Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NIPA-like protein 2

Gene

NIPAL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-5223345. Miscellaneous transport and binding events.

Names & Taxonomyi

Protein namesi
Recommended name:
NIPA-like protein 2
Gene namesi
Name:NIPAL2
Synonyms:NPAL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000104361.9.
HGNCiHGNC:25854. NIPAL2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei46 – 66HelicalSequence analysisAdd BLAST21
Transmembranei88 – 108HelicalSequence analysisAdd BLAST21
Transmembranei110 – 130HelicalSequence analysisAdd BLAST21
Transmembranei144 – 164HelicalSequence analysisAdd BLAST21
Transmembranei177 – 197HelicalSequence analysisAdd BLAST21
Transmembranei209 – 229HelicalSequence analysisAdd BLAST21
Transmembranei243 – 263HelicalSequence analysisAdd BLAST21
Transmembranei278 – 298HelicalSequence analysisAdd BLAST21
Transmembranei306 – 326HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi79815.
OpenTargetsiENSG00000104361.
PharmGKBiPA164723926.

Polymorphism and mutation databases

BioMutaiNIPAL2.
DMDMi74733759.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002421481 – 368NIPA-like protein 2Add BLAST368

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi274N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9H841.
PeptideAtlasiQ9H841.
PRIDEiQ9H841.

Expressioni

Gene expression databases

BgeeiENSG00000104361.
CleanExiHS_NPAL2.
GenevisibleiQ9H841. HS.

Organism-specific databases

HPAiHPA071759.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000339256.

Structurei

3D structure databases

ProteinModelPortaliQ9H841.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NIPA family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2922. Eukaryota.
ENOG410XNR8. LUCA.
GeneTreeiENSGT00550000074395.
HOGENOMiHOG000230865.
HOVERGENiHBG069791.
InParanoidiQ9H841.
OMAiGNIPGKQ.
OrthoDBiEOG091G09Z6.
PhylomeDBiQ9H841.
TreeFamiTF313214.

Family and domain databases

InterProiView protein in InterPro
IPR008521. Mg_trans_NIPA.
PANTHERiPTHR12570. PTHR12570. 1 hit.
PfamiView protein in Pfam
PF05653. Mg_trans_NIPA. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H841-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAVAPAGPG DSASAALDEL SLNFTYGAPG AGNGSLSGDW YRRNQIHLFG
60 70 80 90 100
VLLAILGNLV ISISLNIQKY SHLQLAQQEH PRPYFKSVLW WGGVLLMAVG
110 120 130 140 150
ETGNFAAYGF APITLIAPLG CVSVTGSAII SVTFLKDNLR ASDLLGTTLA
160 170 180 190 200
FAGTYLLVNF APNITQAISA RTVQYYLVGW QFLIYVILEI LIFCILLYFY
210 220 230 240 250
KRKGMKHMVI LLTLVAILAS LTVISVKAVS GMITFSVMDK MQLTYPIFYI
260 270 280 290 300
MFIIMIASCV FQVKFLNQAT KLYNTTTVVP VNHIFFTISA IIAGIIFYQE
310 320 330 340 350
FLGAPFLTVF IYLFGCFLSF LGVFLVTRNR EKEHLQQSYI DFGNIPDTTP
360
ERKAWRETNV GQNTTRFT
Length:368
Mass (Da):40,785
Last modified:March 1, 2001 - v1
Checksum:i8221F45E85273782
GO
Isoform 2 (identifier: Q9H841-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-368: DTTPERKAWRETNVGQNTTRFT → GKQMLDKIQPDSHSLSYGTLPDGSDSTKSQSGEKKEV

Note: No experimental confirmation available.
Show »
Length:383
Mass (Da):42,156
Checksum:i663D9E818093D5E7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056271347 – 368DTTPE…TTRFT → GKQMLDKIQPDSHSLSYGTL PDGSDSTKSQSGEKKEV in isoform 2. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024017 mRNA. Translation: BAB14779.1.
AP003438 Genomic DNA. No translation available.
AP003439 Genomic DNA. No translation available.
BC132687 mRNA. Translation: AAI32688.1.
BC144055 mRNA. Translation: AAI44056.1.
CCDSiCCDS6278.1. [Q9H841-1]
CCDS83310.1. [Q9H841-2]
RefSeqiNP_001308564.1. NM_001321635.1. [Q9H841-2]
NP_001308565.1. NM_001321636.1.
NP_079035.1. NM_024759.2. [Q9H841-1]
UniGeneiHs.309489.
Hs.732714.

Genome annotation databases

EnsembliENST00000341166; ENSP00000339256; ENSG00000104361. [Q9H841-1]
ENST00000430223; ENSP00000407087; ENSG00000104361. [Q9H841-2]
GeneIDi79815.
KEGGihsa:79815.
UCSCiuc003yil.2. human. [Q9H841-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNPAL2_HUMAN
AccessioniPrimary (citable) accession number: Q9H841
Secondary accession number(s): A2RTY8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: March 1, 2001
Last modified: September 27, 2017
This is version 95 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families