Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-related protein 8

Gene

ACTR8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize.
Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA reoplication and probably DNA repair. Required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage. Strongly prefer nucleosomes and H3-H4 tetramers over H2A-H2B dimers, suggesting it may act as a nucleosome recognition module within the complex.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei55ATP1
Binding sitei56ATP1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi283 – 286ATP4

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, DNA damage, DNA recombination, DNA repair, Mitosis, Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000113812-MONOMER.
ReactomeiR-HSA-5689603. UCH proteinases.
R-HSA-5696394. DNA Damage Recognition in GG-NER.
SignaLinkiQ9H981.

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-related protein 8
Short name:
hArp8
Alternative name(s):
INO80 complex subunit N
Gene namesi
Name:ACTR8
Synonyms:ARP8, INO80N
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:14672. ACTR8.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: HPA
  • Ino80 complex Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000113812.
PharmGKBiPA24491.

Polymorphism and mutation databases

BioMutaiACTR8.
DMDMi116241257.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000891231 – 624Actin-related protein 8Add BLAST624

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei132PhosphoserineCombined sources1
Modified residuei412PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9H981.
MaxQBiQ9H981.
PaxDbiQ9H981.
PeptideAtlasiQ9H981.
PRIDEiQ9H981.

PTM databases

iPTMnetiQ9H981.
PhosphoSitePlusiQ9H981.

Expressioni

Gene expression databases

BgeeiENSG00000113812.
CleanExiHS_ACTR8.
ExpressionAtlasiQ9H981. baseline and differential.
GenevisibleiQ9H981. HS.

Organism-specific databases

HPAiHPA065236.

Interactioni

Subunit structurei

Component of the chromatin remodeling INO80 complex; specifically part of a complex module associated with the DBINO domain of INO80. Interacts with ACTR5; the interaction is observed in asynchronous (interphase) cells but not in metaphase-arrested cells indicative for a possible dissociation of the INO80 complex in mitotic cells. Exists as monomers and dimers, but the dimer is most probably the biologically relevant form required for stable interactions with histones that exploits the twofold symmetry of the nucleosome core.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ACTR5Q9H9F93EBI-769597,EBI-769418
UCHL5Q9Y5K53EBI-769597,EBI-1051183

Protein-protein interaction databases

BioGridi125062. 28 interactors.
IntActiQ9H981. 19 interactors.
STRINGi9606.ENSP00000336842.

Structurei

Secondary structure

1624
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi37 – 39Combined sources3
Turni40 – 42Combined sources3
Helixi44 – 46Combined sources3
Beta strandi47 – 52Combined sources6
Beta strandi55 – 62Combined sources8
Beta strandi69 – 72Combined sources4
Beta strandi75 – 78Combined sources4
Turni95 – 98Combined sources4
Helixi102 – 119Combined sources18
Helixi133 – 140Combined sources8
Beta strandi146 – 151Combined sources6
Beta strandi164 – 167Combined sources4
Helixi169 – 172Combined sources4
Beta strandi178 – 183Combined sources6
Beta strandi185 – 187Combined sources3
Helixi201 – 218Combined sources18
Helixi224 – 229Combined sources6
Beta strandi231 – 236Combined sources6
Helixi242 – 254Combined sources13
Beta strandi259 – 265Combined sources7
Helixi266 – 274Combined sources9
Beta strandi277 – 284Combined sources8
Beta strandi289 – 297Combined sources9
Helixi301 – 303Combined sources3
Beta strandi305 – 308Combined sources4
Helixi311 – 324Combined sources14
Helixi337 – 350Combined sources14
Beta strandi361 – 367Combined sources7
Beta strandi374 – 381Combined sources8
Helixi384 – 390Combined sources7
Turni391 – 393Combined sources3
Helixi395 – 398Combined sources4
Beta strandi406 – 408Combined sources3
Helixi503 – 506Combined sources4
Helixi511 – 520Combined sources10
Helixi525 – 533Combined sources9
Beta strandi534 – 540Combined sources7
Helixi547 – 558Combined sources12
Helixi561 – 566Combined sources6
Beta strandi571 – 575Combined sources5
Helixi576 – 578Combined sources3
Turni581 – 583Combined sources3
Helixi584 – 594Combined sources11
Helixi596 – 600Combined sources5
Helixi605 – 611Combined sources7
Helixi614 – 619Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4FO0X-ray2.60A34-624[»]
ProteinModelPortaliQ9H981.
SMRiQ9H981.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the actin family. ARP8 subfamily.Curated

Phylogenomic databases

eggNOGiKOG0797. Eukaryota.
COG5277. LUCA.
GeneTreeiENSGT00390000001763.
HOGENOMiHOG000034073.
HOVERGENiHBG023939.
InParanoidiQ9H981.
KOiK11673.
OMAiSIDCCAS.
OrthoDBiEOG091G03ZH.
PhylomeDBiQ9H981.
TreeFamiTF324575.

Family and domain databases

InterProiIPR004000. Actin.
IPR027668. Arp8/plant_Arp9.
[Graphical view]
PANTHERiPTHR11937. PTHR11937. 3 hits.
PTHR11937:SF13. PTHR11937:SF13. 3 hits.
PfamiPF00022. Actin. 2 hits.
[Graphical view]
SMARTiSM00268. ACTIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H981-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTQAEKGDTE NGKEKGGEKE KEQRGVKRPI VPALVPESLQ EQIQSNFIIV
60 70 80 90 100
IHPGSTTLRI GRATDTLPAS IPHVIARRHK QQGQPLYKDS WLLREGLNKP
110 120 130 140 150
ESNEQRQNGL KMVDQAIWSK KMSNGTRRIP VSPEQARSYN KQMRPAILDH
160 170 180 190 200
CSGNKWTNTS HHPEYLVGEE ALYVNPLDCY NIHWPIRRGQ LNIHPGPGGS
210 220 230 240 250
LTAVLADIEV IWSHAIQKYL EIPLKDLKYY RCILLIPDIY NKQHVKELVN
260 270 280 290 300
MILMKMGFSG IVVHQESVCA TYGSGLSSTC IVDVGDQKTS VCCVEDGVSH
310 320 330 340 350
RNTRLCLAYG GSDVSRCFYW LMQRAGFPYR ECQLTNKMDC LLLQHLKETF
360 370 380 390 400
CHLDQDISGL QDHEFQIRHP DSPALLYQFR LGDEKLQAPM ALFYPATFGI
410 420 430 440 450
VGQKMTTLQH RSQGDPEDPH DEHYLLATQS KQEQSAKATA DRKSASKPIG
460 470 480 490 500
FEGDLRGQSS DLPERLHSQE VDLGSAQGDG LMAGNDSEEA LTALMSRKTA
510 520 530 540 550
ISLFEGKALG LDKAILHSID CCSSDDTKKK MYSSILVVGG GLMFHKAQEF
560 570 580 590 600
LQHRILNKMP PSFRRIIENV DVITRPKDMD PRLIAWKGGA VLACLDTTQE
610 620
LWIYQREWQR FGVRMLRERA AFVW
Length:624
Mass (Da):70,484
Last modified:October 17, 2006 - v2
Checksum:iDA71C49B9D2C4E19
GO
Isoform 2 (identifier: Q9H981-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-111: Missing.

Note: No experimental confirmation available.
Show »
Length:513
Mass (Da):58,045
Checksum:i601862886A522A00
GO
Isoform 3 (identifier: Q9H981-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     305-354: LCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLD → IFSWN

Note: No experimental confirmation available.
Show »
Length:329
Mass (Da):36,737
Checksum:i5A83E55423F44021
GO

Sequence cautioni

The sequence BAB15402 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti596D → G in BAB14352 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02803356T → I.Corresponds to variant rs3733082dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0405061 – 250Missing in isoform 3. 1 PublicationAdd BLAST250
Alternative sequenceiVSP_0405071 – 111Missing in isoform 2. 1 PublicationAdd BLAST111
Alternative sequenceiVSP_040508305 – 354LCLAY…FCHLD → IFSWN in isoform 3. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022996 mRNA. Translation: BAB14352.1.
AK094507 mRNA. Translation: BAG52879.1.
AK026232 mRNA. Translation: BAB15402.1. Different initiation.
AC012467 Genomic DNA. No translation available.
BC032744 mRNA. Translation: AAH32744.1.
CCDSiCCDS2875.1. [Q9H981-1]
RefSeqiNP_075050.3. NM_022899.4. [Q9H981-1]
XP_005265644.1. XM_005265587.4. [Q9H981-1]
XP_011532551.1. XM_011534249.2. [Q9H981-2]
UniGeneiHs.412186.

Genome annotation databases

EnsembliENST00000335754; ENSP00000336842; ENSG00000113812. [Q9H981-1]
ENST00000482349; ENSP00000419429; ENSG00000113812. [Q9H981-2]
GeneIDi93973.
KEGGihsa:93973.
UCSCiuc003dhc.5. human. [Q9H981-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022996 mRNA. Translation: BAB14352.1.
AK094507 mRNA. Translation: BAG52879.1.
AK026232 mRNA. Translation: BAB15402.1. Different initiation.
AC012467 Genomic DNA. No translation available.
BC032744 mRNA. Translation: AAH32744.1.
CCDSiCCDS2875.1. [Q9H981-1]
RefSeqiNP_075050.3. NM_022899.4. [Q9H981-1]
XP_005265644.1. XM_005265587.4. [Q9H981-1]
XP_011532551.1. XM_011534249.2. [Q9H981-2]
UniGeneiHs.412186.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4FO0X-ray2.60A34-624[»]
ProteinModelPortaliQ9H981.
SMRiQ9H981.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125062. 28 interactors.
IntActiQ9H981. 19 interactors.
STRINGi9606.ENSP00000336842.

PTM databases

iPTMnetiQ9H981.
PhosphoSitePlusiQ9H981.

Polymorphism and mutation databases

BioMutaiACTR8.
DMDMi116241257.

Proteomic databases

EPDiQ9H981.
MaxQBiQ9H981.
PaxDbiQ9H981.
PeptideAtlasiQ9H981.
PRIDEiQ9H981.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335754; ENSP00000336842; ENSG00000113812. [Q9H981-1]
ENST00000482349; ENSP00000419429; ENSG00000113812. [Q9H981-2]
GeneIDi93973.
KEGGihsa:93973.
UCSCiuc003dhc.5. human. [Q9H981-1]

Organism-specific databases

CTDi93973.
GeneCardsiACTR8.
H-InvDBHIX0003379.
HGNCiHGNC:14672. ACTR8.
HPAiHPA065236.
neXtProtiNX_Q9H981.
OpenTargetsiENSG00000113812.
PharmGKBiPA24491.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0797. Eukaryota.
COG5277. LUCA.
GeneTreeiENSGT00390000001763.
HOGENOMiHOG000034073.
HOVERGENiHBG023939.
InParanoidiQ9H981.
KOiK11673.
OMAiSIDCCAS.
OrthoDBiEOG091G03ZH.
PhylomeDBiQ9H981.
TreeFamiTF324575.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000113812-MONOMER.
ReactomeiR-HSA-5689603. UCH proteinases.
R-HSA-5696394. DNA Damage Recognition in GG-NER.
SignaLinkiQ9H981.

Miscellaneous databases

ChiTaRSiACTR8. human.
GenomeRNAii93973.
PROiQ9H981.

Gene expression databases

BgeeiENSG00000113812.
CleanExiHS_ACTR8.
ExpressionAtlasiQ9H981. baseline and differential.
GenevisibleiQ9H981. HS.

Family and domain databases

InterProiIPR004000. Actin.
IPR027668. Arp8/plant_Arp9.
[Graphical view]
PANTHERiPTHR11937. PTHR11937. 3 hits.
PTHR11937:SF13. PTHR11937:SF13. 3 hits.
PfamiPF00022. Actin. 2 hits.
[Graphical view]
SMARTiSM00268. ACTIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARP8_HUMAN
AccessioniPrimary (citable) accession number: Q9H981
Secondary accession number(s): B3KSW7, Q8N566, Q9H663
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 27, 2003
Last sequence update: October 17, 2006
Last modified: November 2, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.