Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 206

Gene

TMEM206

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 206
Gene namesi
Name:TMEM206
Synonyms:C1orf75
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000065600.12
HGNCiHGNC:25593 TMEM206
neXtProtiNX_Q9H813

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 64CytoplasmicSequence analysisAdd BLAST64
Transmembranei65 – 85HelicalSequence analysisAdd BLAST21
Topological domaini86 – 301ExtracellularSequence analysisAdd BLAST216
Transmembranei302 – 318HelicalSequence analysisAdd BLAST17
Topological domaini319 – 350CytoplasmicSequence analysisAdd BLAST32

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000065600
PharmGKBiPA162406386

Polymorphism and mutation databases

BioMutaiTMEM206
DMDMi74752717

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002794711 – 350Transmembrane protein 206Add BLAST350

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei9PhosphoserineCombined sources1
Modified residuei10PhosphotyrosineBy similarity1
Modified residuei14PhosphoserineBy similarity1
Modified residuei24PhosphoserineBy similarity1
Glycosylationi155N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi162N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9H813
MaxQBiQ9H813
PaxDbiQ9H813
PeptideAtlasiQ9H813
PRIDEiQ9H813

PTM databases

iPTMnetiQ9H813
PhosphoSitePlusiQ9H813
SwissPalmiQ9H813

Expressioni

Gene expression databases

BgeeiENSG00000065600
CleanExiHS_TMEM206
GenevisibleiQ9H813 HS

Organism-specific databases

HPAiHPA008540

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PLP2Q049414EBI-4319734,EBI-608347

Protein-protein interaction databases

BioGridi120539, 106 interactors
IntActiQ9H813, 6 interactors

Structurei

3D structure databases

ProteinModelPortaliQ9H813
SMRiQ9H813
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TMEM206 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGZU Eukaryota
ENOG410XTG6 LUCA
GeneTreeiENSGT00390000017528
HOGENOMiHOG000154621
HOVERGENiHBG057560
InParanoidiQ9H813
OMAiKHPVMSV
OrthoDBiEOG091G09KN
PhylomeDBiQ9H813
TreeFamiTF333307

Family and domain databases

InterProiView protein in InterPro
IPR029366 TMEM206
PANTHERiPTHR16087 PTHR16087, 1 hit
PfamiView protein in Pfam
PF15122 TMEM206, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H813-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIRQERSTSY QELSEELVQV VENSELADEQ DKETVRVQGP GILPGLDSES
60 70 80 90 100
ASSSIRFSKA CLKNVFSVLL IFIYLLLMAV AVFLVYRTIT DFREKLKHPV
110 120 130 140 150
MSVSYKEVDR YDAPGIALYP GQAQLLSCKH HYEVIPPLTS PGQPGDMNCT
160 170 180 190 200
TQRINYTDPF SNQTVKSALI VQGPREVKKR ELVFLQFRLN KSSEDFSAID
210 220 230 240 250
YLLFSSFQEF LQSPNRVGFM QACESAYSSW KFSGGFRTWV KMSLVKTKEE
260 270 280 290 300
DGREAVEFRQ ETSVVNYIDQ RPAAKKSAQL FFVVFEWKDP FIQKVQDIVT
310 320 330 340 350
ANPWNTIALL CGAFLALFKA AEFAKLSIKW MIKIRKRYLK RRGQATSHIS
Length:350
Mass (Da):40,043
Last modified:March 1, 2001 - v1
Checksum:i5F68ACA21DDD0674
GO
Isoform 2 (identifier: Q9H813-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-12: E → EAVRPALPSSKPCLLTSPAVLVKLLSSSASTSRPPNLGHLWQPSSSVPLHRAASLAKVRQFQ

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):46,468
Checksum:i99559672E8B735EB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti11 – 12QE → RV in CAG33549 (Ref. 2) Curated2
Sequence conflicti23N → S in BAA91870 (PubMed:14702039).Curated1
Sequence conflicti47D → G in CAG33549 (Ref. 2) Curated1
Sequence conflicti227Y → C in BAA91870 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035847336K → N in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1034429230Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04288712E → EAVRPALPSSKPCLLTSPAV LVKLLSSSASTSRPPNLGHL WQPSSSVPLHRAASLAKVRQ FQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001736 mRNA Translation: BAA91870.1
AK024066 mRNA Translation: BAB14810.1
AK297200 mRNA Translation: BAH12522.1
CR457268 mRNA Translation: CAG33549.1
AC092803 Genomic DNA No translation available.
AL360091 Genomic DNA No translation available.
BC006320 mRNA Translation: AAH06320.1
CCDSiCCDS1504.1 [Q9H813-1]
CCDS55687.1 [Q9H813-2]
RefSeqiNP_001185791.1, NM_001198862.1 [Q9H813-2]
NP_060722.2, NM_018252.2 [Q9H813-1]
UniGeneiHs.445386

Genome annotation databases

EnsembliENST00000261455; ENSP00000261455; ENSG00000065600 [Q9H813-1]
ENST00000535273; ENSP00000438863; ENSG00000065600 [Q9H813-2]
GeneIDi55248
KEGGihsa:55248
UCSCiuc001hjc.5 human [Q9H813-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTM206_HUMAN
AccessioniPrimary (citable) accession number: Q9H813
Secondary accession number(s): B7Z4D6, Q6IA87, Q9NV85
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: March 1, 2001
Last modified: May 23, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health