Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Golgi reassembly-stacking protein 2

Gene

GORASP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the assembly and membrane stacking of the Golgi cisternae, and in the process by which Golgi stacks reform after mitotic breakdown. May regulate the intracellular transport and presentation of a defined set of transmembrane proteins, such as transmembrane TGFA.2 Publications

GO - Biological processi

  • organelle organization Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-162658. Golgi Cisternae Pericentriolar Stack Reorganization.

Names & Taxonomyi

Protein namesi
Recommended name:
Golgi reassembly-stacking protein 2
Short name:
GRS2
Alternative name(s):
Golgi phosphoprotein 6
Short name:
GOLPH6
Golgi reassembly-stacking protein of 55 kDa
Short name:
GRASP55
p59
Gene namesi
Name:GORASP2
Synonyms:GOLPH6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:17500. GORASP2.

Subcellular locationi

GO - Cellular componenti

  • Golgi apparatus Source: HPA
  • Golgi membrane Source: Reactome
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi59 – 591L → A: Abolishes organelle clustering; when associated with S-100. 1 Publication
Mutagenesisi100 – 1001I → S: Abolishes organelle clustering; when associated with A-59. 1 Publication
Mutagenesisi222 – 2221T → A: Abolishes mitotic phosphorylation; when associated with A-225. 1 Publication
Mutagenesisi225 – 2251T → A: Abolishes mitotic phosphorylation; when associated with A-222. 1 Publication

Organism-specific databases

PharmGKBiPA38457.

Polymorphism and mutation databases

BioMutaiGORASP2.
DMDMi51316097.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemoved2 Publications
Chaini2 – 452451Golgi reassembly-stacking protein 2PRO_0000087545Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycine1 Publication2 Publications
Modified residuei30 – 301Dimethylated arginine; alternateBy similarity
Modified residuei30 – 301Omega-N-methylated arginine; alternateBy similarity
Modified residuei47 – 471Dimethylated arginine; alternateBy similarity
Modified residuei47 – 471Omega-N-methylated arginine; alternateBy similarity
Modified residuei214 – 2141PhosphoserineCombined sources
Modified residuei222 – 2221PhosphothreonineCombined sources
Modified residuei225 – 2251PhosphothreonineCombined sources1 Publication
Modified residuei409 – 4091PhosphoserineBy similarity
Modified residuei415 – 4151PhosphothreonineCombined sources
Modified residuei433 – 4331PhosphothreonineCombined sources
Modified residuei436 – 4361PhosphoserineCombined sources
Modified residuei441 – 4411PhosphoserineBy similarity
Modified residuei449 – 4491PhosphoserineCombined sources
Modified residuei451 – 4511PhosphoserineCombined sources

Post-translational modificationi

Myristoylated. Myristoylation is essential for the Golgi targeting (By similarity).By similarity
Palmitoylated.1 Publication
Phosphorylated in mitotic cells.1 Publication

Keywords - PTMi

Lipoprotein, Methylation, Myristate, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ9H8Y8.
MaxQBiQ9H8Y8.
PaxDbiQ9H8Y8.
PeptideAtlasiQ9H8Y8.
PRIDEiQ9H8Y8.

PTM databases

iPTMnetiQ9H8Y8.
PhosphoSiteiQ9H8Y8.
SwissPalmiQ9H8Y8.

Expressioni

Gene expression databases

BgeeiENSG00000115806.
CleanExiHS_GORASP2.
ExpressionAtlasiQ9H8Y8. baseline and differential.
GenevisibleiQ9H8Y8. HS.

Organism-specific databases

HPAiHPA035274.
HPA035275.

Interactioni

Subunit structurei

Forms a RAB2 effector complex with BLZF1/Golgin 45 in the medial Golgi. Interacts with members of the p24 cargo receptors. Interacts with CNIH and the cytoplasmic domain of transmembrane TGFA, prior its transit in the trans-Golgi. Does not interact with GM130. Interacts with KCTD5. Interacts with TMED2 and TMED3 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Q99IB83EBI-739467,EBI-6927928From a different organism.
AAMDCQ9H7C93EBI-739467,EBI-10308705
ACY3Q96HD96EBI-739467,EBI-3916242
AESQ081173EBI-739467,EBI-717810
ARL6IP1Q150413EBI-739467,EBI-714543
BEND5Q7L4P63EBI-739467,EBI-724373
C1orf94Q6P1W53EBI-739467,EBI-946029
CBLBQ131914EBI-739467,EBI-744027
CCDC153Q494R43EBI-739467,EBI-10241443
CDC23Q9UJX23EBI-739467,EBI-396137
CFTRP135693EBI-739467,EBI-349854
CRYAAP024894EBI-739467,EBI-6875961
DCTDP323213EBI-739467,EBI-739870
DMC1Q145653EBI-739467,EBI-930865
DPYSL2Q165553EBI-739467,EBI-1104711
DUSP21Q9H5963EBI-739467,EBI-7357329
EIF2B1Q142323EBI-739467,EBI-491065
ENOX1Q8TC923EBI-739467,EBI-713221
GABPB2Q8TAK53EBI-739467,EBI-8468945
GOLGA2Q083794EBI-739467,EBI-618309
JADE2Q9NQC1-23EBI-739467,EBI-10311936
KCTD9Q7L2733EBI-739467,EBI-4397613
KIFC3Q9BVG83EBI-739467,EBI-2125614
LONRF1Q17RB83EBI-739467,EBI-2341787
MAP1LC3BQ9GZQ83EBI-739467,EBI-373144
MID2Q9UJV3-23EBI-739467,EBI-10172526
MORN2Q502X03EBI-739467,EBI-725982
ODC1P119265EBI-739467,EBI-1044287
PDE9AO760833EBI-739467,EBI-742764
PNMA5Q96PV43EBI-739467,EBI-10171633
PRDX3P300483EBI-739467,EBI-748336
PSMA3P257883EBI-739467,EBI-348380
RGS3P49796-83EBI-739467,EBI-10211517
RPIAP492474EBI-739467,EBI-744831
SCAND1P570863EBI-739467,EBI-745846
STOX1Q6ZVD73EBI-739467,EBI-3923644
TCF4P158843EBI-739467,EBI-533224
TEKT3Q9BXF94EBI-739467,EBI-8644516
TRAF1Q130773EBI-739467,EBI-359224
TRAF2Q129334EBI-739467,EBI-355744
TRAF4Q9BUZ43EBI-739467,EBI-3650647
TRAF5O004633EBI-739467,EBI-523498
TRIM38O006353EBI-739467,EBI-2130415
TXLNAP402223EBI-739467,EBI-359793
ZBTB14O438293EBI-739467,EBI-10176632
ZNF148Q9UQR13EBI-739467,EBI-2688184

Protein-protein interaction databases

BioGridi117479. 105 interactions.
IntActiQ9H8Y8. 69 interactions.
MINTiMINT-152892.
STRINGi9606.ENSP00000234160.

Structurei

Secondary structure

1
452
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi12 – 2211Combined sources
Helixi27 – 304Combined sources
Turni35 – 373Combined sources
Beta strandi38 – 436Combined sources
Beta strandi50 – 534Combined sources
Helixi54 – 618Combined sources
Turni62 – 643Combined sources
Beta strandi67 – 737Combined sources
Turni74 – 763Combined sources
Beta strandi79 – 846Combined sources
Beta strandi88 – 969Combined sources
Beta strandi98 – 1047Combined sources
Helixi108 – 1103Combined sources
Beta strandi113 – 1186Combined sources
Helixi123 – 1275Combined sources
Turni131 – 1333Combined sources
Beta strandi134 – 1418Combined sources
Beta strandi145 – 1473Combined sources
Helixi149 – 1557Combined sources
Turni156 – 1583Combined sources
Beta strandi161 – 1677Combined sources
Turni168 – 1714Combined sources
Beta strandi172 – 1787Combined sources
Beta strandi184 – 1907Combined sources
Beta strandi192 – 1954Combined sources
Helixi198 – 2003Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3RLEX-ray1.65A2-208[»]
4EDJX-ray1.90A/B1-208[»]
ProteinModelPortaliQ9H8Y8.
SMRiQ9H8Y8. Positions 7-208.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H8Y8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini5 – 7571PDZAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni194 – 1996Important for membrane binding

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi277 – 37296Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the GORASP family.Curated
Contains 1 PDZ (DHR) domain.Curated

Phylogenomic databases

eggNOGiKOG3834. Eukaryota.
COG5233. LUCA.
GeneTreeiENSGT00390000008686.
HOGENOMiHOG000231920.
HOVERGENiHBG051826.
InParanoidiQ9H8Y8.
OMAiADMVMNE.
OrthoDBiEOG091G0E90.
PhylomeDBiQ9H8Y8.
TreeFamiTF314053.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR024958. GRASP55/65_PDZ.
IPR007583. GRASP55_65.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR12893. PTHR12893. 1 hit.
PfamiPF04495. GRASP55_65. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H8Y8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSSQSVEIP GGGTEGYHVL RVQENSPGHR AGLEPFFDFI VSINGSRLNK
60 70 80 90 100
DNDTLKDLLK ANVEKPVKML IYSSKTLELR ETSVTPSNLW GGQGLLGVSI
110 120 130 140 150
RFCSFDGANE NVWHVLEVES NSPAALAGLR PHSDYIIGAD TVMNESEDLF
160 170 180 190 200
SLIETHEAKP LKLYVYNTDT DNCREVIITP NSAWGGEGSL GCGIGYGYLH
210 220 230 240 250
RIPTRPFEEG KKISLPGQMA GTPITPLKDG FTEVQLSSVN PPSLSPPGTT
260 270 280 290 300
GIEQSLTGLS ISSTPPAVSS VLSTGVPTVP LLPPQVNQSL TSVPPMNPAT
310 320 330 340 350
TLPGLMPLPA GLPNLPNLNL NLPAPHIMPG VGLPELVNPG LPPLPSMPPR
360 370 380 390 400
NLPGIAPLPL PSEFLPSFPL VPESSSAASS GELLSSLPPT SNAPSDPATT
410 420 430 440 450
TAKADAASSL TVDVTPPTAK APTTVEDRVG DSTPVSEKPV SAAVDANASE

SP
Length:452
Mass (Da):47,145
Last modified:January 23, 2007 - v3
Checksum:i326EA6C107D2EA8B
GO
Isoform 2 (identifier: Q9H8Y8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.

Show »
Length:384
Mass (Da):39,768
Checksum:i707E11F2C55B7BDA
GO
Isoform 3 (identifier: Q9H8Y8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MGSSQSVEIPGGGTEGYHVLR → MREGSSTLSEIRKLKPGIMVCTCNPSYSNQETE

Note: No experimental confirmation available.
Show »
Length:464
Mass (Da):48,674
Checksum:iF6A0C68893A94434
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti20 – 201L → Q in BAB14459 (PubMed:14702039).Curated
Sequence conflicti34 – 341E → G in BAB14395 (PubMed:14702039).Curated
Sequence conflicti83 – 831S → P AA sequence (PubMed:11101516).Curated
Sequence conflicti299 – 2991A → T in BAB14395 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti432 – 4321S → F.1 Publication
Corresponds to variant rs3770436 [ dbSNP | Ensembl ].
VAR_051013

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868Missing in isoform 2. 1 PublicationVSP_011300Add
BLAST
Alternative sequencei1 – 2121MGSSQ…YHVLR → MREGSSTLSEIRKLKPGIMV CTCNPSYSNQETE in isoform 3. 1 PublicationVSP_054364Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027349 mRNA. Translation: BAB55054.1.
AK023082 mRNA. Translation: BAB14395.1.
AK023201 mRNA. Translation: BAB14459.1.
AK296698 mRNA. Translation: BAG59292.1.
AL117430 mRNA. Translation: CAB55919.1.
AC010092 Genomic DNA. Translation: AAY15076.1.
CH471058 Genomic DNA. Translation: EAX11227.1.
BC007770 mRNA. Translation: AAH07770.1.
CCDSiCCDS33325.1. [Q9H8Y8-1]
PIRiT17229.
RefSeqiNP_001188357.1. NM_001201428.1. [Q9H8Y8-2]
NP_056345.3. NM_015530.4. [Q9H8Y8-1]
XP_006712471.1. XM_006712408.2. [Q9H8Y8-2]
UniGeneiHs.431317.

Genome annotation databases

EnsembliENST00000234160; ENSP00000234160; ENSG00000115806. [Q9H8Y8-1]
GeneIDi26003.
KEGGihsa:26003.
UCSCiuc002ugk.4. human. [Q9H8Y8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027349 mRNA. Translation: BAB55054.1.
AK023082 mRNA. Translation: BAB14395.1.
AK023201 mRNA. Translation: BAB14459.1.
AK296698 mRNA. Translation: BAG59292.1.
AL117430 mRNA. Translation: CAB55919.1.
AC010092 Genomic DNA. Translation: AAY15076.1.
CH471058 Genomic DNA. Translation: EAX11227.1.
BC007770 mRNA. Translation: AAH07770.1.
CCDSiCCDS33325.1. [Q9H8Y8-1]
PIRiT17229.
RefSeqiNP_001188357.1. NM_001201428.1. [Q9H8Y8-2]
NP_056345.3. NM_015530.4. [Q9H8Y8-1]
XP_006712471.1. XM_006712408.2. [Q9H8Y8-2]
UniGeneiHs.431317.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3RLEX-ray1.65A2-208[»]
4EDJX-ray1.90A/B1-208[»]
ProteinModelPortaliQ9H8Y8.
SMRiQ9H8Y8. Positions 7-208.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117479. 105 interactions.
IntActiQ9H8Y8. 69 interactions.
MINTiMINT-152892.
STRINGi9606.ENSP00000234160.

PTM databases

iPTMnetiQ9H8Y8.
PhosphoSiteiQ9H8Y8.
SwissPalmiQ9H8Y8.

Polymorphism and mutation databases

BioMutaiGORASP2.
DMDMi51316097.

Proteomic databases

EPDiQ9H8Y8.
MaxQBiQ9H8Y8.
PaxDbiQ9H8Y8.
PeptideAtlasiQ9H8Y8.
PRIDEiQ9H8Y8.

Protocols and materials databases

DNASUi26003.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000234160; ENSP00000234160; ENSG00000115806. [Q9H8Y8-1]
GeneIDi26003.
KEGGihsa:26003.
UCSCiuc002ugk.4. human. [Q9H8Y8-1]

Organism-specific databases

CTDi26003.
GeneCardsiGORASP2.
HGNCiHGNC:17500. GORASP2.
HPAiHPA035274.
HPA035275.
MIMi608693. gene.
neXtProtiNX_Q9H8Y8.
PharmGKBiPA38457.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3834. Eukaryota.
COG5233. LUCA.
GeneTreeiENSGT00390000008686.
HOGENOMiHOG000231920.
HOVERGENiHBG051826.
InParanoidiQ9H8Y8.
OMAiADMVMNE.
OrthoDBiEOG091G0E90.
PhylomeDBiQ9H8Y8.
TreeFamiTF314053.

Enzyme and pathway databases

ReactomeiR-HSA-162658. Golgi Cisternae Pericentriolar Stack Reorganization.

Miscellaneous databases

ChiTaRSiGORASP2. human.
EvolutionaryTraceiQ9H8Y8.
GeneWikiiGORASP2.
GenomeRNAii26003.
PROiQ9H8Y8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115806.
CleanExiHS_GORASP2.
ExpressionAtlasiQ9H8Y8. baseline and differential.
GenevisibleiQ9H8Y8. HS.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR024958. GRASP55/65_PDZ.
IPR007583. GRASP55_65.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR12893. PTHR12893. 1 hit.
PfamiPF04495. GRASP55_65. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiGORS2_HUMAN
AccessioniPrimary (citable) accession number: Q9H8Y8
Secondary accession number(s): B4DKT0
, Q53TE3, Q96I74, Q96K84, Q9H946, Q9UFW4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.