Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 206

Gene

TMEM206

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 206
Gene namesi
Name:TMEM206
Synonyms:C1orf75
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000065600.12.
HGNCiHGNC:25593. TMEM206.
neXtProtiNX_Q9H813.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 64CytoplasmicSequence analysisAdd BLAST64
Transmembranei65 – 85HelicalSequence analysisAdd BLAST21
Topological domaini86 – 301ExtracellularSequence analysisAdd BLAST216
Transmembranei302 – 318HelicalSequence analysisAdd BLAST17
Topological domaini319 – 350CytoplasmicSequence analysisAdd BLAST32

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000065600.
PharmGKBiPA162406386.

Polymorphism and mutation databases

BioMutaiTMEM206.
DMDMi74752717.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002794711 – 350Transmembrane protein 206Add BLAST350

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei9PhosphoserineCombined sources1
Modified residuei10PhosphotyrosineBy similarity1
Modified residuei14PhosphoserineBy similarity1
Modified residuei24PhosphoserineBy similarity1
Glycosylationi155N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi162N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9H813.
MaxQBiQ9H813.
PaxDbiQ9H813.
PeptideAtlasiQ9H813.
PRIDEiQ9H813.

PTM databases

iPTMnetiQ9H813.
PhosphoSitePlusiQ9H813.
SwissPalmiQ9H813.

Expressioni

Gene expression databases

BgeeiENSG00000065600.
CleanExiHS_TMEM206.
GenevisibleiQ9H813. HS.

Organism-specific databases

HPAiHPA008540.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PLP2Q049414EBI-4319734,EBI-608347

Protein-protein interaction databases

BioGridi120539. 106 interactors.
IntActiQ9H813. 6 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ9H813.
SMRiQ9H813.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TMEM206 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGZU. Eukaryota.
ENOG410XTG6. LUCA.
GeneTreeiENSGT00390000017528.
HOGENOMiHOG000154621.
HOVERGENiHBG057560.
InParanoidiQ9H813.
OMAiKHPVMSV.
OrthoDBiEOG091G09KN.
PhylomeDBiQ9H813.
TreeFamiTF333307.

Family and domain databases

InterProiView protein in InterPro
IPR029366. TMEM206.
PANTHERiPTHR16087. PTHR16087. 1 hit.
PfamiView protein in Pfam
PF15122. TMEM206. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H813-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIRQERSTSY QELSEELVQV VENSELADEQ DKETVRVQGP GILPGLDSES
60 70 80 90 100
ASSSIRFSKA CLKNVFSVLL IFIYLLLMAV AVFLVYRTIT DFREKLKHPV
110 120 130 140 150
MSVSYKEVDR YDAPGIALYP GQAQLLSCKH HYEVIPPLTS PGQPGDMNCT
160 170 180 190 200
TQRINYTDPF SNQTVKSALI VQGPREVKKR ELVFLQFRLN KSSEDFSAID
210 220 230 240 250
YLLFSSFQEF LQSPNRVGFM QACESAYSSW KFSGGFRTWV KMSLVKTKEE
260 270 280 290 300
DGREAVEFRQ ETSVVNYIDQ RPAAKKSAQL FFVVFEWKDP FIQKVQDIVT
310 320 330 340 350
ANPWNTIALL CGAFLALFKA AEFAKLSIKW MIKIRKRYLK RRGQATSHIS
Length:350
Mass (Da):40,043
Last modified:March 1, 2001 - v1
Checksum:i5F68ACA21DDD0674
GO
Isoform 2 (identifier: Q9H813-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-12: E → EAVRPALPSSKPCLLTSPAVLVKLLSSSASTSRPPNLGHLWQPSSSVPLHRAASLAKVRQFQ

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):46,468
Checksum:i99559672E8B735EB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti11 – 12QE → RV in CAG33549 (Ref. 2) Curated2
Sequence conflicti23N → S in BAA91870 (PubMed:14702039).Curated1
Sequence conflicti47D → G in CAG33549 (Ref. 2) Curated1
Sequence conflicti227Y → C in BAA91870 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035847336K → N in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1034429230Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04288712E → EAVRPALPSSKPCLLTSPAV LVKLLSSSASTSRPPNLGHL WQPSSSVPLHRAASLAKVRQ FQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001736 mRNA. Translation: BAA91870.1.
AK024066 mRNA. Translation: BAB14810.1.
AK297200 mRNA. Translation: BAH12522.1.
CR457268 mRNA. Translation: CAG33549.1.
AL360091, AC092803 Genomic DNA. Translation: CAH73228.1.
BC006320 mRNA. Translation: AAH06320.1.
CCDSiCCDS1504.1. [Q9H813-1]
CCDS55687.1. [Q9H813-2]
RefSeqiNP_001185791.1. NM_001198862.1. [Q9H813-2]
NP_060722.2. NM_018252.2. [Q9H813-1]
UniGeneiHs.445386.

Genome annotation databases

EnsembliENST00000261455; ENSP00000261455; ENSG00000065600. [Q9H813-1]
ENST00000535273; ENSP00000438863; ENSG00000065600. [Q9H813-2]
GeneIDi55248.
KEGGihsa:55248.
UCSCiuc001hjc.5. human. [Q9H813-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTM206_HUMAN
AccessioniPrimary (citable) accession number: Q9H813
Secondary accession number(s): B7Z4D6, Q6IA87, Q9NV85
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: March 1, 2001
Last modified: December 20, 2017
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families