Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H841

- NPAL2_HUMAN

UniProt

Q9H841 - NPAL2_HUMAN

Protein

NIPA-like protein 2

Gene

NIPAL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 71 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. magnesium ion transmembrane transporter activity Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NIPA-like protein 2
    Gene namesi
    Name:NIPAL2
    Synonyms:NPAL2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:25854. NIPAL2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164723926.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 368368NIPA-like protein 2PRO_0000242148Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi274 – 2741N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9H841.
    PRIDEiQ9H841.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9H841.
    BgeeiQ9H841.
    CleanExiHS_NPAL2.
    GenevestigatoriQ9H841.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H841.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei46 – 6621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei88 – 10821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei110 – 13021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei144 – 16421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei177 – 19721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei209 – 22921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei243 – 26321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei278 – 29821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei306 – 32621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the NIPA family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG249324.
    HOGENOMiHOG000230865.
    HOVERGENiHBG069791.
    InParanoidiQ9H841.
    PhylomeDBiQ9H841.
    TreeFamiTF313214.

    Family and domain databases

    InterProiIPR008521. Mg_trans_NIPA.
    [Graphical view]
    PANTHERiPTHR12570. PTHR12570. 1 hit.
    PfamiPF05653. Mg_trans_NIPA. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H841-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAVAPAGPG DSASAALDEL SLNFTYGAPG AGNGSLSGDW YRRNQIHLFG    50
    VLLAILGNLV ISISLNIQKY SHLQLAQQEH PRPYFKSVLW WGGVLLMAVG 100
    ETGNFAAYGF APITLIAPLG CVSVTGSAII SVTFLKDNLR ASDLLGTTLA 150
    FAGTYLLVNF APNITQAISA RTVQYYLVGW QFLIYVILEI LIFCILLYFY 200
    KRKGMKHMVI LLTLVAILAS LTVISVKAVS GMITFSVMDK MQLTYPIFYI 250
    MFIIMIASCV FQVKFLNQAT KLYNTTTVVP VNHIFFTISA IIAGIIFYQE 300
    FLGAPFLTVF IYLFGCFLSF LGVFLVTRNR EKEHLQQSYI DFGNIPDTTP 350
    ERKAWRETNV GQNTTRFT 368
    Length:368
    Mass (Da):40,785
    Last modified:March 1, 2001 - v1
    Checksum:i8221F45E85273782
    GO
    Isoform 2 (identifier: Q9H841-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         347-368: DTTPERKAWRETNVGQNTTRFT → GKQMLDKIQPDSHSLSYGTLPDGSDSTKSQSGEKKEV

    Note: No experimental confirmation available.

    Show »
    Length:383
    Mass (Da):42,156
    Checksum:i663D9E818093D5E7
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei347 – 36822DTTPE…TTRFT → GKQMLDKIQPDSHSLSYGTL PDGSDSTKSQSGEKKEV in isoform 2. 1 PublicationVSP_056271Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024017 mRNA. Translation: BAB14779.1.
    AP003438 Genomic DNA. No translation available.
    AP003439 Genomic DNA. No translation available.
    BC132687 mRNA. Translation: AAI32688.1.
    BC144055 mRNA. Translation: AAI44056.1.
    CCDSiCCDS6278.1.
    RefSeqiNP_079035.1. NM_024759.1.
    UniGeneiHs.309489.

    Genome annotation databases

    EnsembliENST00000341166; ENSP00000339256; ENSG00000104361.
    ENST00000430223; ENSP00000407087; ENSG00000104361.
    GeneIDi79815.
    KEGGihsa:79815.
    UCSCiuc003yil.1. human.

    Polymorphism databases

    DMDMi74733759.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024017 mRNA. Translation: BAB14779.1 .
    AP003438 Genomic DNA. No translation available.
    AP003439 Genomic DNA. No translation available.
    BC132687 mRNA. Translation: AAI32688.1 .
    BC144055 mRNA. Translation: AAI44056.1 .
    CCDSi CCDS6278.1.
    RefSeqi NP_079035.1. NM_024759.1.
    UniGenei Hs.309489.

    3D structure databases

    ProteinModelPortali Q9H841.
    ModBasei Search...
    MobiDBi Search...

    Polymorphism databases

    DMDMi 74733759.

    Proteomic databases

    PaxDbi Q9H841.
    PRIDEi Q9H841.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000341166 ; ENSP00000339256 ; ENSG00000104361 .
    ENST00000430223 ; ENSP00000407087 ; ENSG00000104361 .
    GeneIDi 79815.
    KEGGi hsa:79815.
    UCSCi uc003yil.1. human.

    Organism-specific databases

    CTDi 79815.
    GeneCardsi GC08M099278.
    HGNCi HGNC:25854. NIPAL2.
    neXtProti NX_Q9H841.
    PharmGKBi PA164723926.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG249324.
    HOGENOMi HOG000230865.
    HOVERGENi HBG069791.
    InParanoidi Q9H841.
    PhylomeDBi Q9H841.
    TreeFami TF313214.

    Miscellaneous databases

    GenomeRNAii 79815.
    NextBioi 69418.
    PROi Q9H841.

    Gene expression databases

    ArrayExpressi Q9H841.
    Bgeei Q9H841.
    CleanExi HS_NPAL2.
    Genevestigatori Q9H841.

    Family and domain databases

    InterProi IPR008521. Mg_trans_NIPA.
    [Graphical view ]
    PANTHERi PTHR12570. PTHR12570. 1 hit.
    Pfami PF05653. Mg_trans_NIPA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

    Entry informationi

    Entry nameiNPAL2_HUMAN
    AccessioniPrimary (citable) accession number: Q9H841
    Secondary accession number(s): A2RTY8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 71 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3