Q9H981 (ARP8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Actin-related protein 8 Short name=hArp8 Alternative name(s): INO80 complex subunit N | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 624 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays an important role in the functional organization of mitotic chromosomes. Ref.7 Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA reoplication and probably DNA repair. Required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage. Ref.7 |
| Subunit structure | Component of the chromatin remodeling INO80 complex; specifically part of a complex module associated with the DBINO domain of INO80. Interacts with ACTR5; the interaction is observed in asynchronous (interphase) cells but not in metaphase-arrested cells indicative for a possible dissociation of the INO80 complex in mitotic cells. Ref.7 |
| Subcellular location | Nucleus. Chromosome. Note: Specifically localizes to mitotic chromosomes. Ref.7 |
| Sequence similarities | Belongs to the actin family. ARP8 subfamily. |
| Sequence caution | The sequence BAB15402.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle Cell division DNA damage DNA recombination DNA repair Mitosis Transcription Transcription regulation |
| Cellular component | Chromosome Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | DNA recombination Inferred from electronic annotation. Source: UniProtKB-KW DNA repairInferred from electronic annotation. Source: UniProtKB-KW cell divisionInferred from electronic annotation. Source: UniProtKB-KW mitosisInferred from electronic annotation. Source: UniProtKB-KW regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | Ino80 complex Inferred from direct assay Ref.10. Source: UniProtKB |
| Molecular function | protein binding Inferred from physical interaction Ref.7Ref.8. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ACTR5 | Q9H9F9 | 2 | EBI-769597,EBI-769418 | |
| UCHL5 | Q9Y5K5 | 3 | EBI-769597,EBI-1051183 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H981-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H981-2) The sequence of this isoform differs from the canonical sequence as follows: 1-111: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9H981-3) The sequence of this isoform differs from the canonical sequence as follows: 1-250: Missing. 305-354: LCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLD → IFSWN | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 624 | 624 | Actin-related protein 8 | PRO_0000089123 | |||||
Amino acid modifications | |||||||||
| Modified residue | 132 | 1 | Phosphoserine Ref.5 Ref.6 | ||||||
| Modified residue | 412 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 250 | 250 | Missing in isoform 3. | VSP_040506 | |||||
| Alternative sequence | 1 – 111 | 111 | Missing in isoform 2. | VSP_040507 | |||||
| Alternative sequence | 305 – 354 | 50 | LCLAY…FCHLD → IFSWN in isoform 3. | VSP_040508 | |||||
| Natural variant | 56 | 1 | T → I. Corresponds to variant rs3733082 [ dbSNP | Ensembl ]. | VAR_028033 | |||||
Experimental info | |||||||||
| Sequence conflict | 596 | 1 | D → G in BAB14352. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain cortex and Small intestine. |
| [2] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [4] | "A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex." Jin J., Cai Y., Yao T., Gottschalk A.J., Florens L., Swanson S.K., Gutierrez J.L., Coleman M.K., Workman J.L., Mushegian A., Washburn M.P., Conaway R.C., Conaway J.W. J. Biol. Chem. 280:41207-41212(2005) [PubMed: 16230350] [Abstract] Cited for: IDENTIFICATION IN INO80 COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY. |
| [5] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "The actin-related protein hArp8 accumulates on the mitotic chromosomes and functions in chromosome alignment." Aoyama N., Oka A., Kitayama K., Kurumizaka H., Harata M. Exp. Cell Res. 314:859-868(2008) [PubMed: 18163988] [Abstract] Cited for: FUNCTION IN MITOSIS, INTERACTION WITH ACTR5, SUBCELLULAR LOCATION. |
| [8] | "Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex." Yao T., Song L., Jin J., Cai Y., Takahashi H., Swanson S.K., Washburn M.P., Florens L., Conaway R.C., Cohen R.E., Conaway J.W. Mol. Cell 31:909-917(2008) [PubMed: 18922472] [Abstract] Cited for: IDENTIFICATION IN THE INO80 COMPLEX, MASS SPECTROMETRY. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-412, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Subunit organization of the human INO80 chromatin remodeling complex: An evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling." Chen L., Cai Y., Jin J., Florens L., Swanson S.K., Washburn M.P., Conaway J.W., Conaway R.C. J. Biol. Chem. 286:11283-11289(2011) [PubMed: 21303910] [Abstract] Cited for: IDENTIFICATION IN THE INO80 COMPLEX. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK022996 mRNA. Translation: BAB14352.1. AK094507 mRNA. Translation: BAG52879.1. AK026232 mRNA. Translation: BAB15402.1. Different initiation. AC012467 Genomic DNA. No translation available. BC032744 mRNA. Translation: AAH32744.1. |
| IPI | IPI00025646. IPI00166798. IPI00794608. |
| RefSeq | NP_075050.3. NM_022899.4. |
| UniGene | Hs.412186. |
3D structure databases | |
| ProteinModelPortal | Q9H981. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H981. 14 interactions. |
| STRING | Q9H981. |
PTM databases | |
| PhosphoSite | Q9H981. |
Polymorphism databases | |
| DMDM | 116241257. |
Proteomic databases | |
| PRIDE | Q9H981. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000335754; ENSP00000336842; ENSG00000113812. |
| GeneID | 93973. |
| KEGG | hsa:93973. |
| UCSC | uc003dhc.1. human. |
Organism-specific databases | |
| CTD | 93973. |
| GeneCards | GC03M053877. |
| H-InvDB | HIX0003379. |
| HGNC | HGNC:14672. ACTR8. |
| neXtProt | NX_Q9H981. |
| PharmGKB | PA24491. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000001763. |
| HOGENOM | HBG315884. |
| HOVERGEN | HBG023939. |
| InParanoid | Q9H981. |
| OMA | PKDMDPR. |
| OrthoDB | EOG4SXNC6. |
| PhylomeDB | Q9H981. |
Gene expression databases | |
| ArrayExpress | Q9H981. |
| Bgee | Q9H981. |
| CleanEx | HS_ACTR8. |
| Genevestigator | Q9H981. |
| GermOnline | ENSG00000113812. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004000. Actin-like. [Graphical view] |
| KO | K11673. |
| PANTHER | PTHR11937. Actin_like. 1 hit. |
| Pfam | PF00022. Actin. 1 hit. [Graphical view] |
| SMART | SM00268. ACTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 78228. |
Entry information
| Entry name | ARP8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H981 Secondary accession number(s): B3KSW7, Q8N566, Q9H663 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with