothreonineBy similarity1
Modified residuei757Omega-N-methylarginineBy similarity1
Modified residuei788PhosphoserineBy similarity1
Modified residuei790PhosphoserineBy similarity1
Modified residuei792PhosphothreonineBy similarity1
Modified residuei806Omega-N-methylarginineBy similarity1
Modified residuei826Omega-N-methylarginineBy similarity1
Modified residuei889Omega-N-methylarginineBy similarity1
Modified residuei891PhosphoserineBy similarity1
Modified residuei892PhosphothreonineBy similarity1
Modified residuei898PhosphothreonineBy similarity1
Modified residuei910Omega-N-methylarginineBy similarity1
Modified residuei921Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei921Omega-N-methylarginine; alternateBy similarity1
Modified residuei955Omega-N-methylarginineBy similarity1
Modified residuei957Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ9H987.
MaxQBiQ9H987.
PaxDbiQ9H987.
PeptideAtlasiQ9H987.
PRIDEiQ9H987.

PTM databases

iPTMnetiQ9H987.
PhosphoSitePlusiQ9H987.

Expressioni

Gene expression databases

BgeeiENSG00000166317.
CleanExiHS_SYNPO2L.
ExpressionAtlasiQ9H987. baseline and differential.
GenevisibleiQ9H987. HS.

Organism-specific databases

HPAiHPA055192.
HPA057142.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi123008. 1 interactor.
IntActiQ9H987. 6 interactors.
MINTiMINT-7969997.

Structurei

3D structure databases

ProteinModelPortaliQ9H987.
SMRiQ9H987.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini6 – 88PDZPROSITE-ProRule annotationAdd BLAST83

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi92 – 241Pro-richAdd BLAST150
Compositional biasi422 – 939Pro-richAdd BLAST518

Sequence similaritiesi

Belongs to the synaptopodin family.Curated
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IGPE. Eukaryota.
ENOG410ZJ02. LUCA.
GeneTreeiENSGT00530000063754.
HOGENOMiHOG000261625.
HOVERGENiHBG060706.
InParanoidiQ9H987.
OMAiELTHIGP.
OrthoDBiEOG091G012T.
PhylomeDBiQ9H987.
TreeFamiTF330867.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H987-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAEEEVLVT LSGGAPWGFR LHGGAEQRKP LQVSKIRRRS QAGRAGLRER
60 70 80 90 100
DQLLAINGVS CTNLSHASAM SLIDASGNQL VLTVQRLADE GPVQSPSPHE
110 120 130 140 150
LQVLSPLSPL SPEPPGAPVP QPLQPGSLRS PPDSEAYYGE TDSDADGPAT
160 170 180 190 200
QEKPRRPRRR GPTRPTPPGA PPDEVYLSDS PAEPAPTIPG PPSQGDSRVS
210 220 230 240 250
SPSWEDGAAL QPPPAEALLL PHGPLRPGPH LIPMVGPVPH PVAEDLTTTY
260 270 280 290 300
TQKAKQAKLQ RAESLQEKSI KEAKTKCRTI ASLLTAAPNP HSKGVLMFKK
310 320 330 340 350
RRQRAKKYTL VSFGAAAGTG AEEEDGVPPT SESELDEEAF SDARSLTNQS
360 370 380 390 400
DWDSPYLDME LARAGSRASE GQGSGLGGQL SEVSGRGVQL FEQQRQRADS
410 420 430 440 450
STQELARVEP AAMLNGEGLQ SPPRAQSAPP EAAVLPPSPL PAPVASPRPF
460 470 480 490 500
QPGGGAPTPA PSIFNRSARP FTPGLQGQRP TTTSVIFRPL APKRANDSLG
510 520 530 540 550
GLSPAPPPFL SSQGPTPLPS FTSGVPSHAP VSGSPSTPRS SGPVTATSSL
560 570 580 590 600
YIPAPSRPVT PGGAPEPPAP PSAAAMTSTA SIFLSAPLRP SARPEAPAPG
610 620 630 640 650
PGAPEPPSAR EQRISVPAAR TGILQEARRR GTRKQMFRPG KEETKNSPNP
660 670 680 690 700
ELLSLVQNLD EKPRAGGAES GPEEDALSLG AEACNFMQPV GARSYKTLPH
710 720 730 740 750
VTPKTPPPMA PKTPPPMTPK TPPPVAPKPP SRGLLDGLVN GAASSAGIPE
760 770 780 790 800
PPRLQGRGGE LFAKRQSRAD RYVVEGTPGP GLGPRPRSPS PTPSLPPSWK
810 820 830 840 850
YSPNIRAPPP IAYNPLLSPF FPQAARTLPK AQSQGPRATP KQGIKALDFM
860 870 880 890 900
RHQPYQLKTA MFCFDEVPPT PGPIASGSPK TARVQEIRRF STPAPQPTAE
910 920 930 940 950
PLAPTVLAPR AATTLDEPIW RTELASAPVP SPAPPPEAPR GLGASPSSCG
960 970
FQVARPRFSA TRTGLQAHVW RPGAGHQ
Note: No experimental confirmation available.
Length:977
Mass (Da):102,481
Last modified:November 4, 2008 - v3
Checksum:i885B28CEE3C5B3D7
GO
Isoform 2 (identifier: Q9H987-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-224: Missing.
     225-258: LRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAK → METFEPISQEPLSQASYDKAPDPVPELQDSFYAE

Show »
Length:753
Mass (Da):79,146
Checksum:i46F0797C216316B2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti748I → T in BAB14346 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061835508P → H.Corresponds to variant rs57006992dbSNPEnsembl.1
Natural variantiVAR_019671707P → L.Corresponds to variant rs3812629dbSNPEnsembl.1
Natural variantiVAR_047065833S → Y.Corresponds to variant rs34163229dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0114951 – 224Missing in isoform 2. 2 PublicationsAdd BLAST224
Alternative sequenceiVSP_011496225 – 258LRPGP…AKQAK → METFEPISQEPLSQASYDKA PDPVPELQDSFYAE in isoform 2. 2 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB188489 mRNA. Translation: BAD37139.1.
AK022983 mRNA. Translation: BAB14346.1.
AC073389 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54507.1.
BC142635 mRNA. Translation: AAI42636.1.
CCDSiCCDS44438.1. [Q9H987-1]
CCDS7331.1. [Q9H987-2]
RefSeqiNP_001107605.1. NM_001114133.2. [Q9H987-1]
NP_079151.2. NM_024875.4. [Q9H987-2]
UniGeneiHs.645273.

Genome annotation databases

EnsembliENST00000372873; ENSP00000361964; ENSG00000166317. [Q9H987-2]
ENST00000394810; ENSP00000378289; ENSG00000166317. [Q9H987-1]
GeneIDi79933.
KEGGihsa:79933.
UCSCiuc001jus.6. human. [Q9H987-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB188489 mRNA. Translation: BAD37139.1.
AK022983 mRNA. Translation: BAB14346.1.
AC073389 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54507.1.
BC142635 mRNA. Translation: AAI42636.1.
CCDSiCCDS44438.1. [Q9H987-1]
CCDS7331.1. [Q9H987-2]
RefSeqiNP_001107605.1. NM_001114133.2. [Q9H987-1]
NP_079151.2. NM_024875.4. [Q9H987-2]
UniGeneiHs.645273.

3D structure databases

ProteinModelPortaliQ9H987.
SMRiQ9H987.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123008. 1 interactor.
IntActiQ9H987. 6 interactors.
MINTiMINT-7969997.

PTM databases

iPTMnetiQ9H987.
PhosphoSitePlusiQ9H987.

Polymorphism and mutation databases

BioMutaiSYNPO2L.
DMDMi212276492.

Proteomic databases

EPDiQ9H987.
MaxQBiQ9H987.
PaxDbiQ9H987.
PeptideAtlasiQ9H987.
PRIDEiQ9H987.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372873; ENSP00000361964; ENSG00000166317. [Q9H987-2]
ENST00000394810; ENSP00000378289; ENSG00000166317. [Q9H987-1]
GeneIDi79933.
KEGGihsa:79933.
UCSCiuc001jus.6. human. [Q9H987-1]

Organism-specific databases

CTDi79933.
GeneCardsiSYNPO2L.
HGNCiHGNC:23532. SYNPO2L.
HPAiHPA055192.
HPA057142.
neXtProtiNX_Q9H987.
OpenTargetsiENSG00000166317.
PharmGKBiPA134889033.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGPE. Eukaryota.
ENOG410ZJ02. LUCA.
GeneTreeiENSGT00530000063754.
HOGENOMiHOG000261625.
HOVERGENiHBG060706.
InParanoidiQ9H987.
OMAiELTHIGP.
OrthoDBiEOG091G012T.
PhylomeDBiQ9H987.
TreeFamiTF330867.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166317-MONOMER.

Miscellaneous databases

ChiTaRSiSYNPO2L. human.
GenomeRNAii79933.
PROiQ9H987.

Gene expression databases

BgeeiENSG00000166317.
CleanExiHS_SYNPO2L.
ExpressionAtlasiQ9H987. baseline and differential.
GenevisibleiQ9H987. HS.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSYP2L_HUMAN
AccessioniPrimary (citable) accession number: Q9H987
Secondary accession number(s): A5PKV9, Q68A20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: November 4, 2008
Last modified: November 30, 2016
This is version 117 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.