Q9H902 (REEP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Receptor expression-enhancing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 201 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for endoplasmic reticulum (ER) network formation, shaping and remodeling; it links ER tubules to the cytoskeleton. May also enhance the cell surface expression of odorant receptors. Ref.8 |
| Subunit structure | Interacts with SPAST and ATL1; it preferentially interacts with SPAST isoform 1. Interacts (via C-terminus) with microtubules. Interacts with odorant receptor proteins By similarity. Ref.8 |
| Subcellular location | Membrane. Mitochondrion membrane; Multi-pass membrane protein. Endoplasmic reticulum Ref.8 Ref.10. |
| Involvement in disease | Spastic paraplegia autosomal dominant 31 (SPG31) [MIM:610250]: A form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. Distal hereditary motor neuronopathy 5B (HMN5B) [MIM:614751]: A disorder characterized by distal muscular atrophy mainly affecting the upper extremities, in contrast to other distal motor neuronopathies. These constitute a heterogeneous group of neuromuscular diseases caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. HMN5B is characterized by onset in the first or second decade of distal muscle weakness and atrophy, primarily affecting the intrinsic hand muscles, but also affecting the lower legs, resulting in abnormal gait and pes cavus. |
| Sequence similarities | Belongs to the DP1 family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H902-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H902-2) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEY → MDHLQAGG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9H902-3) The sequence of this isoform differs from the canonical sequence as follows: 1-11: MVSWIISRLVV → MQKVLSNGQTEEVRSGSR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9H902-4) The sequence of this isoform differs from the canonical sequence as follows: 62-201: FPFYYELKIA...SESASSSGTA → DRVPYRRDCG...STSSSATETT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 201 | 201 | Receptor expression-enhancing protein 1 | PRO_0000101821 | |||||
Regions | |||||||||
| Transmembrane | 1 – 21 | 21 | Helical; Potential | ||||||
| Transmembrane | 35 – 55 | 21 | Helical; Potential | ||||||
| Compositional bias | 170 – 173 | 4 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 150 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 152 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 35 | 35 | MVSWI…DIKEY → MDHLQAGG in isoform 2. | VSP_042573 | |||||
| Alternative sequence | 1 – 11 | 11 | MVSWIISRLVV → MQKVLSNGQTEEVRSGSR in isoform 3. | VSP_043251 | |||||
| Alternative sequence | 62 – 201 | 140 | FPFYY…SSGTA → DRVPYRRDCGASACRTSPPS GETAPLLPRAPHHRGLGGPA ANTASLRCPGVLLRALAAQA PPRILRSRFRKKSTSSSATE TT in isoform 4. | VSP_043252 | |||||
| Natural variant | 19 | 1 | P → L in SPG31. Ref.12 | VAR_067265 | |||||
| Natural variant | 20 | 1 | A → E in SPG31; loss of function mutation; shows severely altered localization to numerous punctate small structures throughout the cytoplasm and no localization to the endoplasmic reticulum; does not colocalize with ATL1. Ref.9 Ref.10 Ref.11 | VAR_027351 | |||||
| Natural variant | 23 | 1 | S → F in SPG31. Ref.12 | VAR_067266 | |||||
| Natural variant | 42 | 1 | W → R in SPG31. Ref.12 | VAR_067267 | |||||
| Natural variant | 56 | 1 | D → N in SPG31. Ref.12 | VAR_067268 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "RTP family members induce functional expression of mammalian odorant receptors." Saito H., Kubota M., Roberts R.W., Chi Q., Matsunami H. Cell 119:679-691(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Brain. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [8] | "Hereditary spastic paraplegia proteins REEP1, spastin, and atlastin-1 coordinate microtubule interactions with the tubular ER network." Park S.H., Zhu P.P., Parker R.L., Blackstone C. J. Clin. Invest. 120:1097-1110(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SPAST; ATL1 AND MICROTUBULES. |
| [9] | "Exome sequencing identifies a REEP1 mutation involved in distal hereditary motor neuropathy type V." Beetz C., Pieber T.R., Hertel N., Schabhuttl M., Fischer C., Trajanoski S., Graf E., Keiner S., Kurth I., Wieland T., Varga R.E., Timmerman V., Reilly M.M., Strom T.M., Auer-Grumbach M. Am. J. Hum. Genet. 91:139-145(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN HMN5B, CHARACTERIZATION OF VARIANT SPG31 GLU-20. |
| [10] | "Mutations in the novel mitochondrial protein REEP1 cause hereditary spastic paraplegia type 31." Zuechner S., Wang G., Tran-Viet K.-N., Nance M.A., Gaskell P.C., Vance J.M., Ashley-Koch A.E., Pericak-Vance M.A. Am. J. Hum. Genet. 79:365-369(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPG31 GLU-20, SUBCELLULAR LOCATION. |
| [11] | "Mutation screening of spastin, atlastin, and REEP1 in hereditary spastic paraplegia." McCorquodale D.S. III, Ozomaro U., Huang J., Montenegro G., Kushman A., Citrigno L., Price J., Speziani F., Pericak-Vance M.A., Zuchner S. Clin. Genet. 79:523-530(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPG31 GLU-20. |
| [12] | "REEP1 mutations in SPG31: frequency, mutational spectrum, and potential association with mitochondrial morpho-functional dysfunction." Goizet C., Depienne C., Benard G., Boukhris A., Mundwiller E., Sole G., Coupry I., Pilliod J., Martin-Negrier M.L., Fedirko E., Forlani S., Cazeneuve C., Hannequin D., Charles P., Feki I., Pinel J.F., Ouvrard-Hernandez A.M., Lyonnet S. Stevanin G.Hum. Mutat. 32:1118-1127(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SPG31 LEU-19; PHE-23; ARG-42 AND ASN-56. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY562239 mRNA. Translation: AAT70684.1. AK023172 mRNA. Translation: BAB14444.1. AK297201 mRNA. Translation: BAH12523.1. AK297287 mRNA. Translation: BAH12538.1. AK299334 mRNA. Translation: BAH13005.1. CR457301 mRNA. Translation: CAG33582.1. AC009408 Genomic DNA. Translation: AAX93132.1. AC009309 Genomic DNA. No translation available. CH471053 Genomic DNA. Translation: EAW99457.1. CH471053 Genomic DNA. Translation: EAW99458.1. BC064846 mRNA. Translation: AAH64846.1. |
| IPI | IPI00009673. IPI00917387. IPI00922152. IPI00924625. |
| RefSeq | NP_001158202.1. NM_001164730.1. NP_001158203.1. NM_001164731.1. NP_001158204.1. NM_001164732.1. NP_075063.1. NM_022912.2. |
| UniGene | Hs.368884. |
3D structure databases | |
| ProteinModelPortal | Q9H902. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H902. 1 interaction. |
| STRING | 9606.ENSP00000165698. |
PTM databases | |
| PhosphoSite | Q9H902. |
Polymorphism databases | |
| DMDM | 74733929. |
Proteomic databases | |
| PaxDb | Q9H902. |
| PRIDE | Q9H902. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000165698; ENSP00000165698; ENSG00000068615. ENST00000535845; ENSP00000437567; ENSG00000068615. ENST00000538924; ENSP00000438346; ENSG00000068615. ENST00000541910; ENSP00000442681; ENSG00000068615. |
| GeneID | 65055. |
| KEGG | hsa:65055. |
| UCSC | uc002srh.4. human. |
Organism-specific databases | |
| CTD | 65055. |
| GeneCards | GC02M086441. |
| HGNC | HGNC:25786. REEP1. |
| MIM | 609139. gene. 610250. phenotype. 614751. phenotype. |
| neXtProt | NX_Q9H902. |
| Orphanet | 101011. Autosomal dominant spastic paraplegia type 31. 139536. Distal hereditary motor neuropathy type 5. |
| PharmGKB | PA134906680. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5052. |
| HOGENOM | HOG000007472. |
| HOVERGEN | HBG056861. |
| InParanoid | Q9H902. |
| OMA | RTSGKHG. |
| OrthoDB | EOG4D7Z6W. |
Gene expression databases | |
| ArrayExpress | Q9H902. |
| Bgee | Q9H902. |
| CleanEx | HS_REEP1. |
| Genevestigator | Q9H902. |
| GermOnline | ENSG00000068615. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004345. TB2_DP1_HVA22. [Graphical view] |
| PANTHER | PTHR12300. PTHR12300. 1 hit. |
| Pfam | PF03134. TB2_DP1_HVA22. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 65055. |
| NextBio | 67222. |
| SOURCE | Search... |
Entry information
| Entry name | REEP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H902 Secondary accession number(s): B7Z4D7 Q53TI0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
