Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C10orf68

Gene

C10orf68

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C10orf68
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:25779. C10orf68.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134955273.

Polymorphism and mutation databases

BioMutaiC10orf68.
DMDMi317373344.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 628628Uncharacterized protein C10orf68PRO_0000089801Add
BLAST

Proteomic databases

EPDiQ9H943.
PaxDbiQ9H943.
PRIDEiQ9H943.

PTM databases

PhosphoSiteiQ9H943.

Expressioni

Gene expression databases

BgeeiQ9H943.
ExpressionAtlasiQ9H943. baseline and differential.
GenevisibleiQ9H943. HS.

Organism-specific databases

HPAiHPA039300.

Interactioni

Protein-protein interaction databases

BioGridi122854. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9H943.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J0QB. Eukaryota.
ENOG41117EC. LUCA.
GeneTreeiENSGT00390000004865.
HOGENOMiHOG000230915.
HOVERGENiHBG079994.
InParanoidiQ9H943.
OrthoDBiEOG7CNZFB.
PhylomeDBiQ9H943.
TreeFamiTF351892.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H943-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTEEQTYQAA EKSQAHNEVP NERLVVEHQE SLSKTKLQIK KQETSTEQPL
60 70 80 90 100
TTPDKEPNEN LILRHQDSMS KSEMQVKEQR TLKGQRIITH DEEPGKNLVL
110 120 130 140 150
EHQDSVSKLE MQIEKTKKLP REKRHSTHDE ESGENPMLKH QDSVSKIQVQ
160 170 180 190 200
LEIQETSEGE GRSIPDKNSM FVHQDSVSKL QMQEKKKITP GRERRNTRIV
210 220 230 240 250
VPNENVISVH QDSKSKLQMQ EKKQINSGVE RHKTFPLEIK KKDISLEHLL
260 270 280 290 300
PEEKVLLSRS ESQTKKLQAK VTSRKKTDIE SLRGALGRRL LNDEFKTQSK
310 320 330 340 350
SFPGPDIEQL TDAFGRDILK DEFKTRSKSL PETDERLHST TERGTINDAI
360 370 380 390 400
KTQLKRKSYP ETVLKHLKGV NGKDIIKHLI NIQSKSHGET DKNFFAYATG
410 420 430 440 450
RGLMKESTTT QLKSHPETDK EFLADAIGRG IIIGPITTQL KSHRETDKEL
460 470 480 490 500
LKDAIGRDII KGPISAQLKS HQETDVEPLT NAIGSSKTIG EIKTQLRTHY
510 520 530 540 550
DVNLFKNKDM SVQRQEGIFT RSITPSKFPT KVINLSPFEN KEETYEYSSP
560 570 580 590 600
YVTAPSKAIY RTYRAGPSFS KDIHLPLLNQ LPSGHSKVVT LSQKTIEFTL
610 620
PTVTNTVGKP TYKVLHAAAR KSVPHPYF
Note: No experimental confirmation available.
Length:628
Mass (Da):71,535
Last modified:January 11, 2011 - v2
Checksum:i7A9AB1E1B308F06E
GO
Isoform 2 (identifier: Q9H943-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     276-276: K → IKNEAASELPDTAENLPAMYPSISDLIIQFDLNKVVE
     392-392: K → KEHLADDTGRGIIKGSINAQLKGHQKTDK

Note: No experimental confirmation available.
Show »
Length:692
Mass (Da):78,492
Checksum:iE1F7B7DF525DDDA4
GO
Isoform 3 (identifier: Q9H943-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MTEEQTYQAAEKSQ → MVPASASGEGLRELLLVQEGEVGADMSH
     94-131: Missing.
     392-392: K → KEHLADDTGRGIIKGSINAQLKGHQKTDK

Note: No experimental confirmation available.
Show »
Length:632
Mass (Da):71,310
Checksum:i44848EBD78D7C34B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti39 – 391I → V in BAB14400 (PubMed:14702039).Curated
Sequence conflicti39 – 391I → V in AAI25092 (PubMed:15489334).Curated
Sequence conflicti100 – 1001L → P in BAB14400 (PubMed:14702039).Curated
Sequence conflicti205 – 2051N → S in BAB14400 (PubMed:14702039).Curated
Sequence conflicti326 – 3261R → Q in BAC05140 (PubMed:14702039).Curated
Sequence conflicti530 – 5301T → A in BAC05140 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti388 – 3881G → A.2 Publications
Corresponds to variant rs4448627 [ dbSNP | Ensembl ].
VAR_033692
Natural varianti510 – 5101M → T.
Corresponds to variant rs2504011 [ dbSNP | Ensembl ].
VAR_024308
Natural varianti607 – 6071V → I.2 Publications
Corresponds to variant rs1418538 [ dbSNP | Ensembl ].
VAR_033693

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1414MTEEQ…AEKSQ → MVPASASGEGLRELLLVQEG EVGADMSH in isoform 3. 1 PublicationVSP_040359Add
BLAST
Alternative sequencei94 – 13138Missing in isoform 3. 1 PublicationVSP_040360Add
BLAST
Alternative sequencei276 – 2761K → IKNEAASELPDTAENLPAMY PSISDLIIQFDLNKVVE in isoform 2. 1 PublicationVSP_014599
Alternative sequencei392 – 3921K → KEHLADDTGRGIIKGSINAQ LKGHQKTDK in isoform 2 and isoform 3. 2 PublicationsVSP_014600

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023093 mRNA. Translation: BAB14400.1.
AK097668 mRNA. Translation: BAC05140.1.
AL356053
, AL354750, AL365203, AL591850 Genomic DNA. Translation: CAQ06687.1.
AL354750
, AL356053, AL365203, AL591850 Genomic DNA. Translation: CAQ06850.1.
AL365203
, AL354750, AL356053, AL591850 Genomic DNA. Translation: CAQ08110.1.
AL591850
, AL354750, AL356053, AL365203 Genomic DNA. Translation: CAQ09810.1.
BC125091 mRNA. Translation: AAI25092.1.
RefSeqiNP_078964.2. NM_024688.2. [Q9H943-1]
XP_005252650.1. XM_005252593.2. [Q9H943-2]
UniGeneiHs.585464.

Genome annotation databases

GeneIDi79741.
UCSCiuc001iwn.5. human. [Q9H943-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023093 mRNA. Translation: BAB14400.1.
AK097668 mRNA. Translation: BAC05140.1.
AL356053
, AL354750, AL365203, AL591850 Genomic DNA. Translation: CAQ06687.1.
AL354750
, AL356053, AL365203, AL591850 Genomic DNA. Translation: CAQ06850.1.
AL365203
, AL354750, AL356053, AL591850 Genomic DNA. Translation: CAQ08110.1.
AL591850
, AL354750, AL356053, AL365203 Genomic DNA. Translation: CAQ09810.1.
BC125091 mRNA. Translation: AAI25092.1.
RefSeqiNP_078964.2. NM_024688.2. [Q9H943-1]
XP_005252650.1. XM_005252593.2. [Q9H943-2]
UniGeneiHs.585464.

3D structure databases

ProteinModelPortaliQ9H943.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122854. 4 interactions.

PTM databases

PhosphoSiteiQ9H943.

Polymorphism and mutation databases

BioMutaiC10orf68.
DMDMi317373344.

Proteomic databases

EPDiQ9H943.
PaxDbiQ9H943.
PRIDEiQ9H943.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi79741.
UCSCiuc001iwn.5. human. [Q9H943-1]

Organism-specific databases

CTDi79741.
HGNCiHGNC:25779. C10orf68.
HPAiHPA039300.
neXtProtiNX_Q9H943.
PharmGKBiPA134955273.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J0QB. Eukaryota.
ENOG41117EC. LUCA.
GeneTreeiENSGT00390000004865.
HOGENOMiHOG000230915.
HOVERGENiHBG079994.
InParanoidiQ9H943.
OrthoDBiEOG7CNZFB.
PhylomeDBiQ9H943.
TreeFamiTF351892.

Miscellaneous databases

ChiTaRSiC10orf68. human.
GenomeRNAii79741.
NextBioi69145.
PROiQ9H943.

Gene expression databases

BgeeiQ9H943.
ExpressionAtlasiQ9H943. baseline and differential.
GenevisibleiQ9H943. HS.

Family and domain databases

ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-628 (ISOFORM 2), VARIANTS ALA-388 AND ILE-607.
    Tissue: Teratocarcinoma and Testis.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANTS ALA-388 AND ILE-607.

Entry informationi

Entry nameiCJ068_HUMAN
AccessioniPrimary (citable) accession number: Q9H943
Secondary accession number(s): B0QZ71, Q08AN7, Q8N7T7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: January 11, 2011
Last modified: May 11, 2016
This is version 78 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.