Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptopodin 2-like protein

Gene

SYNPO2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Actin-associated protein that may play a role in modulating actin-based shape.By similarity

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptopodin 2-like protein
Gene namesi
Name:SYNPO2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23532. SYNPO2L.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134889033.

Polymorphism and mutation databases

BioMutaiSYNPO2L.
DMDMi212276492.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 977977Synaptopodin 2-like proteinPRO_0000187675Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei108 – 1081PhosphoserineBy similarity
Modified residuei111 – 1111PhosphoserineBy similarity
Modified residuei141 – 1411PhosphothreonineBy similarity
Modified residuei143 – 1431PhosphoserineBy similarity
Modified residuei178 – 1781PhosphoserineBy similarity
Modified residuei180 – 1801PhosphoserineBy similarity
Modified residuei345 – 3451PhosphoserineBy similarity
Modified residuei350 – 3501PhosphoserineBy similarity
Modified residuei374 – 3741PhosphoserineBy similarity
Modified residuei381 – 3811PhosphoserineBy similarity
Modified residuei384 – 3841PhosphoserineBy similarity
Modified residuei670 – 6701PhosphoserineBy similarity
Modified residuei678 – 6781PhosphoserineBy similarity
Modified residuei705 – 7051PhosphothreonineBy similarity
Modified residuei713 – 7131PhosphothreonineBy similarity
Modified residuei788 – 7881PhosphoserineBy similarity
Modified residuei790 – 7901PhosphoserineBy similarity
Modified residuei792 – 7921PhosphothreonineBy similarity
Modified residuei891 – 8911PhosphoserineBy similarity
Modified residuei892 – 8921PhosphothreonineBy similarity
Modified residuei898 – 8981PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9H987.
MaxQBiQ9H987.
PaxDbiQ9H987.
PRIDEiQ9H987.

PTM databases

iPTMnetiQ9H987.
PhosphoSiteiQ9H987.

Expressioni

Gene expression databases

BgeeiQ9H987.
CleanExiHS_SYNPO2L.
ExpressionAtlasiQ9H987. baseline and differential.
GenevisibleiQ9H987. HS.

Organism-specific databases

HPAiHPA055192.
HPA057142.

Interactioni

Protein-protein interaction databases

BioGridi123008. 1 interaction.
IntActiQ9H987. 1 interaction.
MINTiMINT-7969997.

Structurei

3D structure databases

ProteinModelPortaliQ9H987.
SMRiQ9H987. Positions 9-86.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 8883PDZPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi92 – 241150Pro-richAdd
BLAST
Compositional biasi422 – 939518Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the synaptopodin family.Curated
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IGPE. Eukaryota.
ENOG410ZJ02. LUCA.
GeneTreeiENSGT00530000063754.
HOGENOMiHOG000261625.
HOVERGENiHBG060706.
InParanoidiQ9H987.
OMAiELTHIGP.
OrthoDBiEOG7HXCQ3.
PhylomeDBiQ9H987.
TreeFamiTF330867.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H987-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAEEEVLVT LSGGAPWGFR LHGGAEQRKP LQVSKIRRRS QAGRAGLRER
60 70 80 90 100
DQLLAINGVS CTNLSHASAM SLIDASGNQL VLTVQRLADE GPVQSPSPHE
110 120 130 140 150
LQVLSPLSPL SPEPPGAPVP QPLQPGSLRS PPDSEAYYGE TDSDADGPAT
160 170 180 190 200
QEKPRRPRRR GPTRPTPPGA PPDEVYLSDS PAEPAPTIPG PPSQGDSRVS
210 220 230 240 250
SPSWEDGAAL QPPPAEALLL PHGPLRPGPH LIPMVGPVPH PVAEDLTTTY
260 270 280 290 300
TQKAKQAKLQ RAESLQEKSI KEAKTKCRTI ASLLTAAPNP HSKGVLMFKK
310 320 330 340 350
RRQRAKKYTL VSFGAAAGTG AEEEDGVPPT SESELDEEAF SDARSLTNQS
360 370 380 390 400
DWDSPYLDME LARAGSRASE GQGSGLGGQL SEVSGRGVQL FEQQRQRADS
410 420 430 440 450
STQELARVEP AAMLNGEGLQ SPPRAQSAPP EAAVLPPSPL PAPVASPRPF
460 470 480 490 500
QPGGGAPTPA PSIFNRSARP FTPGLQGQRP TTTSVIFRPL APKRANDSLG
510 520 530 540 550
GLSPAPPPFL SSQGPTPLPS FTSGVPSHAP VSGSPSTPRS SGPVTATSSL
560 570 580 590 600
YIPAPSRPVT PGGAPEPPAP PSAAAMTSTA SIFLSAPLRP SARPEAPAPG
610 620 630 640 650
PGAPEPPSAR EQRISVPAAR TGILQEARRR GTRKQMFRPG KEETKNSPNP
660 670 680 690 700
ELLSLVQNLD EKPRAGGAES GPEEDALSLG AEACNFMQPV GARSYKTLPH
710 720 730 740 750
VTPKTPPPMA PKTPPPMTPK TPPPVAPKPP SRGLLDGLVN GAASSAGIPE
760 770 780 790 800
PPRLQGRGGE LFAKRQSRAD RYVVEGTPGP GLGPRPRSPS PTPSLPPSWK
810 820 830 840 850
YSPNIRAPPP IAYNPLLSPF FPQAARTLPK AQSQGPRATP KQGIKALDFM
860 870 880 890 900
RHQPYQLKTA MFCFDEVPPT PGPIASGSPK TARVQEIRRF STPAPQPTAE
910 920 930 940 950
PLAPTVLAPR AATTLDEPIW RTELASAPVP SPAPPPEAPR GLGASPSSCG
960 970
FQVARPRFSA TRTGLQAHVW RPGAGHQ
Note: No experimental confirmation available.
Length:977
Mass (Da):102,481
Last modified:November 4, 2008 - v3
Checksum:i885B28CEE3C5B3D7
GO
Isoform 2 (identifier: Q9H987-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-224: Missing.
     225-258: LRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAK → METFEPISQEPLSQASYDKAPDPVPELQDSFYAE

Show »
Length:753
Mass (Da):79,146
Checksum:i46F0797C216316B2
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti748 – 7481I → T in BAB14346 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti508 – 5081P → H.
Corresponds to variant rs57006992 [ dbSNP | Ensembl ].
VAR_061835
Natural varianti707 – 7071P → L.
Corresponds to variant rs3812629 [ dbSNP | Ensembl ].
VAR_019671
Natural varianti833 – 8331S → Y.
Corresponds to variant rs34163229 [ dbSNP | Ensembl ].
VAR_047065

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 224224Missing in isoform 2. 2 PublicationsVSP_011495Add
BLAST
Alternative sequencei225 – 25834LRPGP…AKQAK → METFEPISQEPLSQASYDKA PDPVPELQDSFYAE in isoform 2. 2 PublicationsVSP_011496Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB188489 mRNA. Translation: BAD37139.1.
AK022983 mRNA. Translation: BAB14346.1.
AC073389 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54507.1.
BC142635 mRNA. Translation: AAI42636.1.
CCDSiCCDS44438.1. [Q9H987-1]
CCDS7331.1. [Q9H987-2]
RefSeqiNP_001107605.1. NM_001114133.2. [Q9H987-1]
NP_079151.2. NM_024875.4. [Q9H987-2]
UniGeneiHs.645273.

Genome annotation databases

EnsembliENST00000372873; ENSP00000361964; ENSG00000166317. [Q9H987-2]
ENST00000394810; ENSP00000378289; ENSG00000166317. [Q9H987-1]
GeneIDi79933.
KEGGihsa:79933.
UCSCiuc001jus.6. human. [Q9H987-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB188489 mRNA. Translation: BAD37139.1.
AK022983 mRNA. Translation: BAB14346.1.
AC073389 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54507.1.
BC142635 mRNA. Translation: AAI42636.1.
CCDSiCCDS44438.1. [Q9H987-1]
CCDS7331.1. [Q9H987-2]
RefSeqiNP_001107605.1. NM_001114133.2. [Q9H987-1]
NP_079151.2. NM_024875.4. [Q9H987-2]
UniGeneiHs.645273.

3D structure databases

ProteinModelPortaliQ9H987.
SMRiQ9H987. Positions 9-86.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123008. 1 interaction.
IntActiQ9H987. 1 interaction.
MINTiMINT-7969997.

PTM databases

iPTMnetiQ9H987.
PhosphoSiteiQ9H987.

Polymorphism and mutation databases

BioMutaiSYNPO2L.
DMDMi212276492.

Proteomic databases

EPDiQ9H987.
MaxQBiQ9H987.
PaxDbiQ9H987.
PRIDEiQ9H987.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372873; ENSP00000361964; ENSG00000166317. [Q9H987-2]
ENST00000394810; ENSP00000378289; ENSG00000166317. [Q9H987-1]
GeneIDi79933.
KEGGihsa:79933.
UCSCiuc001jus.6. human. [Q9H987-1]

Organism-specific databases

CTDi79933.
GeneCardsiSYNPO2L.
HGNCiHGNC:23532. SYNPO2L.
HPAiHPA055192.
HPA057142.
neXtProtiNX_Q9H987.
PharmGKBiPA134889033.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGPE. Eukaryota.
ENOG410ZJ02. LUCA.
GeneTreeiENSGT00530000063754.
HOGENOMiHOG000261625.
HOVERGENiHBG060706.
InParanoidiQ9H987.
OMAiELTHIGP.
OrthoDBiEOG7HXCQ3.
PhylomeDBiQ9H987.
TreeFamiTF330867.

Miscellaneous databases

ChiTaRSiSYNPO2L. human.
GenomeRNAii79933.
PROiQ9H987.

Gene expression databases

BgeeiQ9H987.
CleanExiHS_SYNPO2L.
ExpressionAtlasiQ9H987. baseline and differential.
GenevisibleiQ9H987. HS.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Homo sapiens cDNA."
    Sugiyama A., Inoue H., Oka M.
    Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiSYP2L_HUMAN
AccessioniPrimary (citable) accession number: Q9H987
Secondary accession number(s): A5PKV9, Q68A20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: November 4, 2008
Last modified: June 8, 2016
This is version 112 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.