Q9H943 (CJ068_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 49.
History...
Names·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein C10orf68 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 628 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H943-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q9H943-2) The sequence of this isoform differs from the canonical sequence as follows: 276-276: K → IKNEAASELPDTAENLPAMYPSISDLIIQFDLNKVVE 392-392: K → KEHLADDTGRGIIKGSINAQLKGHQKTDK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9H943-3) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MTEEQTYQAAEKSQ → MVPASASGEGLRELLLVQEGEVGADMSH 94-131: Missing. 392-392: K → KEHLADDTGRGIIKGSINAQLKGHQKTDK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 628 | 628 | Uncharacterized protein C10orf68 | PRO_0000089801 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 14 | 14 | MTEEQ…AEKSQ → MVPASASGEGLRELLLVQEG EVGADMSH in isoform 3. | VSP_040359 | |||||
| Alternative sequence | 94 – 131 | 38 | Missing in isoform 3. | VSP_040360 | |||||
| Alternative sequence | 276 | 1 | K → IKNEAASELPDTAENLPAMY PSISDLIIQFDLNKVVE in isoform 2. | VSP_014599 | |||||
| Alternative sequence | 392 | 1 | K → KEHLADDTGRGIIKGSINAQ LKGHQKTDK in isoform 2 and isoform 3. | VSP_014600 | |||||
| Natural variant | 388 | 1 | G → A. Ref.1 Ref.3 Corresponds to variant rs4448627 [ dbSNP | Ensembl ]. | VAR_033692 | |||||
| Natural variant | 510 | 1 | M → T. Corresponds to variant rs2504011 [ dbSNP | Ensembl ]. | VAR_024308 | |||||
| Natural variant | 607 | 1 | V → I. Ref.1 Ref.3 Corresponds to variant rs1418538 [ dbSNP | Ensembl ]. | VAR_033693 | |||||
Experimental info | |||||||||
| Sequence conflict | 39 | 1 | I → V in BAB14400. Ref.1 | ||||||
| Sequence conflict | 39 | 1 | I → V in AAI25092. Ref.3 | ||||||
| Sequence conflict | 100 | 1 | L → P in BAB14400. Ref.1 | ||||||
| Sequence conflict | 205 | 1 | N → S in BAB14400. Ref.1 | ||||||
| Sequence conflict | 326 | 1 | R → Q in BAC05140. Ref.1 | ||||||
| Sequence conflict | 530 | 1 | T → A in BAC05140. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-628 (ISOFORM 2), VARIANTS ALA-388 AND ILE-607. Tissue: Teratocarcinoma and Testis. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANTS ALA-388 AND ILE-607. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK023093 mRNA. Translation: BAB14400.1. AK097668 mRNA. Translation: BAC05140.1. AL356053 AL591850 Genomic DNA. Translation: CAQ06687.1.AL354750 AL591850 Genomic DNA. Translation: CAQ06850.1.AL365203 AL591850 Genomic DNA. Translation: CAQ08110.1.AL591850 AL365203 Genomic DNA. Translation: CAQ09810.1.BC125091 mRNA. Translation: AAI25092.1. |
| IPI | IPI00413658. IPI00607785. IPI00972981. |
| RefSeq | NP_078964.2. NM_024688.2. |
| UniGene | Hs.585464. |
3D structure databases | |
| ProteinModelPortal | Q9H943. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 68565303. |
Proteomic databases | |
| PRIDE | Q9H943. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000302316; ENSP00000303710; ENSG00000150076. |
| GeneID | 79741. |
| KEGG | hsa:79741. |
Organism-specific databases | |
| CTD | 79741. |
| GeneCards | GC10P032896. |
| HGNC | HGNC:25779. C10orf68. |
| HPA | HPA039300. |
| neXtProt | NX_Q9H943. |
| PharmGKB | PA134955273. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000004865. |
| HOVERGEN | HBG079994. |
| OrthoDB | EOG4548Z5. |
Gene expression databases | |
| ArrayExpress | Q9H943. |
| Bgee | Q9H943. |
| Genevestigator | Q9H943. |
| GermOnline | ENSG00000150076. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 69145. |
Entry information
| Entry name | CJ068_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H943 Secondary accession number(s): B0QZ71, Q08AN7, Q8N7T7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with