Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NIPA-like protein 2

Gene

NIPAL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. magnesium ion transmembrane transporter activity Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
NIPA-like protein 2
Gene namesi
Name:NIPAL2
Synonyms:NPAL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:25854. NIPAL2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei46 – 6621HelicalSequence AnalysisAdd
BLAST
Transmembranei88 – 10821HelicalSequence AnalysisAdd
BLAST
Transmembranei110 – 13021HelicalSequence AnalysisAdd
BLAST
Transmembranei144 – 16421HelicalSequence AnalysisAdd
BLAST
Transmembranei177 – 19721HelicalSequence AnalysisAdd
BLAST
Transmembranei209 – 22921HelicalSequence AnalysisAdd
BLAST
Transmembranei243 – 26321HelicalSequence AnalysisAdd
BLAST
Transmembranei278 – 29821HelicalSequence AnalysisAdd
BLAST
Transmembranei306 – 32621HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164723926.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 368368NIPA-like protein 2PRO_0000242148Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi274 – 2741N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9H841.
PRIDEiQ9H841.

Expressioni

Gene expression databases

BgeeiQ9H841.
CleanExiHS_NPAL2.
ExpressionAtlasiQ9H841. baseline and differential.
GenevestigatoriQ9H841.

Structurei

3D structure databases

ProteinModelPortaliQ9H841.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NIPA family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG249324.
GeneTreeiENSGT00550000074395.
HOGENOMiHOG000230865.
HOVERGENiHBG069791.
InParanoidiQ9H841.
OMAiIIMIASC.
PhylomeDBiQ9H841.
TreeFamiTF313214.

Family and domain databases

InterProiIPR008521. Mg_trans_NIPA.
[Graphical view]
PANTHERiPTHR12570. PTHR12570. 1 hit.
PfamiPF05653. Mg_trans_NIPA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H841-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAVAPAGPG DSASAALDEL SLNFTYGAPG AGNGSLSGDW YRRNQIHLFG
60 70 80 90 100
VLLAILGNLV ISISLNIQKY SHLQLAQQEH PRPYFKSVLW WGGVLLMAVG
110 120 130 140 150
ETGNFAAYGF APITLIAPLG CVSVTGSAII SVTFLKDNLR ASDLLGTTLA
160 170 180 190 200
FAGTYLLVNF APNITQAISA RTVQYYLVGW QFLIYVILEI LIFCILLYFY
210 220 230 240 250
KRKGMKHMVI LLTLVAILAS LTVISVKAVS GMITFSVMDK MQLTYPIFYI
260 270 280 290 300
MFIIMIASCV FQVKFLNQAT KLYNTTTVVP VNHIFFTISA IIAGIIFYQE
310 320 330 340 350
FLGAPFLTVF IYLFGCFLSF LGVFLVTRNR EKEHLQQSYI DFGNIPDTTP
360
ERKAWRETNV GQNTTRFT
Length:368
Mass (Da):40,785
Last modified:March 1, 2001 - v1
Checksum:i8221F45E85273782
GO
Isoform 2 (identifier: Q9H841-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-368: DTTPERKAWRETNVGQNTTRFT → GKQMLDKIQPDSHSLSYGTLPDGSDSTKSQSGEKKEV

Note: No experimental confirmation available.

Show »
Length:383
Mass (Da):42,156
Checksum:i663D9E818093D5E7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei347 – 36822DTTPE…TTRFT → GKQMLDKIQPDSHSLSYGTL PDGSDSTKSQSGEKKEV in isoform 2. 1 PublicationVSP_056271Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024017 mRNA. Translation: BAB14779.1.
AP003438 Genomic DNA. No translation available.
AP003439 Genomic DNA. No translation available.
BC132687 mRNA. Translation: AAI32688.1.
BC144055 mRNA. Translation: AAI44056.1.
CCDSiCCDS6278.1. [Q9H841-1]
RefSeqiNP_079035.1. NM_024759.1. [Q9H841-1]
UniGeneiHs.309489.

Genome annotation databases

EnsembliENST00000341166; ENSP00000339256; ENSG00000104361. [Q9H841-1]
ENST00000430223; ENSP00000407087; ENSG00000104361. [Q9H841-2]
GeneIDi79815.
KEGGihsa:79815.
UCSCiuc003yil.1. human. [Q9H841-1]
uc003yim.1. human.

Polymorphism databases

DMDMi74733759.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024017 mRNA. Translation: BAB14779.1.
AP003438 Genomic DNA. No translation available.
AP003439 Genomic DNA. No translation available.
BC132687 mRNA. Translation: AAI32688.1.
BC144055 mRNA. Translation: AAI44056.1.
CCDSiCCDS6278.1. [Q9H841-1]
RefSeqiNP_079035.1. NM_024759.1. [Q9H841-1]
UniGeneiHs.309489.

3D structure databases

ProteinModelPortaliQ9H841.
ModBaseiSearch...
MobiDBiSearch...

Polymorphism databases

DMDMi74733759.

Proteomic databases

PaxDbiQ9H841.
PRIDEiQ9H841.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341166; ENSP00000339256; ENSG00000104361. [Q9H841-1]
ENST00000430223; ENSP00000407087; ENSG00000104361. [Q9H841-2]
GeneIDi79815.
KEGGihsa:79815.
UCSCiuc003yil.1. human. [Q9H841-1]
uc003yim.1. human.

Organism-specific databases

CTDi79815.
GeneCardsiGC08M099202.
HGNCiHGNC:25854. NIPAL2.
neXtProtiNX_Q9H841.
PharmGKBiPA164723926.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG249324.
GeneTreeiENSGT00550000074395.
HOGENOMiHOG000230865.
HOVERGENiHBG069791.
InParanoidiQ9H841.
OMAiIIMIASC.
PhylomeDBiQ9H841.
TreeFamiTF313214.

Miscellaneous databases

ChiTaRSiNIPAL2. human.
GenomeRNAii79815.
NextBioi35461299.
PROiQ9H841.

Gene expression databases

BgeeiQ9H841.
CleanExiHS_NPAL2.
ExpressionAtlasiQ9H841. baseline and differential.
GenevestigatoriQ9H841.

Family and domain databases

InterProiIPR008521. Mg_trans_NIPA.
[Graphical view]
PANTHERiPTHR12570. PTHR12570. 1 hit.
PfamiPF05653. Mg_trans_NIPA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiNPAL2_HUMAN
AccessioniPrimary (citable) accession number: Q9H841
Secondary accession number(s): A2RTY8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: March 1, 2001
Last modified: January 7, 2015
This is version 74 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.