Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-related protein 8

Gene

ACTR8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize.
Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA reoplication and probably DNA repair. Required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage. Strongly prefer nucleosomes and H3-H4 tetramers over H2A-H2B dimers, suggesting it may act as a nucleosome recognition module within the complex.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei55 – 551ATP
Binding sitei56 – 561ATP

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi283 – 2864ATP

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, DNA damage, DNA recombination, DNA repair, Mitosis, Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-5696394. DNA Damage Recognition in GG-NER.
SignaLinkiQ9H981.

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-related protein 8
Short name:
hArp8
Alternative name(s):
INO80 complex subunit N
Gene namesi
Name:ACTR8
Synonyms:ARP8, INO80N
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:14672. ACTR8.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: HPA
  • Ino80 complex Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24491.

Polymorphism and mutation databases

BioMutaiACTR8.
DMDMi116241257.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 624624Actin-related protein 8PRO_0000089123Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei132 – 1321PhosphoserineCombined sources
Modified residuei412 – 4121PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9H981.
MaxQBiQ9H981.
PaxDbiQ9H981.
PeptideAtlasiQ9H981.
PRIDEiQ9H981.

PTM databases

iPTMnetiQ9H981.
PhosphoSiteiQ9H981.

Expressioni

Gene expression databases

BgeeiENSG00000113812.
CleanExiHS_ACTR8.
ExpressionAtlasiQ9H981. baseline and differential.
GenevisibleiQ9H981. HS.

Organism-specific databases

HPAiHPA065236.

Interactioni

Subunit structurei

Component of the chromatin remodeling INO80 complex; specifically part of a complex module associated with the DBINO domain of INO80. Interacts with ACTR5; the interaction is observed in asynchronous (interphase) cells but not in metaphase-arrested cells indicative for a possible dissociation of the INO80 complex in mitotic cells. Exists as monomers and dimers, but the dimer is most probably the biologically relevant form required for stable interactions with histones that exploits the twofold symmetry of the nucleosome core.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ACTR5Q9H9F93EBI-769597,EBI-769418
UCHL5Q9Y5K53EBI-769597,EBI-1051183

Protein-protein interaction databases

BioGridi125062. 28 interactions.
IntActiQ9H981. 19 interactions.
STRINGi9606.ENSP00000336842.

Structurei

Secondary structure

1
624
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi37 – 393Combined sources
Turni40 – 423Combined sources
Helixi44 – 463Combined sources
Beta strandi47 – 526Combined sources
Beta strandi55 – 628Combined sources
Beta strandi69 – 724Combined sources
Beta strandi75 – 784Combined sources
Turni95 – 984Combined sources
Helixi102 – 11918Combined sources
Helixi133 – 1408Combined sources
Beta strandi146 – 1516Combined sources
Beta strandi164 – 1674Combined sources
Helixi169 – 1724Combined sources
Beta strandi178 – 1836Combined sources
Beta strandi185 – 1873Combined sources
Helixi201 – 21818Combined sources
Helixi224 – 2296Combined sources
Beta strandi231 – 2366Combined sources
Helixi242 – 25413Combined sources
Beta strandi259 – 2657Combined sources
Helixi266 – 2749Combined sources
Beta strandi277 – 2848Combined sources
Beta strandi289 – 2979Combined sources
Helixi301 – 3033Combined sources
Beta strandi305 – 3084Combined sources
Helixi311 – 32414Combined sources
Helixi337 – 35014Combined sources
Beta strandi361 – 3677Combined sources
Beta strandi374 – 3818Combined sources
Helixi384 – 3907Combined sources
Turni391 – 3933Combined sources
Helixi395 – 3984Combined sources
Beta strandi406 – 4083Combined sources
Helixi503 – 5064Combined sources
Helixi511 – 52010Combined sources
Helixi525 – 5339Combined sources
Beta strandi534 – 5407Combined sources
Helixi547 – 55812Combined sources
Helixi561 – 5666Combined sources
Beta strandi571 – 5755Combined sources
Helixi576 – 5783Combined sources
Turni581 – 5833Combined sources
Helixi584 – 59411Combined sources
Helixi596 – 6005Combined sources
Helixi605 – 6117Combined sources
Helixi614 – 6196Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4FO0X-ray2.60A34-624[»]
ProteinModelPortaliQ9H981.
SMRiQ9H981. Positions 34-410, 424-624.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the actin family. ARP8 subfamily.Curated

Phylogenomic databases

eggNOGiKOG0797. Eukaryota.
COG5277. LUCA.
GeneTreeiENSGT00390000001763.
HOGENOMiHOG000034073.
HOVERGENiHBG023939.
InParanoidiQ9H981.
KOiK11673.
OMAiSIDCCAS.
OrthoDBiEOG091G03ZH.
PhylomeDBiQ9H981.
TreeFamiTF324575.

Family and domain databases

InterProiIPR004000. Actin.
IPR027668. Arp8/plant_Arp9.
[Graphical view]
PANTHERiPTHR11937. PTHR11937. 3 hits.
PTHR11937:SF13. PTHR11937:SF13. 3 hits.
PfamiPF00022. Actin. 2 hits.
[Graphical view]
SMARTiSM00268. ACTIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H981-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTQAEKGDTE NGKEKGGEKE KEQRGVKRPI VPALVPESLQ EQIQSNFIIV
60 70 80 90 100
IHPGSTTLRI GRATDTLPAS IPHVIARRHK QQGQPLYKDS WLLREGLNKP
110 120 130 140 150
ESNEQRQNGL KMVDQAIWSK KMSNGTRRIP VSPEQARSYN KQMRPAILDH
160 170 180 190 200
CSGNKWTNTS HHPEYLVGEE ALYVNPLDCY NIHWPIRRGQ LNIHPGPGGS
210 220 230 240 250
LTAVLADIEV IWSHAIQKYL EIPLKDLKYY RCILLIPDIY NKQHVKELVN
260 270 280 290 300
MILMKMGFSG IVVHQESVCA TYGSGLSSTC IVDVGDQKTS VCCVEDGVSH
310 320 330 340 350
RNTRLCLAYG GSDVSRCFYW LMQRAGFPYR ECQLTNKMDC LLLQHLKETF
360 370 380 390 400
CHLDQDISGL QDHEFQIRHP DSPALLYQFR LGDEKLQAPM ALFYPATFGI
410 420 430 440 450
VGQKMTTLQH RSQGDPEDPH DEHYLLATQS KQEQSAKATA DRKSASKPIG
460 470 480 490 500
FEGDLRGQSS DLPERLHSQE VDLGSAQGDG LMAGNDSEEA LTALMSRKTA
510 520 530 540 550
ISLFEGKALG LDKAILHSID CCSSDDTKKK MYSSILVVGG GLMFHKAQEF
560 570 580 590 600
LQHRILNKMP PSFRRIIENV DVITRPKDMD PRLIAWKGGA VLACLDTTQE
610 620
LWIYQREWQR FGVRMLRERA AFVW
Length:624
Mass (Da):70,484
Last modified:October 17, 2006 - v2
Checksum:iDA71C49B9D2C4E19
GO
Isoform 2 (identifier: Q9H981-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-111: Missing.

Note: No experimental confirmation available.
Show »
Length:513
Mass (Da):58,045
Checksum:i601862886A522A00
GO
Isoform 3 (identifier: Q9H981-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     305-354: LCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLD → IFSWN

Note: No experimental confirmation available.
Show »
Length:329
Mass (Da):36,737
Checksum:i5A83E55423F44021
GO

Sequence cautioni

The sequence BAB15402 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti596 – 5961D → G in BAB14352 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti56 – 561T → I.
Corresponds to variant rs3733082 [ dbSNP | Ensembl ].
VAR_028033

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 250250Missing in isoform 3. 1 PublicationVSP_040506Add
BLAST
Alternative sequencei1 – 111111Missing in isoform 2. 1 PublicationVSP_040507Add
BLAST
Alternative sequencei305 – 35450LCLAY…FCHLD → IFSWN in isoform 3. 1 PublicationVSP_040508Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022996 mRNA. Translation: BAB14352.1.
AK094507 mRNA. Translation: BAG52879.1.
AK026232 mRNA. Translation: BAB15402.1. Different initiation.
AC012467 Genomic DNA. No translation available.
BC032744 mRNA. Translation: AAH32744.1.
CCDSiCCDS2875.1. [Q9H981-1]
RefSeqiNP_075050.3. NM_022899.4. [Q9H981-1]
XP_005265644.1. XM_005265587.4. [Q9H981-1]
XP_011532551.1. XM_011534249.2. [Q9H981-2]
UniGeneiHs.412186.

Genome annotation databases

EnsembliENST00000335754; ENSP00000336842; ENSG00000113812. [Q9H981-1]
ENST00000482349; ENSP00000419429; ENSG00000113812. [Q9H981-2]
GeneIDi93973.
KEGGihsa:93973.
UCSCiuc003dhc.5. human. [Q9H981-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022996 mRNA. Translation: BAB14352.1.
AK094507 mRNA. Translation: BAG52879.1.
AK026232 mRNA. Translation: BAB15402.1. Different initiation.
AC012467 Genomic DNA. No translation available.
BC032744 mRNA. Translation: AAH32744.1.
CCDSiCCDS2875.1. [Q9H981-1]
RefSeqiNP_075050.3. NM_022899.4. [Q9H981-1]
XP_005265644.1. XM_005265587.4. [Q9H981-1]
XP_011532551.1. XM_011534249.2. [Q9H981-2]
UniGeneiHs.412186.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4FO0X-ray2.60A34-624[»]
ProteinModelPortaliQ9H981.
SMRiQ9H981. Positions 34-410, 424-624.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125062. 28 interactions.
IntActiQ9H981. 19 interactions.
STRINGi9606.ENSP00000336842.

PTM databases

iPTMnetiQ9H981.
PhosphoSiteiQ9H981.

Polymorphism and mutation databases

BioMutaiACTR8.
DMDMi116241257.

Proteomic databases

EPDiQ9H981.
MaxQBiQ9H981.
PaxDbiQ9H981.
PeptideAtlasiQ9H981.
PRIDEiQ9H981.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335754; ENSP00000336842; ENSG00000113812. [Q9H981-1]
ENST00000482349; ENSP00000419429; ENSG00000113812. [Q9H981-2]
GeneIDi93973.
KEGGihsa:93973.
UCSCiuc003dhc.5. human. [Q9H981-1]

Organism-specific databases

CTDi93973.
GeneCardsiACTR8.
H-InvDBHIX0003379.
HGNCiHGNC:14672. ACTR8.
HPAiHPA065236.
neXtProtiNX_Q9H981.
PharmGKBiPA24491.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0797. Eukaryota.
COG5277. LUCA.
GeneTreeiENSGT00390000001763.
HOGENOMiHOG000034073.
HOVERGENiHBG023939.
InParanoidiQ9H981.
KOiK11673.
OMAiSIDCCAS.
OrthoDBiEOG091G03ZH.
PhylomeDBiQ9H981.
TreeFamiTF324575.

Enzyme and pathway databases

ReactomeiR-HSA-5696394. DNA Damage Recognition in GG-NER.
SignaLinkiQ9H981.

Miscellaneous databases

ChiTaRSiACTR8. human.
GenomeRNAii93973.
PROiQ9H981.

Gene expression databases

BgeeiENSG00000113812.
CleanExiHS_ACTR8.
ExpressionAtlasiQ9H981. baseline and differential.
GenevisibleiQ9H981. HS.

Family and domain databases

InterProiIPR004000. Actin.
IPR027668. Arp8/plant_Arp9.
[Graphical view]
PANTHERiPTHR11937. PTHR11937. 3 hits.
PTHR11937:SF13. PTHR11937:SF13. 3 hits.
PfamiPF00022. Actin. 2 hits.
[Graphical view]
SMARTiSM00268. ACTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARP8_HUMAN
AccessioniPrimary (citable) accession number: Q9H981
Secondary accession number(s): B3KSW7, Q8N566, Q9H663
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 27, 2003
Last sequence update: October 17, 2006
Last modified: September 7, 2016
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.